Donate
   
Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Grammar Search
"vi" has 2 results
vi: neuter nominative singular stem:
vi: neuter accusative singular stem:
Root Search
vi has 1 results
        Root Word (Pāṇini Dhātupāṭha:)Full Root MarkerSenseClassSutra
√vīgatiprajanakāntyasanakhādaneṣu251
 
 
vi has 6 results
Root WordIAST MeaningMonier Williams PageClass
√वीgoing / gati347/3Cl.2
√वीpervading / vyāpti1037/3Cl.2
√वीbringing forth, procreasting / prajana658/2Cl.2
√वीbeing beautiful / kānti270/3Cl.2
√वीthrowing / asana117/2Cl.2
√वीeating / khādana339/2Cl.2
Preverbs Search
 
vi has 1 results
Preverb WordMeaning
viapart, asunder, away, out
Amarakosha Search
Results for vi
WordReferenceGenderNumberSynonymsDefinition
abhijātaḥ3.3.88MasculineSingularsatyam, sādhuḥ, vidyamānaḥ, praśastaḥ, abhyarhitaḥ
abhinītaḥ3.3.87MasculineSingularpūtaḥ, vijanaḥ
ācchādanam3.3.132NeuterSingularviralam, stokam
āḍambaraḥ3.3.176MasculineSingularpiṅgalaḥ, vipulaḥ, nakulaḥ, viṣṇuḥ
adhamaḥ3.3.152MasculineSingularbhrātṛjaḥ, dvi
ādhiḥ3.3.104MasculineSingularvidhānam, daivam
agniḥMasculineSingularjvalanaḥ, barhiḥ, śociṣkeśaḥ, bṛhadbhānuḥ, analaḥ, śikhāvān, hutabhuk, saptārciḥ, citrabhānuḥ, appittam, vaiśvānaraḥ, dhanañjayaḥ, jātavedāḥ, śuṣmā, uṣarbudhaḥ, kṛśānuḥ, rohitāśvaḥ, āśuśukṣaṇiḥ, dahanaḥ, damunāḥ, vibhāvasuḥ, vahniḥ, kṛpīṭayoniḥ, tanūnapāt, kṛṣṇavartmā, āśrayāśaḥ, pāvakaḥ, vāyusakhaḥ, hiraṇyaretāḥ, havyavāhanaḥ, śukraḥ, śuciḥ, vītihotraḥfire god
āḥ3.3.248MasculineSingularpraśnaḥ, vitarkaḥ
ajaśṛṅgīFeminineSingularviṣāṇī
ajñānamNeuterSingularavidyā, ahammatiḥignorance
alaṅkāraḥ2.6.102MasculineSingularābharaṇam, pariṣkāraḥ, vibhūṣaṇam, maṇḍanam
amaraḥ1.1.7-9MasculineSingularnirjaraḥ, vibudhaḥ, sumanasaḥ, āditeyaḥ, aditinandanaḥ, asvapnaḥ, gīrvāṇaḥ, daivatam, devaḥ, suraḥ, tridiveśaḥ, diviṣad, ādityaḥ, amartyaḥ, dānavāriḥ, devatā, tridaśaḥ, suparvā, divaukāḥ, lekhaḥ, ṛbhuḥ, amṛtāndhāḥ, vṛndārakaḥimmortal
āmayāvī2.6.58MasculineSingularāturaḥ, abhyamitaḥ, abhyāntaḥ, vikṛtaḥ, vyādhitaḥ, apaṭuḥ
āmreḍitamNeuterSingulardvistriruktamrepettition
ānāhaḥ2.6.55MasculineSingularvibandhaḥ
aṅgahāraḥMasculineSingularaṅgavikṣepaḥa appropriate vocative for female friend
añjanam2.9.101NeuterSingularvi‍tunnakam, ‍mayūrakam, tutthāñjanam
antargatam3.1.86MasculineSingularvismṛtam
anveṣitam3.1.105MasculineSingularmṛgitam, gaveṣitam, anviṣṭam, mārgitam
ānvīkṣikī1.6.5FeminineSingulartarkavidyālogic
apadiśam1.3.5MasculineSingularvidikintermediate point
āpannasattvā2.6.22FeminineSingulargarbhiṇī, gurviṇī, antarvatnī
āpūpikaḥ2.9.29MasculineSingularkāndavikaḥ, bhakṣyakāraḥ
arālam3.1.70MasculineSingularbhugnam, natam, jihmam, vakram, kuṭilam, kuñcitam, vṛjinam, vellitam, āviddham, ūrmimat
ārāt3.3.250MasculineSingularkhedaḥ, anukampā, santoṣaḥ, vismayaḥ, āmantraṇam
argalam2.2.17MasculineSingularviṣkambham
arimedaḥ2.2.50MasculineSingularviṭkhadiraḥ
aśaḥ2.9.90MasculineSingularriktham, rāḥ, draviṇam, dhanam, svāpateyam, arthaḥ, hiraṇyam, ṛktham, vittam, vibhavaḥ, dyumnam, va‍su
āspadam3.3.101NeuterSingularvidvān, supragalbhaḥ
āsphoṭāFeminineSingularviṣṇukrāntā, aparājitā, girikarṇī
asuraḥ1.1.12MasculineSingularditisutaḥ, indrāriḥ, daityaḥ, suradvi, śukraśiṣyaḥ, danujaḥ, pūrvadevaḥ, dānavaḥ, daiteyaḥgiant
aśvayuk1.3.21FeminineSingularvithe head of aries
aṭavīFeminineSingulargahanam, kānanam, vanam, araṇyam, vipinam
atha3.3.255MasculineSingularupamā, vikalpaḥ
atyayaḥ3.3.158MasculineSingularviśrambhaḥ, yācñā, premā
avadhiḥ3.3.106MasculineSingularnadaviśeṣaḥ, abdhiḥ, sarit
āyuḥMasculineSingularvitakālaḥ
babhruḥ3.3.178MasculineSingulardevātvṛtam, śreṣṭhaḥ, dāyādaḥ, viṭaḥ, manākpriyam
balākā2.5.27FeminineSingularvisakaṇṭhikā
balam2.8.107NeuterSingularparākramaḥ, sthāma, taraḥ, śaktiḥ, śauryam, draviṇam, prāṇaḥ, śuṣmam, sahaḥ
bāṇaḥ2.8.87MasculineSingularmārgaṇaḥ, khagaḥ, pṛṣatkaḥ, pa‍ttrī, kalambaḥ, ajihmagaḥ, i‍ṣuḥ, śaraḥ, ā‍śugaḥ, viśikhaḥ, ropaḥ
bāṇaḥ3.3.51MasculineSingularnirvyāpārasthitiḥ, kālaviśeṣaḥ, utsavaḥ
bhakṣitaḥMasculineSingularglastam, annam, khāditam, liptam, bhuktam, grastam, abhyavahṛtam, gilitam, carvitam, aśitam, jagdham, psātam, pratyasitam
bhikṣā3.3.232FeminineSingularravi, śvetaḥ, chadaḥ
bhrātṛvyaḥ3.3.154MasculineSingularśapathaḥ, jñānam, viśvāsaḥ, hetuḥ, randhraḥ, adhīnaḥ, śabdaḥ
bhūḥ2.1.2-3FeminineSingularkṣmā, mahī, dhātrī, kumbhinī, ratnagarbhā, bhūmiḥ, rasā, dharā, kṣoṇī, kṣitiḥ, vasudhā, gotrā, pṛthvī, medinī, gahvarī, ilā, bhūtadhātrī, sāgarāmbarā, anantā, sthirā, dharaṇī, kāśyapī, vasumatī, vasundharā, pṛthivī, avaniḥ, vipulā, gauḥ, kṣamā, jagatī, acalā, viśvambharā, dharitrī, jyā, sarvaṃsahā, urvī, kuḥ
bhūṣṇuḥ3.1.28MasculineSingularbhaviṣṇuḥ, bhavi
bhūtiḥ3.3.76FeminineSingularjagat, chandoviśeṣaḥ, kṣitiḥ
bībhatsamNeuterSingularvikṛtamdisgust
brahmā1.1.16-17MasculineSingularprajāpatiḥ, viścasṛṭ, aṇḍajaḥ, kamalodbhavaḥ, satyakaḥ, ātmabhūḥ, pitāmahaḥ, svayaṃbhūḥ, abjayoniḥ, kamalāsanaḥ, vedhāḥ, vidhiḥ, pūrvaḥ, sadānandaḥ, haṃsavāhanaḥ, surajyeṣṭhaḥ, hiraṇyagarbhaḥ, caturāsanaḥ, druhiṇaḥ, sraṣṭā, vidhātā, nābhijanmā, nidhanaḥ, rajomūrtiḥ, parameṣṭhī, lokeśaḥ, dhātā, virañciḥbramha
buddham3.1.110MasculineSingularmanitam, viditam, pratipannam, avasitam, avagatam, budhitam
buddhiḥ1.5.1FeminineSingularpratipat, upalabdhiḥ, śemuṣī, dhiṣaṇā, cetanā, saṃvit, prekṣā, prajñā, manīṣā, jñaptiḥ, cit, matiḥ, dhīḥunderstanding or intellect
carcā1.5.2FeminineSingularsaṅkhyā, vicāraṇāreflection
cāṣaḥ2.5.18MasculineSingularkikīdivi
caṭakaḥ2.5.20MasculineSingularkalaviṅkaḥ
cavyamNeuterSingularcavikam
chatrā2.9.38FeminineSingularvitunnakam, kustumburu, dhānyakam
daivam1.4.28NeuterSingularniyatiḥ, vidhiḥ, diṣṭam, bhāgadheyam, bhāgyamdestiny or luck
daraḥ3.3.192MasculineSingularvi, tādarthyam, paridhānam, avasaraḥ, ātmīyaḥ, bhedaḥ, avadhiḥ, antarātmā, bahiḥ, chidram, antardhiḥ, avakāśaḥ, madhyaḥ
dātram2.9.13NeuterSingularlavitram
deśaḥ2.1.8MasculineSingularviṣayaḥ, upavartanam
devanam3.3.124NeuterSingularvipat, bhraṃśaḥ, kāmajaḥdoṣaḥ, krodhajaḥdoṣaḥ
dhamanīFeminineSingularhanuḥ, haṭṭavilāsinī, añjanakeśī
dhavaḥ3.3.214MasculineSingularnikṛtiḥ, aviśvāsaḥ, apahnavaḥ
digdhaḥ2.8.90MasculineSingularviṣāktaḥ, liptakaḥ
ḍimbaḥ3.4.14MasculineSingularviplavaḥ, ḍamaraḥ
dīnaḥ3.1.48MasculineSingularniḥsvaḥ, durvidhaḥ, daridraḥ, durgataḥ
dṛṣṭāntaḥ3.3.69MasculineSingularśleṣmādiḥ, aśmavikṛtiḥ, rasādiḥ, śabdayoniḥ, raktādiḥ, mahābhūtādiḥ, mahābhūtaguṇāḥ, indriyāṇi
dūram3.1.67MasculineSingularviprakṛṣṭam
durmanā3.1.6MasculineSingularvimanāḥ, antarmanāḥ
dūrvāFeminineSingularbhārgavī, ruhā, anantā, śataparvi, sahasravīryā
dviguṇākṛtam2.9.9MasculineSingulardvitīyākṛtam, dvihalyam, dvisītyam, ‍śambākṛtam
dvīyaḥ3.1.67MasculineSingularsudūram, daviṣṭham
dyauḥ1.2.1FeminineSingularvyoma, nabhaḥ, anntam, viyat, vihāyaḥ, dyuḥ, meghādhvā, dyauḥ, puṣkaram, antarīkṣam, suravartma, viṣṇupadam, vihāyasaḥ, tārāpathaḥ, mahābilam, abhram, ambaram, gaganam, kham, ākāśam, nākaḥ, antarikṣamsky
gaṃgā1.10.31FeminineSingularbhāgīrathī, tripathagā, trisrotā, viṣṇupadī, bhīṣmasūḥ, jahnutanayā, suranimnagāganges(river)
garutmānMasculineSingularnāgāntakaḥ, viṣṇurathaḥ, garuḍaḥ, suparṇaḥ, tārkṣyaḥ, pannagāśanaḥ, vainateyaḥ, khageśvaraḥa heavanly bird
gauḥ2.9.67-72FeminineSingularupasaryā, rohiṇī, bahusūtiḥ, kapilā, navasūtikā, ekahāyanī, droṇakṣīrā, bandhyā, saurabheyī, garbhopaghātinī, arjunī, acaṇḍī, dhavalā, vaṣkayiṇī, dvivarṣā, pīnoghnī, tryabdā, samāṃsamīnā, sandhinī, vaśā, praṣṭhauhī, naicikī, pareṣṭukā, pāṭalā, suvratā, caturabdā, droṇadugdhā, avatokā, usrā, kālyā, aghnyā, sukarā, kṛṣṇā, dhenuḥ, ekābdā, pīvarastanī, trihāyaṇī, māheyī, vehad, śṛṅgiṇī, bālagarbhiṇī, śavalī, cirasūtā, dvihāyanī, sukhasaṃdohyā, caturhāyaṇī, dhenuṣyā, sravadgarbhā, mātā(49)cow
ghṛtamājyam2.9.53NeuterSingularājyam, havi, sarpiḥ
gojihvāFeminineSingulardarvi
harṣamāṇaḥ3.1.5MasculineSingularvikurvāṇaḥ, pramanāḥ, hṛṣṭamānasaḥ
hastī2.8.35MasculineSingularpadmī, karī, gajaḥ, anekapaḥ, dantī, stamberamaḥ, vāraṇaḥ, mataṅgajaḥ, dviradaḥ, hāthī, ibhaḥ, kuñjaraḥ, dvipaḥ, dantāvalaḥ
hetuśūnyā3.2.2FeminineSingularvilakṣaṇam
himāṃśuḥ1.3.13-14MasculineSingularśaśadharaḥ, induḥ, sudhāṃśuḥ, niśāpatiḥ, somaḥ, kalānidhiḥ, nakṣatreśaḥ, candramāḥ, kumudabāndhavaḥ, śubhrāṃśuḥ, abjaḥ, glauḥ, dvijarājaḥ, kṣapākaraḥ, candraḥ, vidhuḥ, oṣadhīśaḥ, jaivātṛkaḥ, mṛgāṅkaḥthe moon
hlādinīFeminineSingulardambholiḥ, śatakoṭiḥ, kuliśam, śambaḥ, pavi, vajram, aśaniḥ, svaruḥ, bhiduramthe thunderbolt of indra
hṛṣīkamNeuterSingularviṣayi, indriyamorgan of sense
huṃ3.3.260MasculineSingularvistāraḥ, aṅgīkṛtiḥ
indraḥ1.1.45MasculineSingularmarutvān, pākaśāsanaḥ, puruhūtaḥ, lekharṣabhaḥ, divaspatiḥ, vajrī, vṛṣā, balārātiḥ, harihayaḥ, saṅkrandanaḥ, meghavāhanaḥ, ṛbhukṣāḥ, maghavā, vṛddhaśravāḥ, purandaraḥ, śakraḥ, sutrāmā, vāsavaḥ, vāstoṣpatiḥ, śacīpatiḥ, svārāṭ, duścyavanaḥ, ākhaṇḍalaḥ, viḍaujāḥ, sunāsīraḥ, jiṣṇuḥ, śatamanyuḥ, gotrabhid, vṛtrahā, surapatiḥ, jambhabhedī, namucisūdanaḥ, turāṣāṭ, sahasrākṣaḥindra, the king of the gods
iti3.3.253MasculineSingularvikalpaḥ, pṛcchā
jagatīFeminineSingularlokaḥ, viṣṭapam, bhuvanam, jagat
jarā2.6.41FeminineSingularvisrasā
jñātā3.1.29MasculineSingularviduraḥ, vinduḥ
kacchūḥ2.6.53FeminineSingularpāma, pāmā, vicarcikā
kakudaḥ3.3.99MasculineSingulargosevitam, gopadamānam
kaluṣaḥ1.10.14MasculineSingularancchaḥ, āvilaḥturbid water
kam3.3.5NeuterSingularhastaḥ, vitastaḥ
kambalaḥ3.3.202MasculineSingularpāpam, vi, kiṭṭam
kāminī3.3.119FeminineSingularprajāpatiḥ, tattvam, tapaḥ, brahma, brahmā, vipraḥ, vedāḥ
kaṇaḥ3.3.52MasculineSingularstutiḥ, akṣaraḥ, dvijādiḥ, śuklādiḥ
kañcukī2.8.8MasculineSingularsthāpatyaḥ, ‍sauvidaḥ, sauvidallaḥ
kāṇḍaḥ3.3.49MasculineSingularvinyastaḥ, saṃhataḥ
kāntāram3.3.179MasculineSingularviṣṇuḥ, indraḥ, kapilaḥ, ahiḥ, aṃśuḥ, arkaḥ, anilaḥ, bhekaḥ, śukaḥ, siṃhaḥ, candraḥ, yamaḥ, kapiḥ, vājī
kapotapālikā2.2.15FeminineSingularviṭaṅkam
karcūrakaḥMasculineSingulardrāviḍakaḥ, kālpakaḥ, vedhamukhyakaḥ
karṇadhāraḥMasculineSingularvikaḥthe pilot or helmsman
kārtikeyaḥMasculineSingularmahāsenaḥ, kumāraḥ, śikhivāhanaḥ, bāhuleyaḥ, senānīḥ, ṣaḍānanaḥ, śaktidharaḥ, viśākhaḥ, guhaḥ, skandaḥ, śarajanmā, krauñcadāruṇaḥ, ṣāṇmāturaḥ, tārakajit, agnibhūḥ, pārvatīnandanaḥkaarttik
kaulīnam3.3.123NeuterSingularpratirodhaḥ, virodhācaraṇam
khagaḥ2.5.35-36MasculineSingularvihaṅgamaḥ, pakṣī, śakunaḥ, pattrī, pattrarathaḥ, vājī, viṣkiraḥ, garutmān, vihaṅgaḥ, vihāyāḥ, śakuniḥ, dvijaḥ, patagaḥ, aṇḍajaḥ, vikiraḥ, patatriḥ, pitsan, vihagaḥ, śakuntiḥ, śakuntaḥ, patatrī, patan, nagaukāḥ, vi, nīḍodbhavaḥ, nabhasaṅgamaḥ
khalu3.3.263MasculineSingularviṣādaḥ, śuk, artiḥ
klpaḥ2.7.43MasculineSingularvidhiḥ, kramaḥ
kṛṣṇapākaphalaḥ2.2.67MasculineSingularavignaḥ, suṣeṇaḥ, karamardakaḥ
kṛtahastaḥ2.8.69MasculineSingular‍suprayogaviśikhaḥ, ‍kṛtapuṅkhaḥ
kṛtāntaḥ3.3.71MasculineSingularlatā, vistāraḥ
kṛtasapatnikā2.6.7FeminineSingularadhyūḍhā, ‍adhivinnā
kṣatriyaḥ2.8.1MasculineSingularvirāṭ, mūrddhābhiṣiktaḥ, rājanyaḥ, bāhujaḥ
kṣveḍaḥ1.8.9MasculineSingularviṣam, garalamthe venom of a snake
kuberaḥ1.1.68-69MasculineSingularekapiṅgaḥ, paulastyaḥ, dhanādhipaḥ, manuṣyadharmā, tryambakasakhaḥ, śrīdaḥ, yakṣaḥ, vaiśravaṇaḥ, rājarājaḥ, guhyakeśvaraḥ, aiḍaviḍaḥ, naravāhanaḥ, kinnareśaḥ, dhanadaḥ, yakṣarāṭ, puṇyajaneśvaraḥkuber
kuharam1.8.1NeuterSingularśvabhram, nirvyathanam, vivaram, śuṣiḥ, randhram, chidram, śuṣiram, vapā, rokam, bilamthe infernal region
kūpakaḥMasculineSingularvidārakaḥa temporarry well
kuśamMasculineSingularpavitram, kuthaḥ, darbhaḥ
kuṣṭham2.6.54NeuterSingularśvitram
kuṭṭakaḥ2.10.8MasculineSingularśaulvikaḥ
labdham3.1.105MasculineSingularāsāditam, bhūtam, prāptam, vinnam, bhāvitam
lulāpaḥ2.2.5MasculineSingularmahiṣaḥ, vāhadviṣan, kāsaraḥ, sairibhaḥ
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketanaḥ, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
mādhavakaḥ2.10.41MasculineSingularmadhvāsavaḥ, ma‍dhu, mādhvikam
madhucchiṣṭam2.9.108NeuterSingular‍kunaṭī, golā, ‍manoguptā, ‍manohvā, nāgajihvi, naipālī
madhuvrataḥ2.5.31MasculineSingularbhramaraḥ, puṣpaliṭ, madhupaḥ, ṣaṭpadaḥ, dvirephaḥ, madhuliṭ, aliḥ, bhṛṅgaḥ, alī, madhukaraḥ
mandākinīFeminineSingularviyadgaṅgā, svarṇadī, suradīrghikāthe river of heaven
mandāraḥMasculineSingularāsphotaḥ, gaṇarūpaḥ, vikīraṇaḥ, arkaparṇaḥ, arkāhvaḥ, vasukaḥ
mañjiṣṭhāFeminineSingularbhaṇḍīrī, vikasā, bhaṇḍī, jiṅgī, yojanavallī, samaṅgā, kālameśikā, maṇḍūkaparṇī
manthadaṇḍaḥ2.9.75MasculineSingulardaṇḍaviṣkambhaḥ
māraṇam2.8.118NeuterSingularnirbahaṇam, pravāsanam, nihiṃsanam, nirgranthanam, nihānanam, nirvāpaṇam, pratighātanam, krathanam, piñjaḥ, unmāthaḥ, nikāraṇam, parāsanam, nirvāsanam, apāsanam, kṣaṇanam, viśasanam, udvāsanam, ujjāsanam, viśaraḥ, pramāpaṇam, viśāraṇam, niṣūdanam, saṃjñapanam, ni‍starhaṇam, parivarjanam, māraṇam, pramathanam, ālambhaḥ, ghātaḥ
mārjāraḥ2.2.7MasculineSingularotuḥ, viḍālaḥ, vṛṣadaṃśakaḥ, ākhubhuk
matsyaṇḍī2.9.44FeminineSingularphāṇitam, khaṇḍavikāraḥ
meḍhraḥ2.9.77MasculineSingularkrayavikrayikaḥ, ‍naigamaḥ, vāṇijaḥ, vaṇik, ‍paṇyājīvaḥ, āpaṇikaḥ, ‍sārthavāhaḥ
mliṣṭamMasculineSingularavispaṣṭaman indistinct speech
mūlyam2.10.38-39NeuterSingularbharaṇam, bharma, vidhā, paṇaḥ, bharaṇyam, bhṛ‍tiḥ, karmaṇyā, nirveśaḥ, vetanam, bhṛtyā
netram3.3.188NeuterSingularviṣayaḥ, kāyaḥ
nikāraḥ3.4.15MasculineSingularviprakāraḥ
nikṛtaḥ3.1.40MasculineSingularviprakṛtaḥ
niṣkalā2.6.22FeminineSingularvigatārtavā
niṣprabhaḥ3.1.99MasculineSingularvigataḥ, ārokaḥ
nūnam3.3.258MasculineSingularvitarkaḥ, paripraśnaḥ
odanam2.9.49MasculineSingulardīdivi, ‍bhissā, ‍bhaktam, andhaḥ, annam
oghaḥ3.3.32MasculineSingularviparyāsaḥ, vistaraḥ
okaḥ3.3.241NeuterSingularvidam
pādasphoṭaḥ2.6.52MasculineSingularvipādikā
padmam1.10.39-40MasculineSingularpaṅkeruham, kamalam, aravindam, rājīvam, sārasam, kuśeśayam, sahasrapattram, nalinam, ambhoruham, bisaprasūnam, tāmarasam, śatapattram, mahotpalam, puṣkaram, sarasīruhama lotus
pāliḥ3.3.204FeminineSingularvilāsaḥ, kriyā
pariṇāmaḥ3.4.15MasculineSingularvikāraḥ, vikṝtiḥ, vikriyā
paritaḥ2.4.12MasculineSingularsamantataḥ, sarvataḥ, viṣvak
parivyādhaḥ2.4.30MasculineSingularvidulaḥ, nādeyī, ambuvetasaḥ
paryāyaḥ3.3.155MasculineSingularvipat, vyasanam, aśubhaṃdaivam
paścād3.3.251MasculineSingularharṣaḥ, anukampā, vākyārambhaḥ, viṣādaḥ
paścāttāpaḥ1.7.25MasculineSingularanutāpaḥ, vipratīsāraḥrepeantance
pāṭhāFeminineSingularpāpacelī, śreyasī, ambaṣṭhā, vanatiktikā, ekāṣṭhīlā, sthāpanī, prācīnā, rasā, viddhakarṇī
patnī2.6.5FeminineSingularjāyā, ‍dārā, ‍pāṇigṛhītī, dvitīyā, sahadharmiṇī, bhāryā
pelavam3.1.66MasculineSingularviralam, tanu
prabhāFeminineSingularśociḥ, dyutiḥ, bhā, ruk, rociḥ, chavi, tvi, dīptiḥ, bhāḥ, ruciḥlight
pradrāvaḥ2.8.116MasculineSingularvidravaḥ, dravaḥ, apakramaḥ, uddrāvaḥ, apayānam, saṃdrāvaḥ, saṃ‍dāvaḥ
prāduḥ2.4.12MasculineSingularāvi
pragalbhaḥ3.1.24MasculineSingularpratibhānvitaḥ
prajñānam3.3.129NeuterSingularprabhāvaḥ, gṛham, dehaḥ, tvi
prapañcaḥ3.3.33MasculineSingularvipraḥ, aṇḍajaḥ, dantaḥ
praphullaḥMasculineSingularvikacaḥ, sphuṭaḥ, phullaḥ, utphullaḥ, vikasitaḥ, saṃphullaḥ, vyākośaḥ
prasaraḥ2.4.23MasculineSingularvisarpaṇam
prasavaḥ3.3.216MasculineSingularśastraḥ, śūdrāyāṃvipratanayaḥ
pratītaḥ3.1.7MasculineSingularvijñātaḥ, viśrutaḥ, prathitaḥ, khyātaḥ, vittaḥ
pravīṇaḥ3.1.2MasculineSingularśikṣitaḥ, abhijñaḥ, kṛtamukhaḥ, niṣṇātaḥ, nipuṇaḥ, kuśalaḥ, vaijñānikaḥ, vijñaḥ, kṛtī
prayogaḥ2.9.4MasculineSingularvṛddhajīvi, kusīdam
preritaḥ3.1.86MasculineSingularkṣiptaḥ, nuttaḥ, nunnaḥ, astaḥ, niṣṭhyūtaḥ, āviddhaḥ
pṛṣat1.10.6NeuterPluralpṛṣataḥ, vipruṭ, binduḥa drop of water
pṛśniparṇīFeminineSingularsiṃhapucchī, kalaśiḥ, pṛthakparṇī, dhāvaniḥ, citraparṇī, guhā, aṅghriparṇikā, kroṣṭuvinnā
pṛthag2.4.2MasculineSingularhiruk, nānā, vi, antareṇa, ṛte
pṛthuromāMasculineSingularvisāraḥ, jhaṣaḥ, śakalī, matsyaḥ, mīnaḥ, vaisāriṇaḥ, aṇḍajaḥa fish
pūtaḥ2.7.49MasculineSingularpavitraḥ, prayataḥ
pūtam3.1.54MasculineSingularpavitram, medhyam
rādhāFeminineSingularviśākhāstar in the cancer
rajasvalā2.6.20FeminineSingularātreyī, malinī, puṣpavatī, ṛtumatī, strīdharmiṇī, udakyā, avi
rāṣṭaḥ3.3.192MasculineSingularpadmam, karihastāgram, tīrthaḥ, vādyabhāṇḍamukham, oṣadhiviśeṣaḥ, jalam, vyoma, khaḍgaphalam
rathyāFeminineSingularpratolī, viśikhā
rūkṣaḥ3.3.233MasculineSingularrāgaḥ, dravaḥ, śṛṅgārādiḥ, viṣam, vīryam, guṇaḥ
śabdaḥ1.2.24MasculineSingularnisvānaḥ, nirghoṣaḥ, ravaḥ, ninadaḥ, virāvaḥ, āravaḥ, nādaḥ, svānaḥ, dhvānaḥ, ninādaḥ, saṃrāvaḥ, nisvanaḥ, nirhrādaḥ, svanaḥ, dhvaniḥ, ārāvaḥsound
sādhuvāhī2.8.45MasculineSingularvinītaḥ
śakṛt2.6.68NeuterSingularpurīṣam, gūtham, varcaskam, uccāraḥ, viṣṭhā, avaskaraḥ, vi, śamalam
samagram3.1.66MasculineSingularpūrṇam, akhilam, kṛtsnam, sarvam, anūnakam, sakalam, nikhilam, aśeṣam, samam, akhaṇḍam, niḥśeṣam, samastam, viśvam
samālambhaḥ2.4.27MasculineSingularvilepanam
samayā3.3.260MasculineSingularvistāraḥ, aṅgīkṛtiḥ
śaṃbhuḥMasculineSingularkapardī, kapālabhṛt, virūpākṣaḥ, sarvajñaḥ, haraḥ, tryambakaḥ, andhakaripuḥ, vyomakeśaḥ, sthāṇuḥ, ahirbudhnyaḥ, paśupatiḥ, mahānaṭaḥ, maheśvaraḥ, īśānaḥ, bhūteśaḥ, giriśaḥ, kṛttivāsāḥ, ugraḥ, śitikaṇṭhaḥ, mahādevaḥ, kṛśānuretāḥ, nīlalohitaḥ, bhargaḥ, gaṅgādharaḥ, vṛṣadhvajaḥ, bhīmaḥ, umāpatiḥ, īśaḥ, gajāriḥ, śūlī, śarvaḥ, candraśekharaḥ, girīśaḥ, mṛtyuñjayaḥ, prathamādhipaḥ, śrīkaṇṭhaḥ, vāmadevaḥ, trilocanaḥ, dhūrjaṭiḥ, smaraharaḥ, tripurāntakaḥ, kratudhvaṃsī, bhavaḥ, rudraḥ, aṣṭamūrtiḥ, śivaḥ, īśvaraḥ, śaṅkaraḥ, khaṇḍaparaśuḥ, mṛḍaḥ, pinākī(51)shiva, god
śampā1.3.9FeminineSingularcañcalā, taḍit, hrādinī, vidyut, kṣaṇaprabhā, śatahradā, capalā, saudāminī, airāvatīlighting
samparāyaḥ3.3.158MasculineSingularvirodhaḥ
samṛddhiḥ3.4.10FeminineSingularvidhā
samūhaḥ2.5.41MasculineSingularvyūhaḥ, vrajaḥ, nikaraḥ, saṅghātaḥ, samudayaḥ, gaṇaḥ, nikurambam, sandohaḥ, stomaḥ, vrātaḥ, sañcayaḥ, samavāyaḥ, saṃhatiḥ, kadambakam, nivahaḥ, visaraḥ, oghaḥ, vāraḥ, samudāyaḥ, kṣayaḥ, vṛndam
saṃvīkṣaṇam2.4.30NeuterSingularmṛgaṇā, mṛgaḥ, vicayanam, mārgaṇam
śaṇasūtramNeuterSingularpavitrakampackthread
śaṅkhaḥ3.3.23MasculineSingularviśikhaḥ, vāyuḥ
saptalāFeminineSingularvimalā, sātalā, bhūriphenā, carmakaṣā
saptaparṇaḥMasculineSingularviśālatvak, śāradaḥ, viṣamacchadaḥ
śarīram2.6.71NeuterSingulartanūḥ, dehaḥ, varṣma, gātram, tanuḥ, kāyaḥ, saṃhananam, kalevaram, mūrtiḥ, vigrahaḥ, vapuḥ
sarpaḥ1.8.6-8MasculineSingulardvirasanaḥ, kumbhīnasaḥ, bhogadharaḥ, bhujaṅgaḥ, āśīviṣaḥ, vyālaḥ, gūḍhapāt, phaṇī, dandaśūkaḥ, pannagaḥ, pavanāśanaḥ, gokarṇaḥ, phaṇadharaḥ, pṛdākuḥ, ahiḥ, viṣadharaḥ, sarīsṛpaḥ, cakṣuḥśravā, darvīkaraḥ, bileśayaḥ, bhogī, lelihānaḥ, kañcukī, hariḥ, bhujagaḥ, bhujaṅgamaḥ, cakrī, kuṇḍalī, kākodaraḥ, dīrghapṛṣṭhaḥ, uragaḥ, jihvagaḥa snake or serpent
sarvajñaḥ1.1.13MasculineSingularmārajit, tathāgataḥ, sugataḥ, śrīghanaḥ, advayavādī, jinaḥ, bhagavān, dharmarājaḥ, muniḥ, munīndraḥ, daśabalaḥ, lokajit, samantabhadraḥ, buddhaḥ, śāstā, vināyakaḥ, ṣaḍabhijñaḥa gina or buddha
śarvarīFeminineSingularrajanī, kṣapā, rātriḥ, tamī, tamasvi, kṣaṇadā, niśīthinī, yāminī, vibhāvarī, triyāmā, niśāthe star spangled night
satatam1.1.66NeuterSingularanavaratam, aśrāntam, ajasram, santatam, aviratam, aniśam, nityam, anāratameternal or continually
śatruḥ2.8.10MasculineSingularārātiḥ, śātravaḥ, ahitaḥ, durhṛd, sapatnaḥ, paraḥ, dasyuḥ, vipakṣaḥ, dveṣaṇaḥ, vairī, pratyarthī, abhighātī, amitraḥ, dvi, dviṣan, ripuḥ
satyāpanam2.9.83NeuterSingularvikrayaḥ
śīghram1.1.65NeuterSingularavilambitam, satvaram, kṣipram, tūrṇam, drutam, laghu, āśu, capalam, aram, tvaritamswiftly
śikhā3.3.24FeminineSingularśaraḥ, arkaḥ, vihagaḥ
śikhigrīvam2.9.102NeuterSingulardārvi, tuttham
siṃhaḥ2.5.1MasculineSingularmṛgadvi, puṇḍarīkaḥ, mṛgaripuḥ, kesarī, mṛgendraḥ, citrakāyaḥ, mṛgāśanaḥ, kaṇṭhīravaḥ, haryakṣaḥ, pañcanakhaḥ, mṛgadṛṣṭiḥ, hariḥ, pañcāsyaḥ
śobhā1.3.17FeminineSingularkāntiḥ, dyutiḥ, chavibeauty of splendour
sphuṭnam03.04.2005NeuterSingularvidaraḥ, bhidā
śraddhā3.3.109FeminineSingularavalambitaḥ, avidūraḥ
śṛṅgam3.3.31NeuterSingularmūlyam, pūjāvidhiḥ
sthapatiḥ3.3.67MasculineSingularviṣṇuḥ
śubhaṃyuḥ3.1.49MasculineSingularśūbhānvitaḥ
śuciḥ3.3.33MasculineSingularviṣṇuḥ, haraḥ, chāgaḥ
sudhā3.3.109FeminineSingulargarvitaḥ, paṇḍitaṃmanyaḥ
śuklaḥ1.5.12MasculineSingulardhavalaḥ, sitaḥ, śyetaḥ, śuciḥ, valakṣaḥ, avadātaḥ, viśadaḥ, śubhraḥ, arjunaḥ, gauraḥ, pāṇḍaraḥ, śvetaḥwhite
śukraḥMasculineSingularbhārgavaḥ, kavi, daityaguruḥ, kāvyaḥ, uśanāḥvenus
śūlam3.3.204MasculineSingularkālaḥ, maryādā, abdhyambuvikṛtiḥ
śuṇḍī2.9.38FeminineSingularmahauṣadham, viśvam, nāgaram, viśvabheṣajam
śūraḥ2.8.79MasculineSingular‍vīraḥ, vikrāntaḥ
sūraḥ1.3.28-30MasculineSingularsahasrāṃśuḥ, ravi, chāyānāthaḥ, jagaccakṣuḥ, pradyotanaḥ, lokabāndhavaḥ, aryamā, dhāmanidhiḥ, divākaraḥ, braghnaḥ, bhāsvān, haridaśvaḥ, arkaḥ, aruṇaḥ, taraṇiḥ, virocanaḥ, tviṣāṃpatiḥ, haṃsaḥ, savi, tejasāṃrāśiḥ, karmasākṣī, trayītanuḥ, khadyotaḥ, sūryaḥ, bhagaḥ, dvādaśātmā, abjinīpatiḥ, ahaskaraḥ, vibhākaraḥ, saptāśvaḥ, vikartanaḥ, mihiraḥ, dyumaṇiḥ, citrabhānuḥ, grahapatiḥ, bhānuḥ, tapanaḥ, padmākṣaḥ, tamisrahā, lokabandhuḥ, dinamaṇiḥ, inaḥ, ādityaḥ, aṃśumālī, bhāskaraḥ, prabhākaraḥ, vivasvān, uṣṇaraśmiḥ, mārtaṇḍaḥ, pūṣā, mitraḥ, vibhāvasuḥ, aharpatiḥ(53)the sun
śuṣirāFeminineSingularvidrumalatā, kapotāṅghriḥ, naṭī, nalī
sutaḥ3.3.67MasculineSingularviṣṇuḥ
sūtaḥ3.3.68MasculineSingularnīvṛdviśeṣaḥ, samaraḥ, nṛtyasthānam
svādukaṇṭakaḥ2.4.37MasculineSingularsruvāvṛkṣaḥ, granthilaḥ, vyāghrapāt, vikaṅkataḥ
svaḥ1.1.6MasculineSingulardyauḥ, svarga:, dyauḥ, nākaḥ, triviṣṭapam, tridivaḥ, tridaśālayaḥ, suralokaḥheaven
śvaḥśreyasamNeuterSingularśivam, kuśalam, bhāvukam, kalyāṇam, śastam, bhavyam, śubham, bhadram, kṣemam, bhavikam, maṅgalamhappy, well,or right
svaruḥ3.3.175MasculineSingularviṭapī, darbhamuṣṭiḥ, pīṭhādyamāsanam
svarvaidyauMasculineDualnāsatyau, vinau, dasrau, āśvineyau, vinīsutauashvin
svit3.3.250MasculineSingulararthaḥ, vikalpaḥ
syādrasālā2.9.44FeminineSingularkṣīravikṛtiḥ
śyāmā2.2.55FeminineSingulargovandanī, priyakaḥ, viśvaksenā, priyaṅguḥ, latā, kārambhā, phalā, gundrā, mahilāhvayā, gandhaphalī, phalinī
śyāmāFeminineSingularpālindī, suṣeṇikā, kālā, masūravidalā, ardhacandrā, kālameṣikā
tamas1.3.26NeuterSingularsaiṃhikeyaḥ, vidhuntudaḥ, rāhuḥ, svarbhānuḥthe acending node
tantuvāyaḥ2.10.6MasculineSingularkuvindaḥ
tarasvinaḥ3.3.135MasculineSingularharaḥ, viṣṇuḥ
tilakam2.6.124NeuterSingularcitrakam, viśeṣakam, tamālapatram
tiṣyaḥ3.3.155MasculineSingularśapathaḥ, ācāraḥ, kālaḥ, siddhāntaḥ, saṃvit
trātam3.1.105MasculineSingularguptam, trāṇam, rakṣitam, avitam, gopāyitam
tūbaraḥ3.3.173MasculineSingularpratijñā, ājiḥ, saṃvit, āpat
tulyam2.9.47MasculineSingular‍bhāvitam
tyāgaḥ2.7.31MasculineSingularaṃhatiḥ, prādeśanam, vitaraṇam, utsarjanam, apavarjanam, pratipādanam, viśrāṇanam, dānam, nirvapaṇam, sparśanam, visarjanam, vihāyitam
tyaktam3.1.108MasculineSingularvidhutam, samujjhitam, dhūtam, utsṛṣṭam, hīnam
unmādaḥ1.7.26MasculineSingularcittavibhramaḥmadness
upahvaram3.3.191NeuterSingularhīrakaḥ, pavi
upaśāyaḥ2.4.32MasculineSingularviśāyaḥ
ūrīkṛtam3.1.110MasculineSingularupaśrutam, viditam, āśrutam, samāhitam, saṅgīrṇam, aṅgīkṛtam, upagatam, saṃśrutam, pratijñātam, urarīkṛtam
vāhinī3.3.119FeminineSingularkratuḥ, vistāraḥ, tucchakaḥ
vaidehakaḥ2.9.79MasculineSingularvikrayikaḥ
vairamNeuterSingularvirodhaḥ, vidveṣaḥenmity
vaiśya2.9.1MasculineSingularvi, ūravyaḥ, ūrujaḥ, aryaḥ, bhūmispṛk
vāṇinī3.3.119FeminineSingulardhojihvi
vārdhakam3.3.21MasculineSingulartvi, karaḥ, jvālā
varṇabhedaḥ2.9.68MasculineSingulardvihāyanī
vāruṇī3.3.58FeminineSingularlohaḥ, kharaḥ, viṣam, abhimaraḥ
vāsitam1.2.135MasculineSingularbhāvitam
vatsādanīFeminineSingularjīvantikā, somavallī, chinnaruhā, viśalyā, guḍūcī, madhuparṇī, tantrikā, amṛtā
vatsaḥ3.3.234MasculineSingularviṣṇuḥ
vedhitaḥ3.1.98MasculineSingularchidritaḥ, viddhaḥ
vellamNeuterSingularcitrataṇḍulā, taṇḍulaḥ, kṛmighnaḥ, viḍaṅgam, amoghā
vibhāvasuḥ3.3.234MasculineSingulardhanam, devabhedaḥ, analaḥ, raśmiḥ, ratnam
vibhītakaḥ2.2.57MasculineSingulartuṣaḥ, karṣaphalaḥ, bhūtāvāsaḥ, kalidrumaḥ, akṣaḥ
vibhrāḍ2.6.102MasculineSingularbhrājiṣṇuḥ, rociṣṇuḥ
vibhramaḥ3.3.149MasculineSingularharit, kṛṣṇaḥ
vibhūtiḥ1.1.41-43FeminineSingularbhūtiḥ, aiśvaryamsuper human power
vicāritaḥ3.1.99MasculineSingularvinnaḥ, vittaḥ
vicikitsāFeminineSingularsaṃśayaḥ, sandehaḥ, dvāparaḥdoubt
vidalam3.5.32NeuterSingular
vidārīFeminineSingularkroṣṭrī, kṣīraśuklā, ikṣugandhā
vidārigandhāFeminineSingularaṃśumatī, śālaparṇī, sthirā, dhruvā
vidhā3.3.108FeminineSingularsampratyayaḥ, spṛhā
vidhavā2.6.11FeminineSingularviśvastā
vidheyaḥ3.1.23MasculineSingularvinayagrāhī, vacanesthitaḥ, āśravaḥ
vidhiḥ3.3.106MasculineSingularvidhiḥ, prakāraḥ
vidhirdarśinaḥ2.7.18MasculineSingular
vidhuḥ3.3.106MasculineSingularsamudayaḥ
vidhūnanam3.2.4NeuterSingularvidhuvanam
vidhuram2.4.20NeuterSingularpraviśleṣaḥ
vidradhiḥ2.6.56FeminineSingular
viduḥ2.8.38MasculineSingular
vidvān2.7.5MasculineSingulardhīraḥ, prājñaḥ, kavi, kṛtī, vicakṣaṇaḥ, doṣajñaḥ, kovidaḥ, manīṣī, saṃkhyāvān, dhīmān, kṛṣṭiḥ, dūradarśī, san, budhaḥ, jñaḥ, paṇḍitaḥ, sūriḥ, labdhavarṇaḥ, dīrghadarśī, vipaścit, sudhīḥ
vidvān3.3.242MasculineSingularsādhuḥ, bāḍhaḥ
vidyut3.5.2FeminineSingular
vighnaḥ2.4.19MasculineSingularpratyūhaḥ, antarāyaḥ
vīghram3.1.54MasculineSingularvimalātmakam
vigraḥ2.6.46MasculineSingulargatanāsikaḥ
vihaṅgikā2.10.30FeminineSingularbhārayaṣṭiḥ
vihāraḥ2.4.16MasculineSingularparikramaḥ
vihasitamNeuterSingulara laugh
vijanaḥ2.8.21MasculineSingularrahaḥ, upāṃśu, viviktaḥ, channaḥ, niḥśalākaḥ
vijayaḥ2.8.112MasculineSingularjayaḥ
vijñānamNeuterSingularknowledge of arts
vikalāṅgaḥ2.6.46MasculineSingularapogaṇḍaḥ
vikāraḥ2.9.100MasculineSingularrasaḥ, sūtaḥ, pāradaḥ
vīkāśaḥ3.3.223MasculineSingularekavidhā, avasthānam
vikāsī3.1.29MasculineSingularvikasvaraḥ
viklavaḥ3.1.42MasculineSingularvihvalaḥ
vikramaḥ2.8.107MasculineSingularatiśaktitā
vikramaḥ3.3.148MasculineSingularsvasā, kulastrī
vikretā2.9.80MasculineSingularkrāyakaḥ
vikreyam2.9.83MasculineSingular‍satyākṛtiḥ, ‍satyaṅkāraḥ
vikṛtiḥ3.4.15FeminineSingular
vilakṣaḥ3.1.25MasculineSingularvismayānvitaḥ
vilambhaḥ2.4.28MasculineSingularatisarjanam
vilāpaḥ1.6.16MasculineSingularparivedanamlamentation
vilīnaḥ3.1.100MasculineSingularvidrutaḥ, drutaḥ
vimardanam3.4.13NeuterSingularparimalaḥ
vimarśaḥMasculineSingularbhāvanā, vāsanāreasoning
vimātṛjaḥ2.6.25MasculineSingularvaimātreya
vīṇāFeminineSingularvipañcakī, vallakīa lute
vināśaḥ2.4.22MasculineSingularadarśanam
vināśonmukham3.1.90MasculineSingularpakvam
vināyakaḥ3.3.6MasculineSingularjyotsnikā, ghoṣaḥ
vināyakaḥMasculineSingulargaṇādhipaḥ, ekadantaḥ, herambaḥ, lambodaraḥ, vighnarājaḥ, gajānanaḥ, dvaimāturaḥganesh
vinītaḥ3.1.24MasculineSingularnibhṛtaḥ, praśritaḥ
vipaṇaḥ2.9.84MasculineSingulardruvyam, ‍pāyyam, mānam
vipaṇiḥ3.3.58FeminineSingularkamalam
vipaṇiḥ2.2.2FeminineSingularpaṇyavīthikā
viparyāsaḥ2.4.33MasculineSingularvyatyayaḥ, viparyayaḥ, vyatyāsaḥ
vipāśā1.10.33FeminineSingularvipāṭvyasa(river)
vipattiḥ2.8.83FeminineSingularvipat, āpat
vipraḥ2.7.4MasculineSingularvāḍavaḥ, brāhmaṇaḥ, dvijātiḥ, agrajanmā, bhūdevaḥ
vipralabdhaḥ3.1.40MasculineSingularvañcitaḥ
vipralambhaḥ2.4.28MasculineSingularviprayogaḥ
vipralambhaḥMasculineSingularvisaṃvādaḥdissapointing
vipralāpaḥMasculineSingularvirodhoktiḥquarrel
vipraśnikā2.6.20FeminineSingularīkṣaṇikā, ‍daivajñā
virajastamāḥ2.7.48MasculineSingulardvayātigaḥ
virati:2.4.37FeminineSingularāratiḥ, avaratiḥ, uparāmaḥ
virocanaḥ3.3.115MasculineSingularmūrtaḥ, nirantaraḥ, meghaḥ, mūrtiguṇaḥ
virodhanam2.4.21NeuterSingularparyavasthā
viṣabhedāḥ1.8.10MasculinePluralone of the poison among nine
viśaḥ3.3.222MasculineSingularbhṛtiḥ, bhogaḥ
viśālāFeminineSingularindravāruṇī
viśālatā2.6.115FeminineSingularpariṇāhaḥ
viśalyāFeminineSingularagniśikhā, anantā, phalinī, śakrapuṣpī
viśalyā3.3.163FeminineSingularharmyādeḥprakoṣṭhaḥ, kañcī, madhyebhabandhanam
viṣam3.3.231NeuterSingularsevā, arthanā, bhṛtiḥ
viṣāṇam3.3.61MasculineSingularnadaḥ, arṇavaḥ
viśaṅkaṭam3.1.59MasculineSingularvaḍram, pṛthu, uru, bṛhat, vipulam, viśālam, pṛthulam, mahat
viśāradaḥ3.3.102MasculineSingularyajñitaroḥśākhā, upasūryakaḥ
viṣavaidyaḥMasculineSingularjāṅgulikaḥa dealer in antidotes
viṣayaḥ3.4.11MasculineSingularāśayaḥ
viṣayaḥ3.3.160MasculineSingularupasthaḥ, rahasyaḥ
viṣayāḥ1.5.7MasculinePluralone object of sense
viṣeṇaḥ3.1.44MasculineSingular
vismayaḥMasculineSingularadbhutam, āścaryam, citramsurprise
viṣṇuḥ1.1.18-21MasculineSingularadhokṣajaḥ, vidhuḥ, yajñapuruṣaḥ, viśvarūpaḥ, vaikuṇṭhaḥ, hṛṣīkeśaḥ, svabhūḥ, govindaḥ, acyutaḥ, janārdanaḥ, cakrapāṇiḥ, madhuripuḥ, devakīnandanaḥ, puruṣottamaḥ, kaṃsārātiḥ, kaiṭabhajit, purāṇapuruṣaḥ, jalaśāyī, muramardanaḥ, kṛṣṇaḥ, dāmodaraḥ, mādhavaḥ, puṇḍarīkākṣaḥ, pītāmbaraḥ, viśvaksenaḥ, indrāvarajaḥ, padmanābhaḥ, trivikramaḥ, śrīpatiḥ, balidhvaṃsī, viśvambharaḥ, śrīvatsalāñchanaḥ, narakāntakaḥ, mukundaḥ, nārāyaṇaḥ, viṣṭaraśravāḥ, keśavaḥ, daityāriḥ, garuḍadhvajaḥ, śārṅgī, upendraḥ, caturbhujaḥ, vāsudevaḥ, śauriḥ, vanamālī(45)vishnu, the god
visphāraḥ2.8.109MasculineSingular
visphoṭaḥ2.6.53NeuterSingularpiṭakaḥ
visramMasculineSingulara smell that like of raw meat
visrambhaḥ3.3.143MasculineSingularadhyakṣaḥ
viśrāvaḥ2.4.28MasculineSingularpravikhyātiḥ
visṛtam3.1.85MasculineSingularvistṛtam, tatam
visṛtvaraḥ3.1.30MasculineSingularvisṛmaraḥ, prasārī, visārī
viṣṭaraḥ3.3.177MasculineSingularmahāraṇyam, durgapathaḥ
vistāraḥ2.4.14MasculineSingularviṭapaḥ
vistāraḥ2.4.22MasculineSingularvigrahaḥ, vyāsaḥ
viṣṭiḥFeminineSingularājūḥthrowing in hell
viṣuvatNeuterSingularviṣuvamequinox
viśvāFeminineSingularupaviṣā, aruṇā, śṛṅgī, viṣā, mahauṣadham, prativiṣā, ativiṣā
viṣvadyūṅ3.1.33MasculineSingular
viśvakarmā3.3.116MasculineSingularprabhā, sūryaḥ
viṣvaksenapriyāFeminineSingularbadarā, gṛṣṭiḥ, vārāhī
viśvāsaḥ2.8.22MasculineSingularvisrambhaḥ
viṭaḥ3.5.17MasculineSingular
vitānam2.6.121MasculineSingularullocaḥ
vitānam3.3.120MasculineSingularavayavaḥ, lāñchanam, śmaśru, niṣṭhānam
vitaṇḍā3.5.9FeminineSingular
viṭapaḥ3.3.138MasculineSingulardivyagāyanaḥ, antarābhavasattvaḥ
vitardiḥFeminineSingularvedikā
vitastiḥ2.6.84Ubhaya-lingaSingulardvādaśāṅgulaḥ
vitatham1.2.22MasculineSingularanṛtam
vitunnakaḥNeuterSingulartālī, śivā, tāmlakī, jhaṭā, amalā, ajjhaṭā
vitunnamNeuterSingularsuniṣaṇṇakam
vivādaḥMasculineSingularvyavahāraḥa dispute
vivadhaḥ3.3.103MasculineSingulardoṣotpādaḥ, prakṛtyādivinaśvaraḥ(vyākaraṇe), mukhyānuyāyīśiśuḥ, prakṛtasyānuvartanam
vīvadhaḥ3.3.103MasculineSingularviṣṇuḥ, candramā
vivāhaḥ2.7.60MasculineSingularpariṇayaḥ, udvāhaḥ, upayāmaḥ, pāṇipīḍanam, upayamaḥ
vivarṇaḥ2.10.16MasculineSingularjālmaḥ, ‍‍pṛthagjanaḥ, ‍pāmaraḥ, itaraḥ, apasadaḥ, ‍prākṛtaḥ, ‍kṣullakaḥ, nihīnaḥ, nīcaḥ
vivaśaḥ3.1.43MasculineSingularariṣṭaduṣṭadhīḥ
vivasvataḥ3.3.64MasculineSingularmeghaḥ, parvataḥ
vivekaḥ2.7.42MasculineSingularpṛthagātmatā
vividhaḥ3.1.93MasculineSingularbahuvidhaḥ, nānārūpaḥ, pṛthagvidhaḥ
viviktaḥ3.3.89MasculineSingularpūjitaḥ, arātiḥ, abhiyuktaḥ, agrataḥkṛtaḥ
vṛddhatvam2.6.40NeuterSingular‍sthāviram
vṛkṣaḥMasculineSingulardrumaḥ, śālaḥ, taruḥ, śākhī, druḥ, kuṭaḥ, pādapaḥ, mahīruhaḥ, agamaḥ, palāśī, anokahaḥ, viṭapī
vyadhvaḥ2.1.16MasculineSingularkāpathaḥ, duradhvaḥ, vipathaḥ, kadadhvā
vyākulaḥ3.1.42MasculineSingularvihastaḥ
vyañjanam3.3.123NeuterSingularudgamaḥ, pauruṣam, tantram, sanniviṣṭhaḥ
vyomayānam1.1.49NeuterSingularvimānamthe car of indra
yamaḥ2.4.18MasculineSingularsaṃyāmaḥ, saṃyamaḥ, viyāmaḥ, viyamaḥ, yamaḥ
yāvāgū2.9.50FeminineSingularśrāṇā, vilepī, taralā, uṣṇikā
yuddham2.8.107NeuterSingularāyodhanam, pravidāraṇam, saṃkhyam, ‍samaraḥ, kalahaḥ, abhisaṃpātaḥ, saṃyogaḥ, saṃgrāmaḥ, ‍saṃyat, samit, janyam, mṛdham, samīkam, a‍nīkaḥ, vigrahaḥ, kaṃliḥ, abhyāmardaḥ, āhavaḥ, ‍samitiḥ, yut, pradhanam, āskandanam, ‍sāṃparāthikam, raṇaḥ, saṃprahāraḥ, saṃsphoṭaḥ, ‍samāghātaḥ, samudāyaḥ, ājiḥ
śraviṣṭāFeminineSingulardhaniṣṭhāstar in cancer
caṇḍāṃśoḥ paripārśvikaḥ1.3.31MasculinePluraldaṇḍaḥ, māṭharaḥ, piṅgalaḥsun's attendant
āśvinaḥMasculineSingularāśvayujaḥ, iṣaḥaashvinah
saṃvit1.5.5FeminineSingularpratiśravaḥ, saṃśravaḥ, pratijñānam, abhyupagamaḥ, āśravaḥ, āgūḥ, samādhiḥ, aṅgīkāraḥ, niyamaḥagreement
sāttvikam1.7.16MasculineSingularone kind of acting,gesticulated
vikaḥMasculineSingularbelonging of river devika
kovidāraḥ2.4.22MasculineSingularyugapatrakaḥ, camarikaḥ, kuddālaḥ
cirivilvaḥ2.2.47MasculineSingularnaktamālaḥ, karajaḥ, karañjakaḥ
kṣīravidārīFeminineSingularmahāśvetā, ṛkṣagandhikā
dviFeminineSingularkauntī, kapilā, bhasmagandhinī, hareṇū, reṇukā
tapasviFeminineSingularjaṭilā, lomaśā, misī, jaṭā, māṃsī
kuruvindaḥMasculineSingularmeghanāmā, mustā, mustakam
śvāvit2.2.8MasculineSingularśalyaḥ
sthaviraḥ2.6.42MasculineSingularjīnaḥ, jīrṇaḥ, jaran, pravayāḥ, vṛddhaḥ
ṛtvijaḥ2.7.19MasculineSingularāgnīdhraḥ, yājakaḥ
dhavitram2.7.25NeuterSingular
havi2.7.28NeuterSingularsānnāyyam
parivittiḥ2.7.60MasculineSingular
prāḍvivākaḥ2.8.5MasculineSingularakṣadarśakaḥ
dvipādyaḥ2.8.27MasculineSingular
kavi2.8.49FeminineSingular‍khalīnaḥ
ahaṃpūrvi2.8.103FeminineSingular
vi2.9.1FeminineSingular‍ājīvaḥ, vārtā, vṛttiḥ, vartanam, jīvanam
dviguṇākṛtam2.9.9MasculineSingulardvitīyākṛtam, dvihalyam, dvisītyam, ‍śambākṛtam
davi2.9.34FeminineSingularkhajākā, kambiḥ
govi2.9.51FeminineSingulargomayam
dvivarṣā2.9.69FeminineSingularekābdā
vaiṇivi2.10.13MasculineSingular‍veṇudhmaḥ
carmaprasevi2.10.33FeminineSingularbhastrā
śāstravit3.1.4MasculineSingularantarvāṇiḥ
avinītaḥ3.1.21MasculineSingularsamuddhataḥ
śiśvidānaḥ3.1.44MasculineSingularakṛṣṇakarmā
avilambitam3.1.82MasculineSingularuccaṇḍam
āvidhaḥ2.4.36MasculineSingular
dvijaḥ3.3.36MasculineSingularpūrdvāraḥ, kṣetram
śipiviṣṭaḥ3.3.40MasculineSingularśubham, aśubham
draviṇam3.3.58NeuterSingularsādhakatamam, kṣetram, gātram, indriyam
govindaḥ3.3.98MasculineSingularṛtuḥ, vatsaraḥ
saṃvit3.3.99FeminineSingularkṛtyam, pratiṣṭhā
tarasvinaḥ3.3.135MasculineSingularharaḥ, viṣṇuḥ
dvijihvaḥ3.3.141MasculineSingularbrahmā, trilocanaḥ
avi:3.3.215MasculineSingularutsekaḥ, amarṣaḥ, icchāprasavaḥ, mahaḥ
tvi3.3.233FeminineSingularsūryaḥ, vahniḥ
svit3.3.250MasculineSingulararthaḥ, vikalpaḥ
kaviyam3.5.35MasculineSingular
Monier-Williams Search
Results for vi
Devanagari
BrahmiEXPERIMENTAL
vim. (Nominal verb v/is-or v/es- accusative v/im- genitive case ablative v/es-; plural Nominal verb accusative v/ayas-[acc. vīn- ]; v/ibhis-, v/ibhyas-, vīn/ām-) a bird (also applied to horses, arrows, and the marut-s) (also occurring in later language).[ confer, compare 1. v/ayas-; Greek for ; Latin a-vis; according to tosome German Ei; Anglo-Saxon ae4g; English egg.] View this entry on the original dictionary page scan.
vin. an artificial word said to be equals anna- View this entry on the original dictionary page scan.
viind. (prob. for an original dvi-,meaning"in two parts";and opp. to sam- q.v) apart, asunder, in different directions, to and fro, about, away, away from, off, without etc. etc. In it appears also as a preposition with accusative denoting"through"or"between"(with ellipse of the verb i, 181, 5; x, 86, 20 etc.'>) It is especially used as a prefix to verbs or nouns and other parts of speech derived from verbs, to express"division","distinction","distribution","arrangement","order","opposition", or"deliberation" (see vi-bhid-, -śiṣ-, -dhā-, -rudh-, -car-,with their nominal derivatives) View this entry on the original dictionary page scan.
viind. sometimes it gives a meaning opposite to the idea contained in the simple root (exempli gratia, 'for example' krī-,"to buy"; vi-krī-,"to sell") , or it intensifies that idea (exempli gratia, 'for example' hiṃs-,"to injure"; vi-hiṃs-,"to injure severely") . The above 3. v/i- may also be used in forming compounds not immediately referable to verbs, in which cases it may express"difference" (confer, compare 1. vi-lakṣaṇa-),"change"or"variety" (confer, compare vi-citra-),"intensity" (confer, compare vi-karāla-),"manifoldness" (confer, compare vi-vidha-),"contrariety" (confer, compare vi-loma-),"deviation from right" (confer, compare vi-śīla-),"negation"or"privation" (confer, compare vi-kaccha-,being often used like 3. a-, nir-,and nis-[qq. vv.], and like the Latin dis,se,and the Englisha,dis,in,unetc.) View this entry on the original dictionary page scan.
viind. in some cases it does not seem to modify the meaning of the simple word at all (see vi-jāmi-, vi-jāmātṛ-) View this entry on the original dictionary page scan.
viind. it is also used to form proper names out of other proper names (exempli gratia, 'for example' vi-koka-, vi-pṛthu-, vi-viṃśa-). To save space such words are here mostly collected under one article View this entry on the original dictionary page scan.
viind. but words having several subordinate compounds will be found sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vibaddhamfn. bound or fastened etc. View this entry on the original dictionary page scan.
vibaddhamfn. obstructed, constipated (as the bowels) View this entry on the original dictionary page scan.
vibaddhakamfn. gaRa ṛśyādi-. View this entry on the original dictionary page scan.
vibādhA1. -bādhate-, to press or drive asunder in different directions, drive or scare away ; to oppress, harass, annoy, molest, afflict, injure, violate : Intensive -bābadhe-, to release, set free
vibādham. an expeller, remover ( v/i-b-) View this entry on the original dictionary page scan.
vibādham. expulsion, removal (in vibādhavat dh/a-vat- mfn.expelling, removing) View this entry on the original dictionary page scan.
vibādhāf. pressure, pain, agony, anguish View this entry on the original dictionary page scan.
vibādhavatmfn. vibādha
vibāhumfn. deprived of arms, armless View this entry on the original dictionary page scan.
vibāhu vi-bila- etc. See . View this entry on the original dictionary page scan.
vibalamfn. having no strength, weak View this entry on the original dictionary page scan.
vibalākamfn. not filled with cranes (as a cloud) (Scholiast or Commentator) View this entry on the original dictionary page scan.
vibālīf. (of doubtful derivation) Name of a river View this entry on the original dictionary page scan.
vibāṇamfn. without an arrow (as a bow) View this entry on the original dictionary page scan.
vibāṇadhimfn. without a quiver View this entry on the original dictionary page scan.
vibāṇajyamfn. without an arrow and a string
vibandhP. A1. -badhnāti-, -badhnīte-, to bind or fasten on different sides, stretch out, extend ; to seize or hold by (instrumental case) ; to obstruct (faeces) View this entry on the original dictionary page scan.
vibandham. encircling, encompassing View this entry on the original dictionary page scan.
vibandham. equals ākalana- View this entry on the original dictionary page scan.
vibandham. a circular bandage View this entry on the original dictionary page scan.
vibandham. obstruction, constipation View this entry on the original dictionary page scan.
vibandham. a remedy for promoting obstruction View this entry on the original dictionary page scan.
vibandhahṛtmfn. destroying or curing obstruction View this entry on the original dictionary page scan.
vibandhanamfn. obstructing, constipating View this entry on the original dictionary page scan.
vibandhanan. the act of fastening or binding on both sides ( parasparavibandhana paraspara-vi-bandhana-, mfn.mutually bound, depending on each other) View this entry on the original dictionary page scan.
vibandhu(v/i--) mfn. having no relations View this entry on the original dictionary page scan.
vibandhu vi-bala-, vi-bāṇa- etc. See . View this entry on the original dictionary page scan.
vibarhamfn. (for 2.See under vi--1. bṛh-) having no tail-feathers View this entry on the original dictionary page scan.
vibarham. (for 1.See) scattering, dispersing (in a-v-) View this entry on the original dictionary page scan.
vibbokaSee bibboka-. View this entry on the original dictionary page scan.
vibhāP. -bhāti-, to shine or gleam forth, come to light, become visible, appear etc. ; to shine upon, illumine ; to procure light id est to kindle (fire dative case) ; to shine brightly, glitter, be resplendent or beautiful, strike or catch the eye, excel by (instrumental case) etc. ; to strike the ear, be heard (as sound) ; to seem or appear as, look like (Nominal verb with or without iva-,or adverb in -vat-) View this entry on the original dictionary page scan.
vibhāmfn. shining, bright View this entry on the original dictionary page scan.
vibhāf. light, lustre, splendour, beauty View this entry on the original dictionary page scan.
vibhāf. Name of the city of soma- View this entry on the original dictionary page scan.
vibhāgam. distribution, apportionment View this entry on the original dictionary page scan.
vibhāgam. partition of patrimony, law of inheritance (one of the 18 titles or branches of law) etc. (see ) View this entry on the original dictionary page scan.
vibhāgam. a share, portion, section, constituent part of anything etc. View this entry on the original dictionary page scan.
vibhāgam. division, separation, distinction, difference etc. (ena-,separately, singly, in detail; see also yoga-v-) View this entry on the original dictionary page scan.
vibhāgam. disjunction (opp. to saṃ-yoga-and regarded in nyāya- as one of the 24 guṇa-s) View this entry on the original dictionary page scan.
vibhāgam. (in arithmetic) the numerator of a fraction View this entry on the original dictionary page scan.
vibhāgam. Name of śiva- View this entry on the original dictionary page scan.
vibhāgabhājmfn. one who shares in a portion of property already distributed (applied especially to a son by a father and mother of the same tribe, born subsequently to a distribution of property amongst his parents and brethren, in which case he inherits the portion allotted or reserved to the parents) View this entry on the original dictionary page scan.
vibhāgabhinnan. equals takra-, buttermilk mixed with water View this entry on the original dictionary page scan.
vibhāgadharmam. the law of division, rule of inheritance View this entry on the original dictionary page scan.
vibhāgajñamfn. (in fine compositi or 'at the end of a compound') knowing the difference between View this entry on the original dictionary page scan.
vibhāgakam. a distributer, arranger (perhaps wrong reading for bhājaka-). View this entry on the original dictionary page scan.
vibhāgakalpanāf. apportioning or allotment of shares or portions View this entry on the original dictionary page scan.
vibhāgapattrikāf. a deed of partition View this entry on the original dictionary page scan.
vibhāgarekhāf. partition-line, boundary between (genitive case) View this entry on the original dictionary page scan.
vibhāgasāram. Name of work View this entry on the original dictionary page scan.
vibhāgaśasind. according to a part or share, separately, proportionately etc. View this entry on the original dictionary page scan.
vibhāgaśasind. (in fine compositi or 'at the end of a compound') according to
vibhāgatasind. according to a part or share, proportionately View this entry on the original dictionary page scan.
vibhāgatattvavicāram. Name of work View this entry on the original dictionary page scan.
vibhāgatvan. state of separation or distinction View this entry on the original dictionary page scan.
vibhāgavatmfn. divided, separated, distinguished ( vibhāgavattā -- f.) View this entry on the original dictionary page scan.
vibhāgavattāf. vibhāgavat
vibhāgecchumfn. wishing for a partition or distribution View this entry on the original dictionary page scan.
vibhāgīkṛP. -karoti-, to divide, parcel out View this entry on the original dictionary page scan.
vibhāginSee a-vibhāgin-. View this entry on the original dictionary page scan.
vibhagnamfn. broken asunder, shattered, crushed View this entry on the original dictionary page scan.
vibhāgyamfn. to be separated or divided View this entry on the original dictionary page scan.
vibhajP. A1. -bhajati-, te-, to divide, distribute, apportion, assign (with two accusative,or with accusative of thing and dative case or locative case of Persian,or with accusative of Persian and instrumental case of thing) etc. (A1.also ="to share together or with each other"or"to share with [ instrumental case ]";with samam-,to divide into equal parts;with ardham-and genitive case,to divide in halves) ; to separate, part, cut etc. ; to divide (arithmetically) ; to open (a box or chest) ; to worship : Passive voice -bhajyate-, to receive one's share from (instrumental case) : Causal -bhājayati-, to cause to distribute or divide or share ; to divide
vibhājmfn. separating, dividing View this entry on the original dictionary page scan.
vibhajam. a particular high number View this entry on the original dictionary page scan.
vibhājakamfn. idem or 'mfn. separating, dividing ' View this entry on the original dictionary page scan.
vibhājakamfn. distributing, apportioning View this entry on the original dictionary page scan.
vibhājakībhūtamfn. being a distributer or divider View this entry on the original dictionary page scan.
vibhajanan. separation, distinction View this entry on the original dictionary page scan.
vibhājanan. division, distinction View this entry on the original dictionary page scan.
vibhājanan. the act of causing to share or distribute, participation View this entry on the original dictionary page scan.
vibhajanīyamfn. to be apportioned or partitioned or distributed or divided etc. View this entry on the original dictionary page scan.
vibhājayitṛmfn. one who causes to divide or distribute Va1rtt. 3. View this entry on the original dictionary page scan.
vibhājitamfn. caused to be divided, distributed, apportioned, partitioned View this entry on the original dictionary page scan.
vibhajyamfn. to be divided View this entry on the original dictionary page scan.
vibhajyamfn. to be (or being) distinguished View this entry on the original dictionary page scan.
vibhajyaind. having distributed or separated or divided, by dividing or distinguishing etc. View this entry on the original dictionary page scan.
vibhājyamfn. to be divided or apportioned, divisible View this entry on the original dictionary page scan.
vibhajyapāṭham. the distinct pronunciation (of every sound) View this entry on the original dictionary page scan.
vibhajyavādam. a particular Buddhist doctrine View this entry on the original dictionary page scan.
vibhajyavādinm. an adherent of the above doctrine View this entry on the original dictionary page scan.
vibhākaram. "light-maker", the sun View this entry on the original dictionary page scan.
vibhākaram. fire View this entry on the original dictionary page scan.
vibhākaram. that portion of the moon which is illumined by the sun View this entry on the original dictionary page scan.
vibhākaram. a king, prince (and"the sun") View this entry on the original dictionary page scan.
vibhākaraśarmanm. (Name of a poet ) View this entry on the original dictionary page scan.
vibhaktamfn. divided, distributed among (instrumental case). etc. ( vibhakte te- ind.after a partition, ) View this entry on the original dictionary page scan.
vibhaktamfn. one who has received his share View this entry on the original dictionary page scan.
vibhaktamfn. one who has caused a partition to be made (Scholiast or Commentator) View this entry on the original dictionary page scan.
vibhaktamfn. parted, separated by (instrumental case or compound) etc. View this entry on the original dictionary page scan.
vibhaktamfn. separated from id est without (instrumental case) View this entry on the original dictionary page scan.
vibhaktamfn. isolated, secluded View this entry on the original dictionary page scan.
vibhaktamfn. distinct, different, various, manifold etc. View this entry on the original dictionary page scan.
vibhaktamfn. divided into regular parts, harmonious, symmetrical View this entry on the original dictionary page scan.
vibhaktamfn. ornamented, decorated View this entry on the original dictionary page scan.
vibhaktamfn. divided (arithmetically) View this entry on the original dictionary page scan.
vibhaktam. Name of skanda- View this entry on the original dictionary page scan.
vibhaktan. isolation, seclusion, solitude View this entry on the original dictionary page scan.
vibhaktagātramfn. one whose limbs are embellished with (compound) View this entry on the original dictionary page scan.
vibhaktajam. a son born after the partition of the family property between his parents and brothers View this entry on the original dictionary page scan.
vibhaktātmanmfn. divided (in his essence) View this entry on the original dictionary page scan.
vibhaktatvan. manifoldness, variety (quot.) View this entry on the original dictionary page scan.
vibhaktāvibhaktanirṇayam. Name of work View this entry on the original dictionary page scan.
vibhakteind. vibhakta
vibhaktif. separation, partition, division, distinction, modification View this entry on the original dictionary page scan.
vibhaktif. part, portion, share of inheritance etc. View this entry on the original dictionary page scan.
vibhaktif. (in gram.) inflection of nouns, declension, an affix of declension, case (according to to "a termination or inflection either of a case or of the persons of a tense";certain taddhita- affixes which are used like case terminations have also the name vi-bhakti-;in the yājyā- formulas especially the cases of agni-are so called) etc. View this entry on the original dictionary page scan.
vibhaktif. a particular division of a sāman- (equals bhakti-) View this entry on the original dictionary page scan.
vibhaktif. a particular high number View this entry on the original dictionary page scan.
vibhaktika(in fine compositi or 'at the end of a compound') equals bhakti- (in āpta-v-,complete as to case terminations) View this entry on the original dictionary page scan.
vibhaktinSee a-vibhaktin-. View this entry on the original dictionary page scan.
vibhaktitattvan. Name of work View this entry on the original dictionary page scan.
vibhaktivivaraṇan. Name of work View this entry on the original dictionary page scan.
vibhaktṛmfn. (with genitive case,or v/i-bhaktṛ-,with accusative) one who distributes, distributer, apportioner View this entry on the original dictionary page scan.
vibhaktṛmfn. (in fine compositi or 'at the end of a compound') an arranger View this entry on the original dictionary page scan.
vibhaktyarthakārakaprakriyāf. Name of work View this entry on the original dictionary page scan.
vibhaktyarthanirṇayam. Name of work View this entry on the original dictionary page scan.
vibhaktyarthavicāram. Name of work View this entry on the original dictionary page scan.
vibhāṇḍam. Name of a man View this entry on the original dictionary page scan.
vibhāṇḍam. equals -māṇḍavya- View this entry on the original dictionary page scan.
vibhāṇḍaf. equals nīlagokarṇī- View this entry on the original dictionary page scan.
vibhāṇḍakam. Name of muni- View this entry on the original dictionary page scan.
vibhaṇḍaka wrong reading for vi-bhāṇḍaka- (See) . View this entry on the original dictionary page scan.
vibhāṇḍīf. the senna plant View this entry on the original dictionary page scan.
vibhāṇḍikāf. Senna Obtusa View this entry on the original dictionary page scan.
vibhaṅgam. bending, contraction (especially of the eyebrows) View this entry on the original dictionary page scan.
vibhaṅgam. a furrow, wrinkle View this entry on the original dictionary page scan.
vibhaṅgam. interruption, stoppage, frustration, disturbance View this entry on the original dictionary page scan.
vibhaṅgam. fraud, deception View this entry on the original dictionary page scan.
vibhaṅgam. a wave View this entry on the original dictionary page scan.
vibhaṅgam. breaking, fracture View this entry on the original dictionary page scan.
vibhaṅgam. division View this entry on the original dictionary page scan.
vibhaṅgam. Name of a class of Buddhist works. View this entry on the original dictionary page scan.
vibhaṅgif. mere appearance or semblance (see bhaṅgi-) View this entry on the original dictionary page scan.
vibhaṅgif. the mere semblance of anything (= bhaṅgi-), View this entry on the original dictionary page scan.
vibhaṅginmfn. wavy, undulating, wrinkled View this entry on the original dictionary page scan.
vibhaṅguramfn. unsteady (as a look) View this entry on the original dictionary page scan.
vibhañjP. -bhanakti-, to break asunder, break to pieces etc. ; to frustrate, disappoint View this entry on the original dictionary page scan.
vibhānumfn. shining, beaming, radiant View this entry on the original dictionary page scan.
vibharaṭṭam. Name of a king (varia lectio vi-bharata-). View this entry on the original dictionary page scan.
vibhāṣA1. -bhāṣate-, to speak variously, speak against, abuse, revile ; (in gram.) to admit an alternative, be optional
vibhāsA1. -bhāsate- (in Vedic or Veda also P.), to shine brightly or pleasantly, be bright : Causal -bhāsayati-, to cause to shine, illuminate, brighten View this entry on the original dictionary page scan.
vibhāsf. brightness, splendour View this entry on the original dictionary page scan.
vibhāṣāf. (for 2.See vi-bhāṣ-) a class of Prakrit languages View this entry on the original dictionary page scan.
vibhāṣāf. (in music) a particular rāgiṇī- View this entry on the original dictionary page scan.
vibhāṣāf. (with Buddhists) a great Commentary. View this entry on the original dictionary page scan.
vibhāṣāf. (for 1.See) an alternative, option, optionality (vi-bhāṣayā-,optionally) , one of two ways (see vi-kalpa-) View this entry on the original dictionary page scan.
vibhāṣāf. (in gram.) the allowing a rule to be optional (of two kinds, viz. prāpta-v-or prāpte v-,an option allowed in a particular operation which another rule makes necessary; aprāpta-v-or aprāpte v-,an option allowed in a particular operation which another rule makes impossible) View this entry on the original dictionary page scan.
vibhāsam. Name of one of the 7 suns View this entry on the original dictionary page scan.
vibhāsam. a particular rāga- View this entry on the original dictionary page scan.
vibhāsam. Name of a deity View this entry on the original dictionary page scan.
vibhāsāf. shining brightly, light, lustre View this entry on the original dictionary page scan.
vibhāṣāvṛttif. Name of work View this entry on the original dictionary page scan.
vibhāṣinmfn. adorned, decorated(in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vibhāṣinmfn. adorning, "omnipotent"(said of śiva-; see vi-bhū-) View this entry on the original dictionary page scan.
vibhāṣitamfn. admitting an alternative (especially in gram. = optional) View this entry on the original dictionary page scan.
vibhāsitamfn. (fr. Causal) made bright, illuminated View this entry on the original dictionary page scan.
vibhāskaramfn. having no sun, without the sun View this entry on the original dictionary page scan.
vibhasmanmfn. free from ashes or dust View this entry on the original dictionary page scan.
vibhasmīkaraṇan. freeing from ashes, dusting View this entry on the original dictionary page scan.
vibhātmfn. shining, splendid (applied to uṣas-) View this entry on the original dictionary page scan.
vibhātm. the world of prajā-pati- View this entry on the original dictionary page scan.
vibhātamfn. shone forth, grown light etc. (tā vibhāvarī-,the morning has dawned ) View this entry on the original dictionary page scan.
vibhātamfn. become visible, appeared View this entry on the original dictionary page scan.
vibhātan. dawn, day-break, morning View this entry on the original dictionary page scan.
vibhāva(for 2.See) mf(arī-See next)n. (vocative case vi-bhāvas-), idem or 'mfn. shining, beaming, radiant ' View this entry on the original dictionary page scan.
vibhāva1. and 2. vi-bhāva-. See above and . View this entry on the original dictionary page scan.
vibhavamfn. powerful, rich View this entry on the original dictionary page scan.
vibhavam. being everywhere, omnipresence View this entry on the original dictionary page scan.
vibhavam. development, evolution (with vaiṣṇava-s"the evolution of the Supreme Being into secondary forms") View this entry on the original dictionary page scan.
vibhavam. power, might, greatness, exalted position, rank, dignity, majesty, dominion etc. (in fine compositi or 'at the end of a compound' with locative case,"one whose power consists in") View this entry on the original dictionary page scan.
vibhavam. influence upon (locative case) View this entry on the original dictionary page scan.
vibhavam. (also plural) wealth, money, property, fortune etc. View this entry on the original dictionary page scan.
vibhavam. luxury, anything sumptuary or superfluous View this entry on the original dictionary page scan.
vibhavam. magnanimity, lofty-mindedness View this entry on the original dictionary page scan.
vibhavam. emancipation from existence View this entry on the original dictionary page scan.
vibhavam. Name of the 2nd year in Jupiter's cycle of 60 years View this entry on the original dictionary page scan.
vibhavam. destruction (of the world) View this entry on the original dictionary page scan.
vibhavam. (in music) a kind of measure View this entry on the original dictionary page scan.
vibhāvam. (for 1.See under vi-bhā-) any condition which excites or develops a particular state of mind or body, any cause of emotion (exempli gratia, 'for example' the persons and circumstances represented in a drama, as opp. to the anu-bhāva-or external signs or effects of emotion) ( vibhāvatva -tva- n.) View this entry on the original dictionary page scan.
vibhāvam. a friend, acquaintance View this entry on the original dictionary page scan.
vibhāvam. Name of śiva- View this entry on the original dictionary page scan.
vibhāvakamfn. causing to appear, procuring or intending to procure (in fine compositi or 'at the end of a compound') ) View this entry on the original dictionary page scan.
vibhāvakamfn. discussing View this entry on the original dictionary page scan.
vibhavakṣayam. loss of fortune or property View this entry on the original dictionary page scan.
vibhavamadam. the pride of power View this entry on the original dictionary page scan.
vibhavamatif. Name of a princess View this entry on the original dictionary page scan.
vibhāvanmf(arī-See next)n. (vocative case vi-bhāvas-), idem or '(for 2.See) mf(arī-See next)n. (vocative case vi-bhāvas-), idem or 'mfn. shining, beaming, radiant ' ' View this entry on the original dictionary page scan.
vibhāvanamfn. causing to appear, developing, manifesting View this entry on the original dictionary page scan.
vibhāvanāf. (in rhetoric) description of effects the causes of which are left to be conjectured (or according to to some, "description by negatives, bringing out the qualities of any object more clearly than by positive description") etc. View this entry on the original dictionary page scan.
vibhāvanan. causing to appear or become visible, development, creation (Scholiast or Commentator equals pālana-) View this entry on the original dictionary page scan.
vibhāvanan. showing, manifesting on View this entry on the original dictionary page scan.
vibhāvanan. clear perception, examination, judgement, clear ascertainment View this entry on the original dictionary page scan.
vibhāvanan. (in fine compositi or 'at the end of a compound') reflection on View this entry on the original dictionary page scan.
vibhāvanan. the act of producing a particular emotion by a work of art View this entry on the original dictionary page scan.
vibhāvanālaṃkāram. the rhetorical figure described above View this entry on the original dictionary page scan.
vibhāvanīyamfn. (fr. Causal) to be clearly perceived or ascertained View this entry on the original dictionary page scan.
vibhāvanīyamfn. to be convicted (equals bhāvya-) on View this entry on the original dictionary page scan.
vibhāvarīf. (See prec.) brilliant, bright (in often applied to uṣas-,"Dawn"; according to to on also equals kupitā-) View this entry on the original dictionary page scan.
vibhāvarīf. the (starry) night etc. View this entry on the original dictionary page scan.
vibhāvarīf. turmeric View this entry on the original dictionary page scan.
vibhāvarīf. equals -haridrā- and drā-dāru- View this entry on the original dictionary page scan.
vibhāvarīf. a kind of ginger View this entry on the original dictionary page scan.
vibhāvarīf. a procuress View this entry on the original dictionary page scan.
vibhāvarīf. a deceitful woman View this entry on the original dictionary page scan.
vibhāvarīf. a loquacious woman View this entry on the original dictionary page scan.
vibhāvarīf. (?) the shreds of a garment torn in a scuffle (= vivāda-vastra-guṇṭhī-or tra-muṇḍī-) View this entry on the original dictionary page scan.
vibhāvarīf. a kind of metre View this entry on the original dictionary page scan.
vibhāvarīf. Name of a daughter of the vidyādhara- mandāra- View this entry on the original dictionary page scan.
vibhāvarīf. of the city of soma- View this entry on the original dictionary page scan.
vibhāvarīf. of the city of the pracetas- View this entry on the original dictionary page scan.
vibhāvarīkāntam. "husband of night", the moon View this entry on the original dictionary page scan.
vibhāvarīmukhan. "beginning of night", evening View this entry on the original dictionary page scan.
vibhāvarīśam. "lord of night", the moon View this entry on the original dictionary page scan.
vibhāvasumfn. abounding in light (applied to agni-, soma-, and kṛṣṇa-) View this entry on the original dictionary page scan.
vibhāvasum. fire or the god of fire etc. View this entry on the original dictionary page scan.
vibhāvasum. the sun View this entry on the original dictionary page scan.
vibhāvasum. the moon View this entry on the original dictionary page scan.
vibhāvasum. a sort of necklace or garland View this entry on the original dictionary page scan.
vibhāvasum. Name of one of the 8 vasu-s View this entry on the original dictionary page scan.
vibhāvasum. of a son of naraka- View this entry on the original dictionary page scan.
vibhāvasum. of a dānava- View this entry on the original dictionary page scan.
vibhāvasum. of a ṛṣi- View this entry on the original dictionary page scan.
vibhāvasum. of a mythical prince dwelling on the mountain gaja-pura- View this entry on the original dictionary page scan.
vibhāvasum. of a gandharva- (who is said to have stolen the soma- from gāyatrī- as she was carrying it to the gods) View this entry on the original dictionary page scan.
vibhāvatmfn. very brilliant or resplendent View this entry on the original dictionary page scan.
vibhavatasind. according to rank or fortune or dignity View this entry on the original dictionary page scan.
vibhāvatvan. vibhāva
vibhavavatmfn. possessed of power, wealthy
vibhāvāyum. morning-wind, View this entry on the original dictionary page scan.
vibhavinmfn. rich, wealthy View this entry on the original dictionary page scan.
vibhāvinmfn. mighty, powerful View this entry on the original dictionary page scan.
vibhāvinmfn. (in fine compositi or 'at the end of a compound') causing to appear ( varṇavibhāvin varṇa--vi-bhāvin- m.Name of śiva-) View this entry on the original dictionary page scan.
vibhāvinmfn. arousing a particular emotion (especially of love) View this entry on the original dictionary page scan.
vibhāvitamfn. (fr. Causal) caused to arise or appear etc. View this entry on the original dictionary page scan.
vibhāvitatvan. the state of being perceived or judged View this entry on the original dictionary page scan.
vibhāvyamfn. to be clearly perceived or observed, distinguishable, comprehensible etc. View this entry on the original dictionary page scan.
vibhāvyamfn. to be attended to or heeded (n. impersonal or used impersonally"it should be heeded") View this entry on the original dictionary page scan.
vibhayan. freedom from danger View this entry on the original dictionary page scan.
vibhayamfn. not exposed to danger View this entry on the original dictionary page scan.
vibhedam. breaking asunder, splitting, piercing, division, separation etc. View this entry on the original dictionary page scan.
vibhedam. knitting, contraction (of the brows) View this entry on the original dictionary page scan.
vibhedam. interruption, disturbance View this entry on the original dictionary page scan.
vibhedam. change, alteration View this entry on the original dictionary page scan.
vibhedam. diverging (in opinion), dissension, disagreeing with (samam-) etc. View this entry on the original dictionary page scan.
vibhedam. distinction, variety View this entry on the original dictionary page scan.
vibhedakamfn. distinguishing anything (genitive case) from (ablative) View this entry on the original dictionary page scan.
vibhedakam. equals vibhīdaka- View this entry on the original dictionary page scan.
vibhedanamfn. splitting, cleaving, piercing View this entry on the original dictionary page scan.
vibhedanan. the act of splitting etc. View this entry on the original dictionary page scan.
vibhedanan. setting at variance, disuniting View this entry on the original dictionary page scan.
vibhedikamfn. separating, dividing (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vibhedinmfn. piercing, rending (See marma-bh-) View this entry on the original dictionary page scan.
vibhedinmfn. dispelling, destroying (with genitive case) View this entry on the original dictionary page scan.
vibhedyamfn. to be split or cleft or broken View this entry on the original dictionary page scan.
vibhetavyan. (impersonal or used impersonally) it is to be feared (varia lectio) View this entry on the original dictionary page scan.
vibhettṛmfn. one who splits or breaks asunder, a destroyer of (genitive case) View this entry on the original dictionary page scan.
vibhīmfn. fearless View this entry on the original dictionary page scan.
vibhīP. -bibheti-, to be afraid of, fear : Causal -bhīṣayati-, te-, to frighten, terrify, intimidate View this entry on the original dictionary page scan.
vibhidP. A1. -bhinatti-, -bhintte- to split or break in two, break in pieces, cleave asunder, divide, separate, open etc. ; to pierce, sting ; to loosen, untie ; to break, infringe, violate ; to scatter, disperse, dispel, destroy etc. ; to alter, change (the mind) : Passive voice to be split or broken, burst asunder etc. (also P. Conditional vyabhetsyat- ) ; to be changed or altered : Causal -bhedayati-, to cause to split etc. ; to divide, alienate, estrange View this entry on the original dictionary page scan.
vibhidam. Name of a demon View this entry on the original dictionary page scan.
vibhidāf. "perforation"and"falling away","apostasy" View this entry on the original dictionary page scan.
vibhīdakam. n. idem or 'n. its berry (used as a die) ' (see vi-bhedaka-under vi-bhid-). View this entry on the original dictionary page scan.
vibhindumfn. splitting or cleaving asunder View this entry on the original dictionary page scan.
vibhindum. Name of a man View this entry on the original dictionary page scan.
vibhindukam. Name of an asura- View this entry on the original dictionary page scan.
vibhinnamfn. split or broken in two etc. View this entry on the original dictionary page scan.
vibhinnamfn. passed across or through (as by a heavenly body) View this entry on the original dictionary page scan.
vibhinnamfn. opened blown View this entry on the original dictionary page scan.
vibhinnamfn. cleft (said of the temples of an elephant which exude during rut) View this entry on the original dictionary page scan.
vibhinnamfn. broken, destroyed View this entry on the original dictionary page scan.
vibhinnamfn. altered, changed (also in one's feelings) View this entry on the original dictionary page scan.
vibhinnamfn. alienated, estranged, become faithless View this entry on the original dictionary page scan.
vibhinnamfn. separated, divided View this entry on the original dictionary page scan.
vibhinnamfn. disunited, living at variance View this entry on the original dictionary page scan.
vibhinnamfn. (a place) filled with dissensions View this entry on the original dictionary page scan.
vibhinnamfn. disappointed (See āśā-v-) View this entry on the original dictionary page scan.
vibhinnamfn. contradictory View this entry on the original dictionary page scan.
vibhinnamfn. various, manifold View this entry on the original dictionary page scan.
vibhinnamfn. mingled with (instrumental case) View this entry on the original dictionary page scan.
vibhinnam. Name of śiva- View this entry on the original dictionary page scan.
vibhinnadarśinmfn. seeing different things, discerning differences, discerning well View this entry on the original dictionary page scan.
vibhinnadhairyamfn. having firmness or constancy shaken View this entry on the original dictionary page scan.
vibhinnāṅgamfn. one who has his body pierced or transfixed View this entry on the original dictionary page scan.
vibhinnatāf. the state of being broken or split asunder or scattered etc. View this entry on the original dictionary page scan.
vibhinnatamisramfn. having darkness expelled or destroyed View this entry on the original dictionary page scan.
vibhinnatvan. the state of being broken or split asunder or scattered etc. View this entry on the original dictionary page scan.
vibhinnaveṣamfn. dressed in various garments View this entry on the original dictionary page scan.
vibhinnīkṛP. -karoti-, to separate, divide View this entry on the original dictionary page scan.
vibhīṣāf. the wish or intention of terrifying View this entry on the original dictionary page scan.
vibhīṣakamf(ikā-)n. frightening, terrifying
vibhīṣaṇamf(ā-)n. terrifying, fearful, horrible etc. View this entry on the original dictionary page scan.
vibhīṣaṇamf(ā-)n. bullying or blustering (as language) View this entry on the original dictionary page scan.
vibhīṣaṇam. miscarriage, abortion View this entry on the original dictionary page scan.
vibhīṣaṇam. Amphidonax Karka View this entry on the original dictionary page scan.
vibhīṣaṇam. Name of a brother of rāvaṇa- (his other brothers were kubera- [by a different mother] and kumbha-karṇa-;both rāvaṇa- and vibhīṣaṇa- are said to have propitiated brahmā- by their penances, so that the god granted them both boons, and the boon chosen by vibhīṣaṇa- was that he should never, even in the greatest calamity, stoop to any mean action;hence he is represented in the rāmāyaṇa- as endeavouring to counteract the malice of his brother rāvaṇa-, in consequence of which he was so ill-treated by him that, leaving laṅkā-, he joined rāma-, by whom, after the death of rāvaṇa-, vibhīṣaṇa- was placed on the throne of laṅkā-) etc. View this entry on the original dictionary page scan.
vibhīṣaṇam. of two kings of kaśmīra- (the sons of go-narda- and rāvaṇa-) (in later times vibhīṣaṇa- appears to have been used as a general Name of the kings of laṅkā-) View this entry on the original dictionary page scan.
vibhīṣaṇam. Name of an author View this entry on the original dictionary page scan.
vibhīṣaṇāf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
vibhīṣaṇan. the act or a means of terrifying, terror, intimidation View this entry on the original dictionary page scan.
vibhīṣaṇan. Name of the 11th muhūrta- View this entry on the original dictionary page scan.
vibhīṣaṇābhiṣekam. " vibhīṣaṇa-'s inauguration", Name of (according to to one recension) . View this entry on the original dictionary page scan.
vibhīṣikāf. the act of terrifying, means of terrifying, terror etc. View this entry on the original dictionary page scan.
vibhīṣikāf. See under vi-bhīṣaka- above. View this entry on the original dictionary page scan.
vibhīṣikāsthānan. an object or means of terrifying View this entry on the original dictionary page scan.
vibhītamfn. (for 2. and 3.See sub voce, i.e. the word in the Sanskrit order) idem or 'mfn. fearless ' View this entry on the original dictionary page scan.
vibhītamfn. (for 1.See;for 3.See column 2) afraid, intimidated View this entry on the original dictionary page scan.
vibhītam. n. equals next View this entry on the original dictionary page scan.
vibhītakaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vibhītakam. (orf(ī-).) the tree Terminalia Bellerica View this entry on the original dictionary page scan.
vibhītakan. its berry (used as a die) View this entry on the original dictionary page scan.
vibhittif. cleaving, splitting View this entry on the original dictionary page scan.
vibhokam. Name of a poet View this entry on the original dictionary page scan.
vibhṛP. A1. -bharati-, te-, to spread out, spread asunder ; (A1.) to distribute, diffuse ; to bear, endure : Intensive (only -bh/aribhrat-and -jarbhrit/as-), to move hither and thither or from side to side (as the tongue) : to open the mouth, gape View this entry on the original dictionary page scan.
vibhrājA1. -bhrājate- (Epic also P.), to shine forth, be bright or radiant etc. ; to shine through (accusative) ; Causal -bhrājayati-, to cause to shine or beam View this entry on the original dictionary page scan.
vibhrājmfn. (Nominal verb -) shining, splendid, luminous View this entry on the original dictionary page scan.
vibhrājm. (with saurya-) Name of the author of View this entry on the original dictionary page scan.
vibhrājam. Name of a king View this entry on the original dictionary page scan.
vibhrājitamfn. (fr. Causal) made splendid or bright, caused to shine View this entry on the original dictionary page scan.
vibhramP. -bhramati-, -bhrāmyati-, to wander or roam or fly about, roll, hover, whirl etc. ; to reel, quiver, shake ; to roam over, wander through (accusative). ; to fall into disorder or confusion, be disarranged or bewildered etc. ; to drive asunder, disperse, scare away ; to move about (the tail) : Causal -bhramayati-, or -bhrāmayati- (Passive voice -bhrāmyate-), to confuse, perplex View this entry on the original dictionary page scan.
vibhramam. (in fine compositi or 'at the end of a compound' f(ā-).) moving to and fro, rolling or whirling about, restlessness, unsteadiness View this entry on the original dictionary page scan.
vibhramam. violence, excess, intensity, high degree (also plural) etc. View this entry on the original dictionary page scan.
vibhramam. hurry, rapture, agitation, disturbance, perturbation, confusion, flurry etc. View this entry on the original dictionary page scan.
vibhramam. doubt, error, mistake, blunder (with daṇḍasya-,"erroneous application of punishment") etc. View this entry on the original dictionary page scan.
vibhramam. illusion, illusive appearance or mere semblance of anything etc. (see -bhāṣita-) View this entry on the original dictionary page scan.
vibhramam. beauty, grace View this entry on the original dictionary page scan.
vibhramam. feminine coquetry, amorous gestures or action of any kind (especially play of the eyes), perturbation, flurry (as when a woman in her confusion puts her ornaments in the wrong places) View this entry on the original dictionary page scan.
vibhramam. caprice, whim View this entry on the original dictionary page scan.
vibhramāf. old age View this entry on the original dictionary page scan.
vibhramabhāṣitan. pl. language in appearance View this entry on the original dictionary page scan.
vibhramārkam. Name of a man View this entry on the original dictionary page scan.
vibhramasūtran. Name of a treatise on grammar (attributed to hema-candra-) View this entry on the original dictionary page scan.
vibhramatantran. (equals -sūtra-) View this entry on the original dictionary page scan.
vibhramavatīf. a girl View this entry on the original dictionary page scan.
vibhramavatīf. Name of a female servant View this entry on the original dictionary page scan.
vibhraminmfn. moving hither and thither View this entry on the original dictionary page scan.
vibhraṃś(sometimes written bhraṃs-) A1. -bhraṃśate-, to fall off (figuratively), be unfortunate, fail or be unsuccessful in (locative case) ; to be separated from, desert (ablative) : Causal -bhraṃśayati-, to cause to fall ; to strike or break off ; to cause to disappear or vanish, destroy annihilate ; to divert from, deprive of (abl) View this entry on the original dictionary page scan.
vibhraṃśam. diarrhoea, laxity of the bowels (See manda-v-) View this entry on the original dictionary page scan.
vibhraṃśam. decline, cessation, end View this entry on the original dictionary page scan.
vibhraṃśam. disturbance, perturbation (See citta-v-) View this entry on the original dictionary page scan.
vibhraṃśam. fall, decay, ruin View this entry on the original dictionary page scan.
vibhraṃśam. (in fine compositi or 'at the end of a compound') being deprived of, loss View this entry on the original dictionary page scan.
vibhraṃśam. a precipice View this entry on the original dictionary page scan.
vibhraṃśayājñam. a particular ekāha- View this entry on the original dictionary page scan.
vibhraṃśinmfn. crumbling to pieces (See a-v-) View this entry on the original dictionary page scan.
vibhraṃśinmfn. falling down, dropping from (in fine compositi or 'at the end of a compound')
vibhraṃśitamfn. (fr. Causal) caused to fall etc. View this entry on the original dictionary page scan.
vibhraṃśitajñānamfn. deprived of reason or consciousness View this entry on the original dictionary page scan.
vibhraṃśitapuṣpapattramfn. having the flowers and leaves knocked off View this entry on the original dictionary page scan.
vibhrāntamfn. wandered or wandering about etc. (n. impersonal or used impersonally"it has been roamed" ) View this entry on the original dictionary page scan.
vibhrāntamfn. rolling or ogling (as the eyes;See below) View this entry on the original dictionary page scan.
vibhrāntamfn. spread abroad (as fame) View this entry on the original dictionary page scan.
vibhrāntamfn. confused, bewildered View this entry on the original dictionary page scan.
vibhrāntamanasmfn. bewildered or confused in mind View this entry on the original dictionary page scan.
vibhrāntanayanamfn. one who rolls the eyes or casts side glances View this entry on the original dictionary page scan.
vibhrāntaśīlamfn. confused in mind or disposition, intoxicated or insane View this entry on the original dictionary page scan.
vibhrāntaśīlam. a monkey View this entry on the original dictionary page scan.
vibhrāntaśīlam. the disc of the sun or moon View this entry on the original dictionary page scan.
vibhrāntif. whirling, going round View this entry on the original dictionary page scan.
vibhrāntif. hurry, agitation View this entry on the original dictionary page scan.
vibhrāntif. error, delusion View this entry on the original dictionary page scan.
vibhraṣṭamfn. fallen, sunk View this entry on the original dictionary page scan.
vibhraṣṭamfn. disappeared, vanished, gone, lost View this entry on the original dictionary page scan.
vibhraṣṭamfn. useless, vain View this entry on the original dictionary page scan.
vibhraṣṭamfn. (in fine compositi or 'at the end of a compound') strayed from View this entry on the original dictionary page scan.
vibhraṣṭamfn. deprived of. View this entry on the original dictionary page scan.
vibhraṣṭamfn. unsuccessful in View this entry on the original dictionary page scan.
vibhraṣṭaharṣamf(ā-)n. deprived of joy View this entry on the original dictionary page scan.
vibhraṣṭatimiramfn. freed from darkness (as the sky) View this entry on the original dictionary page scan.
vibhraṣṭeṣṭprayogam. Name of work View this entry on the original dictionary page scan.
vibhrāṣṭif. radiance, flame, blaze View this entry on the original dictionary page scan.
vibhrātṛvya(v/i--) n. rivalry, hostility View this entry on the original dictionary page scan.
vibhreṣam. ( bhreṣ-) commission of an offence, transgression (used to explain pramoga-) View this entry on the original dictionary page scan.
vibhṛtamfn. spread out, distributed View this entry on the original dictionary page scan.
vibhṛtamfn. upheld, supported, maintained View this entry on the original dictionary page scan.
vibhṛtra(v/i--) mf(ā-)n. to be (or being) borne about or in various directions View this entry on the original dictionary page scan.
vibhṛtvanmfn. bearing hither and thither View this entry on the original dictionary page scan.
vibhrum. (perhaps wrong reading for vi-bhu-) a prince, king (Bombay edition -babhru-). View this entry on the original dictionary page scan.
vibhūP. -bhavati-, to arise, be developed or manifested, expand, appear ; to suffice, be adequate or equal to or a match for (dative case or accusative) ; to pervade, fill ; to be able to or capable of (infinitive mood) ; to exist (in a-vibhavat-,"not existing") : Causal -bhāvayati-, to cause to arise or appear, develop, manifest, reveal, show forth, display etc. ; to pretend, feign on ; to divide, separate ; to perceive distinctly, find out, discover, ascertain, know, acknowledge, recognise as (accusative) etc. ; to regard or consider as, take for (two accusative) ; to suppose, fancy, imagine ; to think, reflect ; to suppose anything of or about (locative case) ; to make clear, establish, prove, decide ; to convict, convince : Passive voice of Causal -bhāvyate-, to be considered or regarded as, appear, seem (Nominal verb) : Desiderative See -bubhūṣā-: Intensive See -bobhuvat-. View this entry on the original dictionary page scan.
vibhumfn. or See vibhū- View this entry on the original dictionary page scan.
vibhūmf(-or v/ī-)n. (Ved.) being everywhere, far-extending, all-pervading, omnipresent, eternal etc. View this entry on the original dictionary page scan.
vibhūmf(-or v/ī-)n. abundant, plentiful View this entry on the original dictionary page scan.
vibhūmf(-or v/ī-)n. mighty, powerful, excellent, great, strong, effective, able to or capable of (infinitive mood) etc. View this entry on the original dictionary page scan.
vibhūmf(-or v/ī-)n. firm, solid, hard View this entry on the original dictionary page scan.
vibhūm. a lord, ruler, sovereign, king (also applied to brahmā-, viṣṇu-, and śiva-) etc. View this entry on the original dictionary page scan.
vibhūm. (in fine compositi or 'at the end of a compound') chief of or among View this entry on the original dictionary page scan.
vibhūm. a servant View this entry on the original dictionary page scan.
vibhūm. the sun View this entry on the original dictionary page scan.
vibhūm. the moon View this entry on the original dictionary page scan.
vibhūm. Name of kubera- ( also "ether;space;time;the soul") View this entry on the original dictionary page scan.
vibhūm. Name of a god (son of veda-śiras- and tuṣitā-) View this entry on the original dictionary page scan.
vibhūm. of a class of gods under manu- sāvarṇi- View this entry on the original dictionary page scan.
vibhūm. of indra- under manu- raivata- and under the 7th manu- View this entry on the original dictionary page scan.
vibhūm. of a son of viṣṇu- and dakṣiṇā- View this entry on the original dictionary page scan.
vibhūm. of a son of bhaga- and siddhi- View this entry on the original dictionary page scan.
vibhūm. of buddha- View this entry on the original dictionary page scan.
vibhūm. of a brother of śakuni- View this entry on the original dictionary page scan.
vibhūm. of a son of śambara- View this entry on the original dictionary page scan.
vibhūm. of a son of satya-ketu- and father of su-vibhu- View this entry on the original dictionary page scan.
vibhūm. of a son of dharma-ketu- and father of su-kumāra- View this entry on the original dictionary page scan.
vibhūm. of a son of varṣa-ketu- or satya-ketu- and father of ānarta- View this entry on the original dictionary page scan.
vibhūm. of a son of prastāva- and niyutsā- View this entry on the original dictionary page scan.
vibhūm. of a son of bhṛgu- View this entry on the original dictionary page scan.
vibhūm. plural Name of the ṛbhu-s View this entry on the original dictionary page scan.
vibhūin compound for vi-bhu- View this entry on the original dictionary page scan.
vibhūdāvanmfn. bestowing richly, liberal View this entry on the original dictionary page scan.
vibhugnamfn. (1. bhuj-) bent, bowed, crooked View this entry on the original dictionary page scan.
vibhujamfn. in mūla-v- (q.v) View this entry on the original dictionary page scan.
vibhūkratumfn. strong. heroic View this entry on the original dictionary page scan.
vibhukta(3. bhuj-), in bhukta-v- gaRa śāka-pārthivādi- ( on ) . View this entry on the original dictionary page scan.
vibhūmamfn. distant from the ground View this entry on the original dictionary page scan.
vibhūmanm. extension, greatness, might View this entry on the original dictionary page scan.
vibhūmanm. Name of kṛṣṇa- (prob.="appearing in manifold form"or"omnipotent") . View this entry on the original dictionary page scan.
vibhūmatmfn. extending everywhere View this entry on the original dictionary page scan.
vibhūmatmfn. joined with the vibhu-s or ṛbhu-s View this entry on the original dictionary page scan.
vibhumatmfn. joined with the vibhu-s or ṛbhu-s View this entry on the original dictionary page scan.
vibhupramitan. the hall of brahmā- View this entry on the original dictionary page scan.
vibhūrasim. (literally"thou art mighty") a form of agni- or the god of fire View this entry on the original dictionary page scan.
vibhūṣP. -bhūṣati-, to be brilliant, appear (?) ( vyāpto bhavati-) ; to adorn, decorate : Causal -bhūṣayati-, to adorn, decorate View this entry on the original dictionary page scan.
vibhūṣāf. ornament, decoration View this entry on the original dictionary page scan.
vibhūṣāf. light, splendour, beauty View this entry on the original dictionary page scan.
vibhūṣaṇamfn. adorning View this entry on the original dictionary page scan.
vibhūṣaṇam. Name of mañju-śrī- View this entry on the original dictionary page scan.
vibhūṣaṇan. (in fine compositi or 'at the end of a compound' f(ā-).) decoration, ornament etc. View this entry on the original dictionary page scan.
vibhūṣaṇan. splendour, beauty View this entry on the original dictionary page scan.
vibhūṣaṇakalāf. a particular samādhi- View this entry on the original dictionary page scan.
vibhūṣaṇavatmfn. adorned, decorated View this entry on the original dictionary page scan.
vibhūṣaṇodbhāsinmfn. glittering with ornaments View this entry on the original dictionary page scan.
vibhūṣitamfn. adorned, decorated etc. View this entry on the original dictionary page scan.
vibhūṣitan. an ornament, decoration View this entry on the original dictionary page scan.
vibhūṣitālaṃkārāf. Name of a gandharvī- and of a kiṃ-narī- View this entry on the original dictionary page scan.
vibhūṣitāṅgamfn. decorated about the body View this entry on the original dictionary page scan.
vibhūtāf. power, supremacy View this entry on the original dictionary page scan.
vibhūtamfn. arisen, produced etc. View this entry on the original dictionary page scan.
vibhūtamfn. great, mighty (See compound) View this entry on the original dictionary page scan.
vibhūtam. equals next View this entry on the original dictionary page scan.
vibhūtadyumnamfn. (v/i-) abounding in splendour or glory View this entry on the original dictionary page scan.
vibhūtamanasmfn. (used to explain vi-manas-) View this entry on the original dictionary page scan.
vibhūtaṃgamāf. a particular high number View this entry on the original dictionary page scan.
vibhūtarātimfn. (vi-) bestowing rich gifts. View this entry on the original dictionary page scan.
vibhūtimfn. penetrating, pervading View this entry on the original dictionary page scan.
vibhūtimfn. abundant, plentiful View this entry on the original dictionary page scan.
vibhūtimfn. mighty, powerful View this entry on the original dictionary page scan.
vibhūtimfn. presiding over (genitive case) View this entry on the original dictionary page scan.
vibhūtim. Name of a sādhya- View this entry on the original dictionary page scan.
vibhūtim. of a son of viśvāmitra- View this entry on the original dictionary page scan.
vibhūtim. of a king View this entry on the original dictionary page scan.
vibhūtif. development, multiplication, expansion, plenty, abundance etc. View this entry on the original dictionary page scan.
vibhūtif. manifestation of might, great power, superhuman power (consisting of eight faculties, especially attributed to śiva-, but supposed also to be attainable by human beings through worship of that deity, viz. aṇiman-,the power of becoming as minute as an atom; laghiman-,extreme lightness; prāpti-,attaining or reaching anything[ exempli gratia, 'for example' the moon with the tip of the finger]; prākāmya-,irresistible will; mahiman-,illimitable bulk; īśitā-,supreme dominion; vaśitā-,subjugating by magic;and kāmāvasāyitā-,the suppressing all desires)
vibhūtif. a particular śakti- View this entry on the original dictionary page scan.
vibhūtif. the might of a king or great lord, sovereign power, greatness etc. View this entry on the original dictionary page scan.
vibhūtif. successful issue (of a sacrifice) View this entry on the original dictionary page scan.
vibhūtif. splendour, glory, magnificence View this entry on the original dictionary page scan.
vibhūtif. fortune, welfare, prosperity etc. View this entry on the original dictionary page scan.
vibhūtif. (also plural) riches, wealth, opulence View this entry on the original dictionary page scan.
vibhūtif. Name of lakṣmi- (the goddess of fortune and welfare) View this entry on the original dictionary page scan.
vibhūtif. the ashes of cow-dung etc. (with which śiva- is said to smear his body, and hence used in imitation of him by devotees) View this entry on the original dictionary page scan.
vibhūtif. (in music) a particular śruti- View this entry on the original dictionary page scan.
vibhūtibalam. Name of a poet View this entry on the original dictionary page scan.
vibhūticandram. Name of an author View this entry on the original dictionary page scan.
vibhūtidhāraṇavidhim. Name of work View this entry on the original dictionary page scan.
vibhūtidvādaśīf. a vrata- or religious observance on a particular twelfth day (in honour of viṣṇu-) View this entry on the original dictionary page scan.
vibhūtigrahaṇan. taking up ashes (at the vaiśvadeva- ceremony) View this entry on the original dictionary page scan.
vibhūtimādhavam. Name of a poet View this entry on the original dictionary page scan.
vibhūtimāhātmyan. Name of a chapter of the View this entry on the original dictionary page scan.
vibhūtimatmfn. mighty, powerful, superhuman View this entry on the original dictionary page scan.
vibhūtimatmfn. smeared with ashes View this entry on the original dictionary page scan.
vibhūtiyogam. Name of the 6th canto of the śiva-gītā-. View this entry on the original dictionary page scan.
vibhutvan. being everywhere, omnipresence View this entry on the original dictionary page scan.
vibhutvan. omnipotence, sovereignty View this entry on the original dictionary page scan.
vibhūtvasamarthanan. Name of work View this entry on the original dictionary page scan.
vibhuvarīf. (prob. f.of vi-bhvan-) far-reaching View this entry on the original dictionary page scan.
vibhūvarmanm. Name of a man View this entry on the original dictionary page scan.
vibhūvasmfn. (prob.) powerful View this entry on the original dictionary page scan.
vibhūvasm. Name of a man View this entry on the original dictionary page scan.
vibhūvasumfn. (vibh/ū-.) possessing mighty treasures or wealth View this entry on the original dictionary page scan.
vibhvain compound for vi-bhvan- below. View this entry on the original dictionary page scan.
vibhvanmfn. far-reaching, penetrating, pervading. View this entry on the original dictionary page scan.
vibhvanm. Name of one of the ṛbhu-s View this entry on the original dictionary page scan.
vibhvanmfn. skilful View this entry on the original dictionary page scan.
vibhvanm. an artificer View this entry on the original dictionary page scan.
vibhvāsahmfn. (vibhvā-for vi-bhvan-) conquering or overcoming the rich View this entry on the original dictionary page scan.
vibhvataṣṭamfn. cut out or furnished by a skilful artificer, very perfect or handsome View this entry on the original dictionary page scan.
vibibhitsumfn. (fr. Desiderative) wishing to break asunder, purposing to cleave or pierce View this entry on the original dictionary page scan.
vibilamfn. having no hole or aperture (as a sheath) View this entry on the original dictionary page scan.
vibobhuvatmfn. (fr. Intensive) spreading or expanding exceedingly over (locative case) View this entry on the original dictionary page scan.
vibodham. (for 2.See ) inattention, absence of mind View this entry on the original dictionary page scan.
vibodham. (for 1.See) awaking etc. View this entry on the original dictionary page scan.
vibodham. perception, intelligence View this entry on the original dictionary page scan.
vibodham. (in dramatic language) the unfolding of the faculties in carrying out an object etc. View this entry on the original dictionary page scan.
vibodham. Name of a bird (a son of droṇa-) View this entry on the original dictionary page scan.
vibodhanam. an arouser, promoter of (genitive case) View this entry on the original dictionary page scan.
vibodhanan. awaking, awakening (trans. and intrans.) View this entry on the original dictionary page scan.
vibodhayitavyamfn. (fr. Causal) to be awakened View this entry on the original dictionary page scan.
vibodhitamfn. (fr. idem or 'mfn. (fr. Causal) to be awakened ') awakened View this entry on the original dictionary page scan.
vibodhitamfn. instructed View this entry on the original dictionary page scan.
vibṛh(or vṛh-) P. -bṛhati-, to tear in pieces, break or pluck off, tear away View this entry on the original dictionary page scan.
vibṛh(or bṛṃh-) P. -bṛhati- (only 1. dual number Potential -bṛheva-), to embrace closely or passionately View this entry on the original dictionary page scan.
vibrūP. A1. -bravīti-, -brūte-, to speak out, express one's self, state, depose, declare etc. ; to explain, propound, teach etc. ; to interpret, decide (a law) ; to answer (a question) ; to make a false statement ; to be at variance, disagree ; to dispute, contend about View this entry on the original dictionary page scan.
vibubhūṣāSee under vi-bhū-. View this entry on the original dictionary page scan.
vibubhūṣāf. (fr. Desiderative) the wish or intention to manifest one's self. View this entry on the original dictionary page scan.
vibububhūṣumfn. wishing to develop or expand one's self. View this entry on the original dictionary page scan.
vibuddhamfn. (for 2.See vi-budh-) without consciousness View this entry on the original dictionary page scan.
vibuddhamfn. (for 1.See) awakened, wide awake etc. View this entry on the original dictionary page scan.
vibuddhamfn. expanded, blown View this entry on the original dictionary page scan.
vibuddhamfn. clever, experienced, skilful in (locative case) View this entry on the original dictionary page scan.
vibuddhacūtam. a mango-tree in blossom View this entry on the original dictionary page scan.
vibuddhakamalamfn. having expanded lotuses View this entry on the original dictionary page scan.
vibuddhimfn. unreasonable View this entry on the original dictionary page scan.
vibudhA1. -budhyate-, to awake, be awake or a wakened etc. ; to become conscious or aware of, perceive, learn : Causal -bodhayati-, to awaken etc. ; to restore to consciousness View this entry on the original dictionary page scan.
vibudhamfn. (for 2.See vi-budh-) destitute of learned men View this entry on the original dictionary page scan.
vibudhamfn. (for 1.See) very wise or learned etc. View this entry on the original dictionary page scan.
vibudham. a wise or learned man, teacher, Pandit View this entry on the original dictionary page scan.
vibudham. a god etc. View this entry on the original dictionary page scan.
vibudham. the moon View this entry on the original dictionary page scan.
vibudham. Name of a prince (son of deva-mīḍha-) View this entry on the original dictionary page scan.
vibudham. of kṛta- View this entry on the original dictionary page scan.
vibudham. of the author of the janma-pradīpa- View this entry on the original dictionary page scan.
vibudhācāryam. "teacher of the gods", Name of bṛhas-pati- View this entry on the original dictionary page scan.
vibudhādhipam. () sovereign of the gods View this entry on the original dictionary page scan.
vibudhādhipatim. () sovereign of the gods ( vibudhādhipatya tya- n.sovereignty of the gods ) View this entry on the original dictionary page scan.
vibudhādhipatyan. vibudhādhipati
vibudhagurum. "teacher of the gods", bṛhas-pati- or the planet Jupiter View this entry on the original dictionary page scan.
vibudhamatimfn. of wise understanding View this entry on the original dictionary page scan.
vibudhānam. a wise man, teacher, preceptor View this entry on the original dictionary page scan.
vibudhanadīf. equals -taṭinī- View this entry on the original dictionary page scan.
vibudhānucaram. a god's attendant View this entry on the original dictionary page scan.
vibudhapatim. "king of the gods", Name of indra- View this entry on the original dictionary page scan.
vibudhapriyāf. "favourite of the gods", Name of a metre View this entry on the original dictionary page scan.
vibudharājam. equals -pati- View this entry on the original dictionary page scan.
vibudharañjanīf. Name of work View this entry on the original dictionary page scan.
vibudharipum. an enemy of the gods View this entry on the original dictionary page scan.
vibudharṣabham. (for -ṛṣ-) chief of the gods View this entry on the original dictionary page scan.
vibudhasadmann. "abode of the gods", heaven or the sky View this entry on the original dictionary page scan.
vibudhasakham. a friend of the gods View this entry on the original dictionary page scan.
vibudhaśatru() m. "foe of the gods", a demon View this entry on the original dictionary page scan.
vibudhastrīf. "divine female", an apsaras- View this entry on the original dictionary page scan.
vibudhataṭinīf. "river of the gods", the gaṅgā- View this entry on the original dictionary page scan.
vibudhatvan. wisdom, learning View this entry on the original dictionary page scan.
vibudhāvāsam. "god's abode", a temple View this entry on the original dictionary page scan.
vibudhavidvi () m. "foe of the gods", a demon View this entry on the original dictionary page scan.
vibudhavijayam. a victory won by the gods View this entry on the original dictionary page scan.
vibudhendram. "best of the wise", (with ācārya-or āśrama-) Name of a teacher View this entry on the original dictionary page scan.
vibudheśvaram. lord of the gods View this entry on the original dictionary page scan.
vibudhetaram. "other than a god", an asura- View this entry on the original dictionary page scan.
vibudhopadeśam. Name of a vocabulary. View this entry on the original dictionary page scan.
vibukam. the son of a vaiśya- and a malli- View this entry on the original dictionary page scan.
vic (confer, compare vij-) cl.7 P. A1. () vin/akti-, viṅkte- (2. sg. vivekṣi- ; perfect tense viveca- , parasmE-pada vivikv/as- Aorist avaikṣīt- grammar; future vektā-, vekṣyati- ; infinitive mood vektum- ; indeclinable -vicya-. -vecam- ), to sift, separate (especially grain from chaff by winnowing) ; to separate from, deprive of (instrumental case) ; to discriminate, discern, judge : Passive voice vicy/ate- (Aorist aveci-) etc.: Causal -vecayati- (Aorist avīvicat-) See vi-vic-: Desiderative vivikṣati- grammar : Intensive (or cl.3. See ) vevekti- [ confer, compare Greek ; Latin vicesetc.]
vicācācalatSee /a-vicācala- etc. View this entry on the original dictionary page scan.
vicācācaliSee /a-vicācala- etc. View this entry on the original dictionary page scan.
vicācalaSee /a-vicācala- etc. View this entry on the original dictionary page scan.
vicākaśatmfn. (fr. Intensive) shining, radiant View this entry on the original dictionary page scan.
vicākaśatmfn. looking on, seeing, beholding, perceiving View this entry on the original dictionary page scan.
vicākaśatSee vi-kāś-. View this entry on the original dictionary page scan.
vicakhnuor vicakhyu- m. Name of a king View this entry on the original dictionary page scan.
vicakilam. a kind of jasmine (Jasminum Zambac) ( also "a species of Artemisia"and"Vanguiera Spinosa") . View this entry on the original dictionary page scan.
vicakilamayamf(ī-)n. made or consisting of vicakila- flowers View this entry on the original dictionary page scan.
vicakramfn. wheel-less View this entry on the original dictionary page scan.
vicakramfn. having no discus View this entry on the original dictionary page scan.
vicakram. Name of a dānava- View this entry on the original dictionary page scan.
vicakramāṇamfn. (fr. Intensive) striding, traversing View this entry on the original dictionary page scan.
vicakropaskaropasthamfn. (a chariot) without wheels and implements and seat View this entry on the original dictionary page scan.
vicakṣA1. -caṣṭe- (Ved. infinitive mood -c/akṣe-), to appear, shine ; to see distinctly, view, look at, perceive, regard ; to make manifest, show ; to proclaim, announce, tell : Causal -cakṣayati-, to cause to see distinctly, make clear ; to proclaim, tell View this entry on the original dictionary page scan.
vicakṣaṇamfn. conspicuous, visible, bright, radiant, splendid View this entry on the original dictionary page scan.
vicakṣaṇamfn. distinct, perceptible View this entry on the original dictionary page scan.
vicakṣaṇamfn. clear-sighted (literally and figuratively), sagacious, clever, wise, experienced or versed in, familiar with (locative case or compound) etc. View this entry on the original dictionary page scan.
vicakṣaṇam. Name of a preceptor (with the patronymic tāṇḍya-) View this entry on the original dictionary page scan.
vicakṣaṇāf. Tiaridium Indicum View this entry on the original dictionary page scan.
vicakṣaṇam. Name of brahmā-'s throne View this entry on the original dictionary page scan.
vicakṣaṇam. Name of a female servant View this entry on the original dictionary page scan.
vicakṣaṇacanasitavatmfn. accompanied by the word vicakṣaṇa-, or canasita- View this entry on the original dictionary page scan.
vicakṣaṇamind. gaRa gotrādi- View this entry on the original dictionary page scan.
vicakṣaṇammanyamfn. considering one's self clever or wise View this entry on the original dictionary page scan.
vicakṣaṇatvan. sagaciousness, cleverness, discernment, judgement, wisdom View this entry on the original dictionary page scan.
vicakṣaṇavatmfn. connected with the word vicakṣaṇa- (see ṇānta- , ṇottara- ) View this entry on the original dictionary page scan.
vicakṣasm. a teacher View this entry on the original dictionary page scan.
vicakṣasn. seeing clear, clear-sightedness (varia lectio cakṣus-). View this entry on the original dictionary page scan.
vicakṣusmfn. eyeless, blind View this entry on the original dictionary page scan.
vicakṣusmfn. = vi-manas-2 View this entry on the original dictionary page scan.
vicakṣusm. Name of a prince View this entry on the original dictionary page scan.
vicakṣusn. (in a formula, with cakṣus-) View this entry on the original dictionary page scan.
vicakṣus vi-catura-, vi-candra- etc. See . View this entry on the original dictionary page scan.
vicakṣuṣkaraṇan. rendering hostile, alienation View this entry on the original dictionary page scan.
vicakṣyamfn. conspicuous, visible View this entry on the original dictionary page scan.
vicalP. -calati-, to move about, shake, waver ; to move away, depart or swerve or deviate or desist from (ablative) etc. ; to fall off or down ; to go astray, fail, be agitated or disturbed or destroyed : Causal -cālayati-, to cause to move, loosen, shake ; to agitate, excite, stir up, trouble ; to cause to turn off or swerve from (ablative) ; to destroy, rescind View this entry on the original dictionary page scan.
vicalamfn. moving about, shaking, unsteady (See a-v-) View this entry on the original dictionary page scan.
vicalamfn. conceited View this entry on the original dictionary page scan.
vicālam. putting apart, distributing, separating View this entry on the original dictionary page scan.
vicālam. interval View this entry on the original dictionary page scan.
vicālamfn. intervening, intermediate View this entry on the original dictionary page scan.
vicalanan. wandering from place to place, roaming about, unsteadiness View this entry on the original dictionary page scan.
vicalanan. boastfulness View this entry on the original dictionary page scan.
vicalanan. moving from, deviation View this entry on the original dictionary page scan.
vicālanamf(ī-)n. removing, destroying View this entry on the original dictionary page scan.
vicālinSee a-vicālita- etc. View this entry on the original dictionary page scan.
vicalitamfn. gone away, departed, deviated from (ablative) View this entry on the original dictionary page scan.
vicalitamfn. troubled, obscured, blinded View this entry on the original dictionary page scan.
vicālitaSee a-vicālita- etc. View this entry on the original dictionary page scan.
vicālyaSee a-vicālita- etc. View this entry on the original dictionary page scan.
vicandramf(ā-)n. moonless (as a night) View this entry on the original dictionary page scan.
vicarP. -carati-, to move in different directions, spread, expand, be diffused ; to rove, ramble about or through, traverse, pervade etc. ; to sally forth, march against, make an attack or assault etc. ; to wander from the right path, go astray, be dissolute ; to commit a mistake or blunder (with words) ; to run out, come to an end ; to stand or be situated in (locative case;applied to heavenly bodies) ; to associate or have intercourse with (instrumental case) ; to act, proceed, behave, live ; to practise, perform, accomplish, make, do etc. ; to graze upon, feed upon (a pasture) : Causal -cārayati-, to cause to go or roam about ; to cause to go astray, seduce ; to move hither and thither (in the mind), ponder, reflect, consider etc. ; to doubt, hesitate ; to examine, investigate, ascertain View this entry on the original dictionary page scan.
vicaramfn. wandered or swerved from (ablative) View this entry on the original dictionary page scan.
vicāram. (in fine compositi or 'at the end of a compound' f(ā-).) mode of acting or proceeding, procedure (also = a single or particular case) View this entry on the original dictionary page scan.
vicāram. change of place View this entry on the original dictionary page scan.
vicāram. pondering, deliberation, consideration, reflection, examination, investigation etc. View this entry on the original dictionary page scan.
vicāram. doubt, hesitation View this entry on the original dictionary page scan.
vicāram. a probable conjecture View this entry on the original dictionary page scan.
vicāram. dispute, discussion View this entry on the original dictionary page scan.
vicāram. prudence View this entry on the original dictionary page scan.
vicārabhūf. a tribunal View this entry on the original dictionary page scan.
vicārabhūf. the judgement-seat of yama- (judge of the dead) View this entry on the original dictionary page scan.
vicāracintāmaṇim. Name of work View this entry on the original dictionary page scan.
vicāradṛśmfn. "employing no spies for eyes" (See cāra-), and"looking at a matter with consideration" View this entry on the original dictionary page scan.
vicārajñamfn. knowing how to discriminate or judge, able to decide on the merits of a case, a judge View this entry on the original dictionary page scan.
vicārakam. a leader, guide View this entry on the original dictionary page scan.
vicārakam. a spy View this entry on the original dictionary page scan.
vicārakam. (in fine compositi or 'at the end of a compound') one who deliberates or considers View this entry on the original dictionary page scan.
vicārakartṛm. one who makes investigation, a judge, investigator View this entry on the original dictionary page scan.
vicārakatāf. investigation, deliberation, discussion View this entry on the original dictionary page scan.
vicārakatvan. investigation, deliberation, discussion View this entry on the original dictionary page scan.
vicāramālāf. Name of work View this entry on the original dictionary page scan.
vicāramañjarīf. Name of work View this entry on the original dictionary page scan.
vicāramūḍhamfn. foolish or mistaken in judgement View this entry on the original dictionary page scan.
vicaraṇamfn. (for 2.See vi-car-) footless View this entry on the original dictionary page scan.
vicaraṇan. (for 1.See) wandering, motion View this entry on the original dictionary page scan.
vicāraṇan. (alsof(ā-).) consideration, reflexion, discussion, doubt, hesitation etc. View this entry on the original dictionary page scan.
vicāraṇan. changing a place (only n.) View this entry on the original dictionary page scan.
vicāraṇāf. distinction, kind View this entry on the original dictionary page scan.
vicāraṇāf. Name of the mīmāṃsā- system of philosophy View this entry on the original dictionary page scan.
vicāranirṇayam. Name of work View this entry on the original dictionary page scan.
vicaraṇīyamfn. it is to be acted or proceeded View this entry on the original dictionary page scan.
vicāraṇīyamfn. to be deliberated about, needing careful consideration View this entry on the original dictionary page scan.
vicāraparam. Name of a king, View this entry on the original dictionary page scan.
vicārārkasaṃgraham. Name of work View this entry on the original dictionary page scan.
vicārārthasamāgamam. assembly for the sake of trial or judgement, an assembly for investigation or discussion View this entry on the original dictionary page scan.
vicāraśāstran. Name of work View this entry on the original dictionary page scan.
vicāraśīlamfn. disposed to deliberation or reflection, considerate, deliberative View this entry on the original dictionary page scan.
vicārasthalan. a place for discussion or investigation, tribunal View this entry on the original dictionary page scan.
vicārasthalan. a logical disputation View this entry on the original dictionary page scan.
vicārasudhākaram. Name of work
vicārasudhārṇavam. Name of work
vicāravatmfn. proceeding with consideration, considerate, prudent View this entry on the original dictionary page scan.
vicāravidm. (prob.)"knowing how to discriminate" , Name of śiva- View this entry on the original dictionary page scan.
vicarcīf. equals carcikā- View this entry on the original dictionary page scan.
vicarcikāf. ( carc-) "coating, cover", a form of cutaneous eruption, itch, scab View this entry on the original dictionary page scan.
vicarcitamfn. rubbed, smeared, anointed, applied (as an unguent) View this entry on the original dictionary page scan.
vicārikāf. a female servant who looks after the garden and the various divisions of the house View this entry on the original dictionary page scan.
vicārinmfn. having wide paths (as the earth) View this entry on the original dictionary page scan.
vicārinmfn. moving about, wandering, traversing etc. View this entry on the original dictionary page scan.
vicārinmfn. proceeding, acting View this entry on the original dictionary page scan.
vicārinmfn. changing, mutable View this entry on the original dictionary page scan.
vicārinmfn. wanton, dissolute, lascivious (varia lectio) View this entry on the original dictionary page scan.
vicārinmfn. (in fine compositi or 'at the end of a compound') deliberating, judging, discussing View this entry on the original dictionary page scan.
vicārinm. Name of a son of kavandha- View this entry on the original dictionary page scan.
vicaritamfn. moved in different directions etc. View this entry on the original dictionary page scan.
vicaritan. wandering, roaming about View this entry on the original dictionary page scan.
vicāritamfn. deliberated, considered, discussed, judged etc. View this entry on the original dictionary page scan.
vicāritamfn. anything which is under discussion, dubious, doubtful, uncertain View this entry on the original dictionary page scan.
vicāritamfn. anything which has been discussed or decided, ascertained, settled View this entry on the original dictionary page scan.
vicāritan. (also plural) deliberation, doubt, hesitation View this entry on the original dictionary page scan.
vicarmanmfn. shieldless View this entry on the original dictionary page scan.
vicarman vi-carṣaṇi- See . View this entry on the original dictionary page scan.
vicāroktif. discriminating speech View this entry on the original dictionary page scan.
vicarṣaṇa(prob. wrong reading) (v/i--) mfn. very active or busy View this entry on the original dictionary page scan.
vicarṣaṇi(v/i--) mfn. very active or busy View this entry on the original dictionary page scan.
vicārum. Name of a son of kṛṣṇa- View this entry on the original dictionary page scan.
vicāryamfn. to be deliberated or discussed (n. impersonal or used impersonally), dubious, doubtful, questionable View this entry on the original dictionary page scan.
vicaṭP. -caṭati-, to break (intr.) View this entry on the original dictionary page scan.
vicaṭanan. breaking, View this entry on the original dictionary page scan.
vicaturamfn. containing various quarters (or half-verses) (see ) . View this entry on the original dictionary page scan.
vicayaSee vi-- 1. 2. ci-, column 3. View this entry on the original dictionary page scan.
vicayam. gathering or putting together, arrangement, enumeration View this entry on the original dictionary page scan.
vicayam. search, investigation, examination View this entry on the original dictionary page scan.
vicayanan. idem or 'm. search, investigation, examination ' View this entry on the original dictionary page scan.
vicayiṣṭha(v/i--) mfn. removing most effectually, effacing View this entry on the original dictionary page scan.
vicchad(1 chad-), Causal -cchādayati-, to uncover, unclothe (only ,as varia lectio for -cchāyayati-). View this entry on the original dictionary page scan.
vicchad(3 chad-), Causal -chandayati-, to render or return homage (?) View this entry on the original dictionary page scan.
vicchandamfn. (v/i--) consisting of various metres View this entry on the original dictionary page scan.
vicchandam. equals next View this entry on the original dictionary page scan.
vicchanda v/i-cchandas-, vi-cchardaka- See . View this entry on the original dictionary page scan.
vicchandakam. a building consisting of several stories and surrounded by a portico, a palace or temple View this entry on the original dictionary page scan.
vicchandasmfn. (v/i--) equals v/i-cchanda- View this entry on the original dictionary page scan.
vicchandasf. (scilicet ṛc-) a verse containing various metres View this entry on the original dictionary page scan.
vicchandasn. a kind of metre View this entry on the original dictionary page scan.
vicchardakam. equals vi-cchandaka- View this entry on the original dictionary page scan.
vicchardanan. ( chṛd-) the act of vomiting View this entry on the original dictionary page scan.
vicchardanan. disregarding View this entry on the original dictionary page scan.
vicchardanan. wasting (?) View this entry on the original dictionary page scan.
vicchardikāf. (See vi-chṛd-). View this entry on the original dictionary page scan.
vicchardikāf. the act of vomiting View this entry on the original dictionary page scan.
viccharditamfn. vomited, ejected View this entry on the original dictionary page scan.
viccharditamfn. disregarded, neglected View this entry on the original dictionary page scan.
viccharditamfn. diminished, impaired View this entry on the original dictionary page scan.
vicchāy vicchāyati- See vich-. View this entry on the original dictionary page scan.
vicchāyan. (for 2.See) the shadow of a flock of birds (alsof(ā-). ) View this entry on the original dictionary page scan.
vicchāyamf(ā-)n. (for 1.See 1. vi-,p.949) destitute of shadow, shadowless View this entry on the original dictionary page scan.
vicchāyamf(ā-)n. lacking colour or lustre or distinction, pale ( vicchāyatā -- f.) View this entry on the original dictionary page scan.
vicchāyam. a jewel, gem View this entry on the original dictionary page scan.
vicchāya1. 2. See pp. 949, 950. View this entry on the original dictionary page scan.
vicchāyatāf. vicchāya
vicchāyayaNom. P. yayati-, to free from shadow, deprive of colour or lustre (-cchāyita-,colourless, pale) ; -cchāyī-kṛ- P. -karoti- idem or 'm. a jewel, gem ' View this entry on the original dictionary page scan.
vicchedam. cutting asunder, cleaving, piercing, breaking, division, separation View this entry on the original dictionary page scan.
vicchedam. interruption, discontinuance, cessation, end etc. View this entry on the original dictionary page scan.
vicchedam. removal, destruction View this entry on the original dictionary page scan.
vicchedam. (in fine compositi or 'at the end of a compound') injury to View this entry on the original dictionary page scan.
vicchedam. distinction, difference (in fine compositi or 'at the end of a compound' also"variety" id est different kinds of) View this entry on the original dictionary page scan.
vicchedam. division of a book, section, chapter View this entry on the original dictionary page scan.
vicchedam. space, interval View this entry on the original dictionary page scan.
vicchedam. caesura, pause in a verse View this entry on the original dictionary page scan.
vicchedakamf(ikā-)n. cutting off or asunder, dividing, separating, a cutter, divider View this entry on the original dictionary page scan.
vicchedanamfn. separating, interrupting View this entry on the original dictionary page scan.
vicchedanāf. breaking off (plural) View this entry on the original dictionary page scan.
vicchedanan. cutting off, removal, annulment, destruction View this entry on the original dictionary page scan.
vicchedanan. distinguishing View this entry on the original dictionary page scan.
vicchedanīyamfn. to be separated, divisible View this entry on the original dictionary page scan.
vicchedinmfn. breaking, destroying View this entry on the original dictionary page scan.
vicchedinmfn. having breaks or intervals View this entry on the original dictionary page scan.
vicchid( chid-) P. -chinatti-, -chintte- to cut or tear or cleave or break asunder, cut off, divide, separate etc. ; to interrupt (See vi-cchidya-) ; to disturb, destroy ; to be divided View this entry on the original dictionary page scan.
vicchidyaind. having cut off etc. View this entry on the original dictionary page scan.
vicchidyaind. separately, interruptedly View this entry on the original dictionary page scan.
vicchinnamfn. cut or torn or split or cleft or broken asunder etc. View this entry on the original dictionary page scan.
vicchinnamfn. interrupted, disconnected ( vicchinnatā -- f.disconnectedness) , incoherent View this entry on the original dictionary page scan.
vicchinnamfn. ended, ceased, no longer existing, View this entry on the original dictionary page scan.
vicchinnamfn. crooked View this entry on the original dictionary page scan.
vicchinnamfn. anointed View this entry on the original dictionary page scan.
vicchinnabalikarmanmfn. having sacrificial rites interrupted View this entry on the original dictionary page scan.
vicchinnadhūmaprasaramfn. having the free course of the smoke interrupted View this entry on the original dictionary page scan.
vicchinnamadyamfn. one who has long abstained from spirituous liquor
vicchinnaprasaramfn. (vicchinnaprasara-) having its progress interrupted (said of science) View this entry on the original dictionary page scan.
vicchinnaśarapātatvan. "distance of an arrow's flight" id est excessive nearness of combatants to each other View this entry on the original dictionary page scan.
vicchinnatāf. vicchinna
vicchittif. (v/i--) cutting asunder or off, breaking off, prevention, interruption, cessation etc. View this entry on the original dictionary page scan.
vicchittif. wanting, lack of (instrumental case) View this entry on the original dictionary page scan.
vicchittif. (in rhetoric) a pointed or cutting or sharp style View this entry on the original dictionary page scan.
vicchittif. irregularity or carelessness in dress and decoration View this entry on the original dictionary page scan.
vicchittif. colouring or marking the body with unguents, painting View this entry on the original dictionary page scan.
vicchittif. caesura, pause in a verse View this entry on the original dictionary page scan.
viccho( cho-), Causal -cchāyayati- to cut about, wound (see vich-). View this entry on the original dictionary page scan.
vicchuraṇan. ( chur-) besprinkling, bestrewing, powdering View this entry on the original dictionary page scan.
vicchuritamfn. bestrewed or powdered or covered or inlaid with (instrumental case or compound) View this entry on the original dictionary page scan.
vicchuritam. a particular samādhi- View this entry on the original dictionary page scan.
viceṣṭP. A1. -ceṣṭati-, te-, to move the limbs about, writhe, wallow, struggle ; to bestir or exert one's self, be active or busy ; act or proceed against, deal with (locative case) etc.: Causal -ceṣṭayati-, to set in motion, rouse to action View this entry on the original dictionary page scan.
viceṣṭamfn. motionless View this entry on the original dictionary page scan.
viceṣṭāf. motion (See nir-viceṣṭa-) View this entry on the original dictionary page scan.
viceṣṭāf. acting, proceeding, conduct, behaviour (see dur-viceṣṭa-) View this entry on the original dictionary page scan.
viceṣṭāf. effort, exertion View this entry on the original dictionary page scan.
viceṣṭanan. moving the limbs View this entry on the original dictionary page scan.
viceṣṭanan. kicking or rolling (said of horses) View this entry on the original dictionary page scan.
viceṣṭitamfn. struggled, striven, exerted etc. View this entry on the original dictionary page scan.
viceṣṭitamfn. effected, produced View this entry on the original dictionary page scan.
viceṣṭitamfn. investigated, inquired into View this entry on the original dictionary page scan.
viceṣṭitamfn. unconsidered, ill-judged View this entry on the original dictionary page scan.
viceṣṭitan. motion (of the body), gesture View this entry on the original dictionary page scan.
viceṣṭitan. action, exertion, conduct, behaviour etc. View this entry on the original dictionary page scan.
viceṣṭitan. evil or malicious act, machination View this entry on the original dictionary page scan.
viceṣṭitṛmfn. moving the limbs, etc. View this entry on the original dictionary page scan.
vicetanamf(ā-)n. (for 2.See under vi-cit-) senseless, unconscious, absent-minded etc. View this entry on the original dictionary page scan.
vicetanamf(ā-)n. inanimate, dead View this entry on the original dictionary page scan.
vicetanamf(ā-)n. foolish, stupid View this entry on the original dictionary page scan.
vicetanaSee a-vicetan/a-. 2. View this entry on the original dictionary page scan.
vicetana vi-cetas- etc. See under vi-- 4. cit-, column 1. View this entry on the original dictionary page scan.
vicetanīf. rendering unconscious View this entry on the original dictionary page scan.
vicetasmfn. (v/i--) (for 2.See vi-cit-) absent-minded, confounded, perplexed View this entry on the original dictionary page scan.
vicetasmfn. ignorant, stupid View this entry on the original dictionary page scan.
vicetasmfn. (v/i--) visible, clearly seen View this entry on the original dictionary page scan.
vicetasmfn. discerning, wise View this entry on the original dictionary page scan.
vicetavyamfn. to be searched or examined or investigated or found out View this entry on the original dictionary page scan.
vicetīind., with kṛ-, bhū-, and as- View this entry on the original dictionary page scan.
vicetṛmfn. one who sifts, sifter (with genitive case) View this entry on the original dictionary page scan.
viceyamfn. to be searched or searched through ( viceyatāraka -tāraka- mfn.having the stars distinguishable or separated by long intervals ) View this entry on the original dictionary page scan.
viceyan. investigation View this entry on the original dictionary page scan.
viceyatārakamfn. viceya
vich cl.10 P. () vicchayati-, to speak or to shine ; vicchāy/ati- (; see ), to go (with ny-ā-,to press or rub one's self against): Causal vicchāy/ayati-, to press, bring into straits (perhaps ) . View this entry on the original dictionary page scan.
vicior vicī- f. equals vīci-, a wave View this entry on the original dictionary page scan.
vici(not always separable from vi--2. ci-) P. A1. -cinoti-, -cinute- (imperative -citana-, -ciyantu- ), to segregate, select, pick out, cull ; to divide, part (hair) ; to take away, remove, disperse ; to clear, prepare (a road) ; to distribute ; to gather, collect ; to pile or heap up in a wrong way, disarrange View this entry on the original dictionary page scan.
vici(see prec.) P. -ciketi-, -cinoti- etc. (pr. p. -cinvat-and -cinvāna-), to discern, distinguish ; to make anything discernible or clear, cause to appear, illumine ; to search through, investigate, inspect, examine etc. ; to look for, long for, strive after View this entry on the original dictionary page scan.
vicicinvatkamfn. (fr. pr. p. cinvat-) sifting, discriminating View this entry on the original dictionary page scan.
vicicīṣāf. (fr. Desiderative) desire of searching
vicicitmfn. searching, sifting View this entry on the original dictionary page scan.
vicicitamfn. searched through, searched View this entry on the original dictionary page scan.
vicicitif. equals caya- View this entry on the original dictionary page scan.
vicicityamfn. to be sifted View this entry on the original dictionary page scan.
vicikila varia lectio for vicakila- View this entry on the original dictionary page scan.
vicikitsāf. doubt, uncertainty, question, inquiry View this entry on the original dictionary page scan.
vicikitsāf. error, mistake View this entry on the original dictionary page scan.
vicikitsanan. (fr. Desiderative) the being uncertain, doubtfulness View this entry on the original dictionary page scan.
vicikitsārthīyamfn. expressing doubt or uncertainty View this entry on the original dictionary page scan.
vicikitsyan. (impersonal or used impersonally) it is to be doubted View this entry on the original dictionary page scan.
vicilakam. a kind of venomous insect View this entry on the original dictionary page scan.
vicintP. A1. -cintayati-, te-, to perceive, discern, observe ; to think of, reflect upon, ponder, consider, regard, mind, care for etc. ; to find out, devise, investigate ; to fancy, imagine View this entry on the original dictionary page scan.
vicintāf. thought, reflection, care for anything
vicintanan. thinking, thought View this entry on the original dictionary page scan.
vicintanīyamfn. to be considered or observed View this entry on the original dictionary page scan.
vicintitamfn. thought of, considered, imagined View this entry on the original dictionary page scan.
vicintitṛmfn. one who thinks of (genitive case) View this entry on the original dictionary page scan.
vicintyamfn. to be considered or thought of or cared for View this entry on the original dictionary page scan.
vicintyamfn. to be found out or devised View this entry on the original dictionary page scan.
vicintyamfn. doubtful, questionable View this entry on the original dictionary page scan.
vicīrin wrong reading for vi-cārin- View this entry on the original dictionary page scan.
vicīrṇamfn. gone or wandered through etc. View this entry on the original dictionary page scan.
vicīrṇamfn. occupied by View this entry on the original dictionary page scan.
vicīrṇamfn. entered View this entry on the original dictionary page scan.
vicīrṇaSee under vi-car-. View this entry on the original dictionary page scan.
vicitP. A1. -cetati-, te-, to perceive, discern, understand ; (A1.) to be or become visible, appear : Causal -citayati-, to perceive, distinguish : Desiderative -cikitsati-, to wish to distinguish ; to reflect, consider, doubt, be uncertain, hesitate View this entry on the original dictionary page scan.
vicitraSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vicitramf(ā-)n. variegated, many-coloured, motley, brilliant etc. View this entry on the original dictionary page scan.
vicitramf(ā-)n. manifold, various, diverse etc. View this entry on the original dictionary page scan.
vicitramf(ā-)n. strange, wonderful, surprising etc. View this entry on the original dictionary page scan.
vicitramf(ā-)n. charming, lovely, beautiful View this entry on the original dictionary page scan.
vicitramf(ā-)n. amusing, entertaining (as a story) View this entry on the original dictionary page scan.
vicitramf(ā-)n. painted, coloured View this entry on the original dictionary page scan.
vicitramf(ā-)n. charmingly View this entry on the original dictionary page scan.
vicitram. the aśoka- tree View this entry on the original dictionary page scan.
vicitram. Name of a king View this entry on the original dictionary page scan.
vicitram. of a son of manu- raucya- or deva-sāvarṇi- View this entry on the original dictionary page scan.
vicitram. of a heron View this entry on the original dictionary page scan.
vicitrāf. a white deer View this entry on the original dictionary page scan.
vicitram. colocynth View this entry on the original dictionary page scan.
vicitram. (in music) a particular mūrchanā- View this entry on the original dictionary page scan.
vicitram. Name of a river View this entry on the original dictionary page scan.
vicitran. variegated colour, party-colour View this entry on the original dictionary page scan.
vicitran. wonder, surprise View this entry on the original dictionary page scan.
vicitran. a figure of speech (implying apparently the reverse of the meaning intended) View this entry on the original dictionary page scan.
vicitrabhūṣaṇam. Name of a kiṃ-nara- View this entry on the original dictionary page scan.
vicitracaritramfn. behaving in a wonderful manner View this entry on the original dictionary page scan.
vicitracīnāṃśukan. variegated China cloth, shot or watered China silk View this entry on the original dictionary page scan.
vicitradehamfn. having a painted body View this entry on the original dictionary page scan.
vicitradehamfn. elegantly formed View this entry on the original dictionary page scan.
vicitradeham. a cloud View this entry on the original dictionary page scan.
vicitrakamfn. wonderful, surprising View this entry on the original dictionary page scan.
vicitrakamfn. (in fine compositi or 'at the end of a compound') connected with (?) View this entry on the original dictionary page scan.
vicitrakam. Betula Bhojpatra View this entry on the original dictionary page scan.
vicitrakan. wonder, astonishment View this entry on the original dictionary page scan.
vicitrakatham. "one whose stories are amusing", Name of a man View this entry on the original dictionary page scan.
vicitrālaṃkārasvaram. Name of a serpent-demon View this entry on the original dictionary page scan.
vicitramind. manifoldly, variously View this entry on the original dictionary page scan.
vicitramālyābharaṇamfn. having variegated garlands and ornaments View this entry on the original dictionary page scan.
vicitramauliśrīcūḍam. Name of a prince View this entry on the original dictionary page scan.
vicitrāṅgam. "having variegated limbs or a spotted body", a peacock View this entry on the original dictionary page scan.
vicitrāṅgam. a tiger View this entry on the original dictionary page scan.
vicitrapaśum. Name of a poet View this entry on the original dictionary page scan.
vicitrāpīḍam. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vicitrarūpamfn. having various forms, various, diverse View this entry on the original dictionary page scan.
vicitrasiṃham. Name of a man View this entry on the original dictionary page scan.
vicitratāf. variegation, variety, wonderfulness View this entry on the original dictionary page scan.
vicitratvan. variegation, variety, wonderfulness View this entry on the original dictionary page scan.
vicitravāgurocchrāyamayamf(ī-)n. filled with various outspread nets View this entry on the original dictionary page scan.
vicitravākyapaṭutāf. great eloquence View this entry on the original dictionary page scan.
vicitravarṣinmfn. raining here and there (not everywhere) View this entry on the original dictionary page scan.
vicitravīryam. "of marvellous heroism", Name of a celebrated king of the lunar race (the son of śāṃtanu- by his wife satya-vatī-, and so half-brother of bhīṣma-;when he died childless, his mother requested vyāsa-, whom she had borne before her marriage to the sage parāśara-, to raise up issue to vicitra-vīrya-;so vyāsa- married the two widows of his half-brother, ambikā- and ambālikā-, and by them became the father of dhṛta-rāṣṭra- and pāṇḍu-; see ) View this entry on the original dictionary page scan.
vicitravīryasūf."mother of vicitra-vīrya-", Name of satya-vatī- View this entry on the original dictionary page scan.
vicitritamfn. variegated, spotted, coloured, painted View this entry on the original dictionary page scan.
vicitritamfn. embellished by, adorned or decorated with (instrumental case or compound) View this entry on the original dictionary page scan.
vicitritamfn. wonderful View this entry on the original dictionary page scan.
vicittamfn. (for 2.See under vi-cit-) unconscious View this entry on the original dictionary page scan.
vicittamfn. not knowing what to do, helpless View this entry on the original dictionary page scan.
vicitta(v/i--) mfn. (for 1.See) perceived, observed, perceivable, manifest View this entry on the original dictionary page scan.
vicittatāf. unconsciousness View this entry on the original dictionary page scan.
vicittif. perturbation (equals vi-bhrama-) View this entry on the original dictionary page scan.
vicitvārā(prob.) wrong reading for vijitvarā-. View this entry on the original dictionary page scan.
vicṛtP. -cṛtati-, to loosen, detach, untie, open, set free View this entry on the original dictionary page scan.
vicṛtf. the act of loosening or untying View this entry on the original dictionary page scan.
vicṛtf. dual number Name of two stars View this entry on the original dictionary page scan.
vicṛtf. of the 17th nakṣatra- View this entry on the original dictionary page scan.
vicṛtta(v/i--) mfn. loosened, untied, opened, spread (cṛta- wrong reading ) . View this entry on the original dictionary page scan.
viculam. Vangueria Spinosa View this entry on the original dictionary page scan.
vicūlinmfn. having no crest View this entry on the original dictionary page scan.
vicumbP. -cumbati-, to kiss eagerly, kiss View this entry on the original dictionary page scan.
vicūrṇP. -cūrṇayati-, to grind to pieces, pound, smash, pulverize View this entry on the original dictionary page scan.
vicūrṇanan. grinding to pieces, pulverizing View this entry on the original dictionary page scan.
vicūrṇībhūP. -bhavati-, to become pulverized or smashed, become dust View this entry on the original dictionary page scan.
vicūrṇitamfn. ground, pounded etc. View this entry on the original dictionary page scan.
vicūrṇitam. Name of a man View this entry on the original dictionary page scan.
vicyuCaus. -cyāvayati-, to cause to fall to pieces, throw down, destroy View this entry on the original dictionary page scan.
vicyutamfn. (v/i--) fallen asunder or to pieces View this entry on the original dictionary page scan.
vicyutamfn. fallen or departed or swerved or deviated from (ablative) View this entry on the original dictionary page scan.
vicyutamfn. failed, perished, lost View this entry on the original dictionary page scan.
vicyutamfn. loosened, set free View this entry on the original dictionary page scan.
vicyutamfn. (in surgery) separated from the living part, sloughed View this entry on the original dictionary page scan.
vicyutif. falling from (literally and figuratively) View this entry on the original dictionary page scan.
vicyutif. severance, separation View this entry on the original dictionary page scan.
vicyutif. failure, miscarriage (See garbha-v-). View this entry on the original dictionary page scan.
vi (see biṭ-and viṭ-;prob. artificial and of doubtful connection with the following words) cl.1 P. veḍati-, to call, cry out, curse, swear varia lectio ; to break View this entry on the original dictionary page scan.
vif. a bit, fragment View this entry on the original dictionary page scan.
vid cl.2 P. () vetti- (vidmahe- ; vedati-, te- ; vid/ati-, te- etc.; vindati-, te- etc.; imperative vidāṃ-karotu- [ confer, compare ];1. sg. imperfect tense avedam-,2. sg. avet-or aves-[ ] etc.;3. plural avidus- [ confer, compare ]; avidan- etc.; perfect tense v/eda-[often substituted for proper vetti- confer, compare ], 3. plural vid/us-or vidre- ; viveda- etc.; vidāṃcak/āra- etc.[ confer, compare ; according to to also vidām-babhūva-]; Aorist avedīt- ; vidām-akran- ; future vedit/ā- ; vettā- future vediṣyati-, te- ; vetsyati-, te- etc.; infinitive mood v/editum-, tos- ; vettum- etc.; ind.p. viditv/ā- etc.), to know, understand, perceive, learn, become or be acquainted with, be conscious of, have a correct notion of (with accusative,in older, language also with genitive case;with infinitive mood = to know how to) etc. (viddhi yathā-,"know that"; vidyāt-,"one should know","it should be understood"; ya evam veda-[in ],"who knows thus","who has this knowledge") ; to know or regard or consider as, take for, declare to be, call (especially in 3. plural vidus-,with two accusative or with accusative and Nominal verb with iti-, exempli gratia, 'for example' taṃ sthaviraṃ viduḥ-,"they consider or call him aged"; rājarṣir iti māṃ viduḥ-,"they consider me a rājarṣi-") etc. ; to mind, notice, observe, remember (with genitive case or accusative) ; to experience, feel (accusative or genitive case) etc. ; to wish to know, inquire about (accusative) : Causal ved/ayate- (rarely ti-; Aorist avīvidat-; Passive voice vedyate-), to make known, announce, report, tell etc. ; to teach, explain ; to recognize or regard as, take for (two accusative) etc. ; to feel, experience etc.: Desiderative of Causal in vivedayiṣu- q.v : Desiderative vividiṣati- or vivitsati-, to wish to know or learn, inquire about (acc) : Intensive vevidyate-, vevetti- grammar ([ confer, compare Greek for , for equals veda-; Latin videre; Slavonic or Slavonian ve8de8ti; Gothic witan,wait; German wizzan,wissen; Anglo-Saxon wa7t; English wot.]) View this entry on the original dictionary page scan.
vidmfn. knowing, understanding, a knower (mostly in fine compositi or 'at the end of a compound';superl. vit-tama-) etc. View this entry on the original dictionary page scan.
vidm. the planet Mercury (see 2. jña-) View this entry on the original dictionary page scan.
vidf. knowledge understanding View this entry on the original dictionary page scan.
vidf. (plural) View this entry on the original dictionary page scan.
vid (originally identical with1. vid-) cl.6 P. A1. () vind/ati-, te- (Vedic or Veda also vitt/e-, vid/e-; parasmE-pada vidān/a-or vidāna-[ q.v ]; Epic 3. plural vindate- Potential vindyāt-,often equals vidyāt-; perfect tense viv/eda-[3. plural vividus- subjunctive vividat-], vividv/as-,3. plural vividre-, vidr/e- etc.; parasmE-pada vividv/as- ; vividivas- ; Aorist /avidat-, data- [ Vedic or Veda subjunctive vid/āsi-, d/āt-; Potential vid/et-, deta- ;3. sg. videṣṭa- ]; A1.1. sg. avitsi- ; future vettā-, vediṣyati- grammar; vetsyati-, te- etc.; infinitive mood vid/e- ; vettum- etc.; v/ettave- ; ttavai-[?] and tos- ; ind.p. vittv/ā- ; -vidya- etc.) , to find, discover, meet or fall in with, obtain, get, acquire, partake of, possess etc. etc. (with diśas-,to find out the quarters of she sky ) ; to get or procure for (dative case) ; to seek out, look for, attend to etc. ; to feel, experience ; to consider as, take for (two accusative) ; to come upon, befall, seize, visit ; to contrive, accomplish, perform, effect, produce ; (A1. mc. also P.) to take to wife, marry (with or scilicet bhāryām-) etc. ; to find (a husband), marry (said of a woman) ; to obtain (a son, with or scilicet sutam-) : Passive voice or A1. vidy/ate- (Epic also ti-; parasmE-pada vidyamāna-[ q.v ]; Aorist avedi-), to be found, exist, be etc. ; (especially in later language) vidyate-,"there is, there exists", often with na-,"there is not" ; with bhoktum-,"there is something to eat" ; followed by a future ,"is it possible that?" ; yathā-vid/e-,"as it happens" id est "as usual","as well as possible" : Causal vedayati-, to cause to find etc. : Desiderative vividiṣati- or vivitsati-, te- grammar (see vivitsita-): Intensive vevidyate-, vevetti- (for parasmE-pada v/evidat-and dāna-See vi--and saṃvid-).
vid(in fine compositi or 'at the end of a compound') finding, acquiring, procuring (See anna--, aśva--, ahar-vid-etc.) View this entry on the original dictionary page scan.
vid cl.7 A1. () vintte-, to consider as, take for (two accusative) View this entry on the original dictionary page scan.
viin compound for 3. viṣ-. View this entry on the original dictionary page scan.
viḍamn. a kind of salt (either factitious salt, procured by boiling earth impregnated with saline particles, or a particular kind of fetid salt used medicinally as a tonic aperient, commonly called Vit-lavan or Bit-noben see viḍ-lavaṇa-;it is black in colour and is prepared by fusing fossil silt with a small portion of Emblic Myrobalan, the product being muriate of soda with small quantities of muriate of lime, sulphur, and oxide of iron) View this entry on the original dictionary page scan.
viḍam. Name of a country and its king View this entry on the original dictionary page scan.
viḍam. a fragment, bit, portion (?) View this entry on the original dictionary page scan.
vidamfn. equals prec. (see ko--, trayī--, dvi-v-) View this entry on the original dictionary page scan.
vidam. knowledge, discovery (see dur-v-) View this entry on the original dictionary page scan.
vidam. Name of a man (see bida-). View this entry on the original dictionary page scan.
viP. -dadāti-, to give out, distribute, grant View this entry on the original dictionary page scan.
vi(or do-,not separable fr.4. -) P. -dāti-, or -dyati- (ind.p. -ditya-), to cut up, cut to pieces, bruise, pound ; to untie, release, deliver from (ablative) ; to destroy View this entry on the original dictionary page scan.
vidabhṛtm. Name of a man gaRa gargādi- (see vaidabhṛta-, tya-). View this entry on the original dictionary page scan.
vidad(for vidat-, pr. p. of3. vid-), in compound View this entry on the original dictionary page scan.
vidadaṅkṣu(?) mfn. (fr. Desiderative) wishing to bite or to eat View this entry on the original dictionary page scan.
vidadaśvam. "granting horses", Name of a man (see vaidadaśvi-). View this entry on the original dictionary page scan.
vidadvasu(vid/ad--) mfn. possessing or granting wealth View this entry on the original dictionary page scan.
vidagaṇa(?) View this entry on the original dictionary page scan.
viḍagandhan. the medicinal salt described above View this entry on the original dictionary page scan.
vidagdhamfn. (for 2.See vi-dah-) undigested View this entry on the original dictionary page scan.
vidagdhaSee vi-dah- below. View this entry on the original dictionary page scan.
vidagdhamfn. burnt up, consumed
vidagdhamfn. inflamed View this entry on the original dictionary page scan.
vidagdhamfn. cooked by internal heat as by the fire of digestion, digested View this entry on the original dictionary page scan.
vidagdhamfn. decomposed, corrupted, spoiled, turned sour View this entry on the original dictionary page scan.
vidagdhamfn. mature (as a tumour) View this entry on the original dictionary page scan.
vidagdhamfn. tawny or reddish brown (like impure blood) View this entry on the original dictionary page scan.
vidagdhamfn. clever, shrewd, knowing, sharp, crafty, sly, artful, intriguing etc. View this entry on the original dictionary page scan.
vidagdham. tawny (the colour) View this entry on the original dictionary page scan.
vidagdham. a clever man, scholar, Pandit View this entry on the original dictionary page scan.
vidagdham. a libertine, intriguer View this entry on the original dictionary page scan.
vidagdham. Name of a teacher of the vājasaneyin-s View this entry on the original dictionary page scan.
vidagdhāf. a sharp or knowing woman View this entry on the original dictionary page scan.
vidagdhabodham. Name of a grammar (by rāma-candra- miśra-) View this entry on the original dictionary page scan.
vidagdhacuḍāmaṇim. Name of an enchanted parrot View this entry on the original dictionary page scan.
vidagdhājīrṇan. a particular form of indigestion View this entry on the original dictionary page scan.
vidagdhakam. a burning corpse View this entry on the original dictionary page scan.
vidagdhālāpamfn. clever in language, elegant, witty View this entry on the original dictionary page scan.
vidagdhamādhavan. Name of a nāṭaka- or drama (by rūpa- go-svāmin-, in 7 acts, written A.D. 1549;it is a dramatic version of the gīta-govinda- on the loves of kṛṣṇa- and rādhā-) View this entry on the original dictionary page scan.
vidagdhamukhamaṇḍanan. Name of work on enigmas (by the Buddhist dharmadāsa-) View this entry on the original dictionary page scan.
vidagdhapariṣadf. an assembly or company of clever people View this entry on the original dictionary page scan.
vidagdhaparivṛddhatāf. the turning acid and swelling (of food in the stomach) View this entry on the original dictionary page scan.
vidagdhatāf. cleverness, sharpness, skill in (locative case) View this entry on the original dictionary page scan.
vidagdhatoṣiṇīf. Name of an astronomy work View this entry on the original dictionary page scan.
vidagdhatvan. cleverness, sharpness, skill in (locative case) View this entry on the original dictionary page scan.
vidagdhavacanamfn. clever or skilful in speech View this entry on the original dictionary page scan.
vidagdhavaidyam. Name of a medical writer View this entry on the original dictionary page scan.
vidahP. -dahati-, to burn up, scorch, consume or destroy by fire ; to cauterize (a wound) ; to decompose, corrupt : Passive voice -dahyate-, to be burnt etc. ; to burn, be inflamed (as a wound) ; to suffer from internal heat ; to be consumed by grief, waste, pine ; to be puffed up, boast (varia lectio vi-katthase-for vi-dahyase-). View this entry on the original dictionary page scan.
vidāham. burning, heat, inflammation (also applied to the action or to a diseased condition of the bile), View this entry on the original dictionary page scan.
vidāham. the turning acid (of food in the stomach) View this entry on the original dictionary page scan.
vidāhakan. caustic potash View this entry on the original dictionary page scan.
vidāhavatmfn. burning, hot View this entry on the original dictionary page scan.
vidāhinmfn. burning, scorching, hot ( vidāhitva hi-tva- n.) View this entry on the original dictionary page scan.
vidāhinmfn. pungent, acrid View this entry on the original dictionary page scan.
vidāhitvan. vidāhin
vidakṣiṇamfn. directed to another quarter than the south View this entry on the original dictionary page scan.
vidalP. -dalati-, to break or burst asunder, be rent or split asunder ; to open, rend or tear asunder (Passive voice future parasmE-pada -daliṣyamāna- ) View this entry on the original dictionary page scan.
vidalamfn. (for 2.See vi-dal-) leafless View this entry on the original dictionary page scan.
vidalamf(ā-)n. (see bidala-;for 1.See) rent asunder, split View this entry on the original dictionary page scan.
vidalamf(ā-)n. expanded, blown View this entry on the original dictionary page scan.
vidalam. rending, dividing, separating View this entry on the original dictionary page scan.
vidalam. sweetmeats, a cake View this entry on the original dictionary page scan.
vidalam. Bauhinia Variegata View this entry on the original dictionary page scan.
vidalāf. Ipomoea Turpethum View this entry on the original dictionary page scan.
vidalan. anything split or pared, a chip, piece, fragment etc. View this entry on the original dictionary page scan.
vidalan. split bamboo, a cane View this entry on the original dictionary page scan.
vidalan. wicker-work View this entry on the original dictionary page scan.
vidalan. a split pea View this entry on the original dictionary page scan.
vidalan. pomegranate bark View this entry on the original dictionary page scan.
vidaladalīkaraṇan. the act of rending asunder or dividing View this entry on the original dictionary page scan.
vidaladalīkṛtamfn. rent asunder, torn, cut, divided, separated View this entry on the original dictionary page scan.
vidaladalitamfn. burst or rent asunder etc. View this entry on the original dictionary page scan.
vidaladalitamfn. expanded, blown View this entry on the original dictionary page scan.
vidalanan. the act of tearing or rending asunder, splitting View this entry on the original dictionary page scan.
vidalanan. bursting (intrans.) View this entry on the original dictionary page scan.
viḍalavaṇam. n. idem or 'n. the medicinal salt described above ' View this entry on the original dictionary page scan.
viḍambA1. -ḍambate-, to imitate, vie with ; P. ḍambayati-, to imitate, copy, emulate, equal, be a match for any one or anything ; to mock, deride, ridicule ; to impose upon, take in, cheat, deceive ; to afflict View this entry on the original dictionary page scan.
viḍambamfn. imitating, representing View this entry on the original dictionary page scan.
viḍambam. mockery, derision View this entry on the original dictionary page scan.
viḍambam. degradation, desecration View this entry on the original dictionary page scan.
viḍambam. afflicting, distressing, annoyance View this entry on the original dictionary page scan.
viḍambakamfn. imitating, strikingly resembling View this entry on the original dictionary page scan.
viḍambakamfn. disgracing, profaning View this entry on the original dictionary page scan.
viḍambanamfn. imitating, representing, acting like View this entry on the original dictionary page scan.
viḍambanan. and f(ā-). imitation, copying, representing, playing the part of any one, imposture, disguise (especially applied to a god assuming human form) (accusative with kṛ-,to imitate, copy, represent) View this entry on the original dictionary page scan.
viḍambanan. derision, ridiculousness, mockery, scoff, scorn, vexation, mortification etc. (accusative with kṛ-,to mock, deride) View this entry on the original dictionary page scan.
viḍambanan. disgrace, degradation profanation View this entry on the original dictionary page scan.
viḍambanan. abuse, misusage View this entry on the original dictionary page scan.
viḍambanan. disappointing, frustrating View this entry on the original dictionary page scan.
viḍambanīyamfn. to be imitated etc. View this entry on the original dictionary page scan.
viḍambanīyamfn. to be distressed or annoyed View this entry on the original dictionary page scan.
viḍambinmfn. imitating, copying, bearing a striking resemblance View this entry on the original dictionary page scan.
viḍambinmfn. mocking, deriding, vying with, surpassing View this entry on the original dictionary page scan.
viḍambinmfn. disgracing, degrading, profaning View this entry on the original dictionary page scan.
viḍambinmfn. causing deception or error View this entry on the original dictionary page scan.
viḍambitamfn. imitated, copied etc. View this entry on the original dictionary page scan.
viḍambitamfn. disguised, transformed, distorted View this entry on the original dictionary page scan.
viḍambitamfn. vexed, mortified View this entry on the original dictionary page scan.
viḍambitamfn. low, poor, abject View this entry on the original dictionary page scan.
viḍambitamfn. deceived, disappointed, frustrated View this entry on the original dictionary page scan.
viḍambitan. an object of ridicule or contempt, despicable object View this entry on the original dictionary page scan.
viḍambiteśvaramfn. imitating or representing śiva- View this entry on the original dictionary page scan.
viḍambyan. an object of ridicule or contempt View this entry on the original dictionary page scan.
vidaṃśP. -daśati-, to bite to pieces, bite asunder View this entry on the original dictionary page scan.
vidaṃśam. biting View this entry on the original dictionary page scan.
vidaṃśam. any pungent food which excites thirst View this entry on the original dictionary page scan.
vidānaSee under 3. vid-. View this entry on the original dictionary page scan.
vidāna mfn. (A1. pr. p.) existing being, real View this entry on the original dictionary page scan.
vidānamfn. common, usual View this entry on the original dictionary page scan.
vidānamfn. forming, making (?) View this entry on the original dictionary page scan.
vidānamfn. (A1. pr. p.) existing being, real View this entry on the original dictionary page scan.
vidānamfn. common, usual View this entry on the original dictionary page scan.
vidānamfn. forming, making (?) View this entry on the original dictionary page scan.
vidānan. cutting to pieces, dividing View this entry on the original dictionary page scan.
vidaṇḍam. a door-key View this entry on the original dictionary page scan.
vidaṇḍam. Name of a king View this entry on the original dictionary page scan.
viḍaṅgamfn. clever, able, skilful View this entry on the original dictionary page scan.
viḍaṅgam. and f(ā-). Embelia Ribes View this entry on the original dictionary page scan.
viḍaṅgan. the fruit of the above plant (a vermifuge) View this entry on the original dictionary page scan.
vidantamfn. toothless, deprived of his tusks (said of an elephant) View this entry on the original dictionary page scan.
vidāntam. Name of a prince View this entry on the original dictionary page scan.
vidanvatm. Name of a bhārgava- View this entry on the original dictionary page scan.
vidaramf(ā-)n. (for 2.See under vi-dṝ-) free from cracks or holes View this entry on the original dictionary page scan.
vidara vi-daraṇa- See under vidṝ-, . View this entry on the original dictionary page scan.
vidāra raka-, raṇa- See under vi-dṝ-, . View this entry on the original dictionary page scan.
vidaram. (for 1.See) tearing asunder, rending View this entry on the original dictionary page scan.
vidaram. a crevice, fissure View this entry on the original dictionary page scan.
vidaran. Cactus Indicus (prob. the flower) View this entry on the original dictionary page scan.
vidāram. tearing or rending asunder, cutting, splitting View this entry on the original dictionary page scan.
vidāram. war, battle View this entry on the original dictionary page scan.
vidāram. an inundation, overflow View this entry on the original dictionary page scan.
viḍāraka viḍāla- See biḍ-. View this entry on the original dictionary page scan.
vidārakamfn. tearing asunder, cutting, splitting, lacerating View this entry on the original dictionary page scan.
vidārakamfn. a hole or pit for water in the bed of a dry river View this entry on the original dictionary page scan.
vidārakamfn. a tree or rock in the middle of a stream dividing its course
vidaraṇan. tearing asunder, reading View this entry on the original dictionary page scan.
vidaraṇan. equals vidradhi- View this entry on the original dictionary page scan.
vidāraṇamf(ī-)n. tearing or rending asunder, breaking, splitting, cleaving, piercing, crushing, lacerating etc. View this entry on the original dictionary page scan.
vidāraṇam. Pterospermum Acerifolium View this entry on the original dictionary page scan.
vidāraṇam. a tree or rock in the middle of a stream to which a boat is fastened View this entry on the original dictionary page scan.
vidāraṇan. the act of tearing asunder etc. etc. View this entry on the original dictionary page scan.
vidāraṇan. hewing down, wasting (of a forest) View this entry on the original dictionary page scan.
vidāraṇan. opening wide (the mouth) View this entry on the original dictionary page scan.
vidāraṇan. repelling, rejecting View this entry on the original dictionary page scan.
vidāraṇan. killing View this entry on the original dictionary page scan.
vidāraṇan. equals viḍamba- or bana- View this entry on the original dictionary page scan.
vidāraṇan. (also) f(ā-). war, battle View this entry on the original dictionary page scan.
vidarbhaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vidarbham. "destitute of darbha- grass", Name of a country south of the vindhya- hills (now called Berar;it was the country of damayantī-, wife of nala-;the soil was probably grassless and arid, but the absence of darbha- is said to be due to the fact that the son of a saint died of the prick of a sharp blade of that grass) etc. View this entry on the original dictionary page scan.
vidarbham. a king of vidarbha- View this entry on the original dictionary page scan.
vidarbham. a particular disease of the gums (equals vaidarbha-) View this entry on the original dictionary page scan.
vidarbham. Name of a man View this entry on the original dictionary page scan.
vidarbham. of a son of jyā-magha- View this entry on the original dictionary page scan.
vidarbham. of a son of ṛṣabha- View this entry on the original dictionary page scan.
vidarbham. plural the inhabitants of vidarbha- and also the country itself View this entry on the original dictionary page scan.
vidarbham. the interior of anything View this entry on the original dictionary page scan.
vidarbhāf. Name of the capital city of vidarbha- (= kuṇḍina-) View this entry on the original dictionary page scan.
vidarbhāf. of a river View this entry on the original dictionary page scan.
vidarbhāf. of a daughter of ugra- and wife of manu- cākṣuṣa- View this entry on the original dictionary page scan.
vidarbhābhimukhamfn. facing vidarbha- View this entry on the original dictionary page scan.
vidarbhabhūf. the country of vidarbha- View this entry on the original dictionary page scan.
vidarbhādhipam. the vidarbha- king ( vidarbhādhiparājadhānī -rāja-dhānī- f.his residence ) View this entry on the original dictionary page scan.
vidarbhādhiparājadhānīf. vidarbhādhipa
vidarbhādhipatim. idem or 'm. the vidarbha- king ( vidarbhādhiparājadhānī -rāja-dhānī- f.his residence )' View this entry on the original dictionary page scan.
vidarbhajāf. " vidarbha--born", Name of the wife of the saint agastya-, of damayantī-, and of rukmiṇī- View this entry on the original dictionary page scan.
vidarbhanagarīf. the city of vidarbha- View this entry on the original dictionary page scan.
vidarbhapatim. the king of vidarbha- View this entry on the original dictionary page scan.
vidarbharājm. the king of vidarbha- View this entry on the original dictionary page scan.
vidarbharājam. (or jan-) idem or 'm. the king of vidarbha- ' ( vidarbharājadhānī ja-dhānī- f.the capital of vidarbha- ; vidarbharājaputrī ja-putrī- f. patronymic of rukmiṇī- ) View this entry on the original dictionary page scan.
vidarbharājadhānīf. vidarbharāja
vidarbharājaputrīf. vidarbharāja
vidarbhatanayāf. "daughter of the vidarbha- king", Name of damayantī- View this entry on the original dictionary page scan.
vidarbhim. Name of a ṛṣi- View this entry on the original dictionary page scan.
vidarbhīkauṇḍinyam. Name of a preceptor View this entry on the original dictionary page scan.
vidārīf. See below View this entry on the original dictionary page scan.
vidārīf. a swelling in the groin View this entry on the original dictionary page scan.
vidārif. (m. Calcutta edition) equals dārī-, Hedysarum Gangeticum (also -gandhā- ) View this entry on the original dictionary page scan.
vidārif. Name of a female demon View this entry on the original dictionary page scan.
vidārīf. Batatas Paniculata View this entry on the original dictionary page scan.
vidārīf. Hedysarum Gangeticum View this entry on the original dictionary page scan.
vidārīgandhāf. idem or 'f. Hedysarum Gangeticum ' () View this entry on the original dictionary page scan.
vidārīgandhikāf. idem or 'f. idem or 'f. Hedysarum Gangeticum ' ()' () View this entry on the original dictionary page scan.
vidārikāf. Hedysarum Gangeticum View this entry on the original dictionary page scan.
vidārikāf. Batatas Paniculata View this entry on the original dictionary page scan.
vidārikāf. a swelling in the groin View this entry on the original dictionary page scan.
vidārikāf. Name of a female demon (also akī- ) View this entry on the original dictionary page scan.
vidārinmfn. tearing asunder, breaking, cutting etc. View this entry on the original dictionary page scan.
vidārinf. Gmelina Arborea View this entry on the original dictionary page scan.
vidāritamfn. torn asunder, rent, split, broken open View this entry on the original dictionary page scan.
vidarśanā śin- See under 2. vi-driś-, p.966. View this entry on the original dictionary page scan.
vidarśanāf. (right) knowledge View this entry on the original dictionary page scan.
vidarśin wrong reading for ni-darśin- View this entry on the original dictionary page scan.
vidārva m. Name of a serpent-demon (see vi-darvya-). View this entry on the original dictionary page scan.
vidarvyamfn. (fr. darvi-) hoodless (said of a serpent) View this entry on the original dictionary page scan.
vidārvyam. Name of a serpent-demon (see vi-darvya-). View this entry on the original dictionary page scan.
vidasP. -dasyati-, or -dasati-, to waste away, become exhausted, come to an end ; to be wanting, fail (with ablative of Persian) View this entry on the original dictionary page scan.
vidāśP. -dāśati-, to reject, deny View this entry on the original dictionary page scan.
vidaśamfn. having no fringe or border (as a garment) View this entry on the original dictionary page scan.
vidāsinSee a-vidāsin-. View this entry on the original dictionary page scan.
vidaṣṭamfn. crushed or forced asunder View this entry on the original dictionary page scan.
vidastamfn. wasted away, exhausted (equals upakṣīṇa-) View this entry on the original dictionary page scan.
vidasyaSee a-vidasy/a-. View this entry on the original dictionary page scan.
vidathan. knowledge, wisdom View this entry on the original dictionary page scan.
vidathan. (especially)"knowledge given to others" id est instruction, direction, order, arrangement, disposition, rule, command (also plural) (vidatham ā-vad-,to impart knowledge, give instruction, rule, govern) View this entry on the original dictionary page scan.
vidathan. a meeting, assembly (either for deliberating or for the observance of festive or religious rites id est) council, community, association, congregation (also applied to particular associations or communities of gods, which in are opposed to those of men;in three associations of gods are mentioned) View this entry on the original dictionary page scan.
vidathan. a host, army, body of warriors (especially applied to the marut-s) View this entry on the original dictionary page scan.
vidathan. war, fight View this entry on the original dictionary page scan.
vidathan. a sage, scholar View this entry on the original dictionary page scan.
vidathan. a saint, devotee, ascetic (equals yogin-) View this entry on the original dictionary page scan.
vidathan. equals kṛtin- View this entry on the original dictionary page scan.
vidathan. Name of a man on View this entry on the original dictionary page scan.
vidatha according to to some for vidhā- tha- from vidh-, and originally ="homage, worship, sacrifice"; according to to others also ="house, household, etc.". View this entry on the original dictionary page scan.
vidathinm. Name of a man (see vaidathina-). View this entry on the original dictionary page scan.
vidathyamfn. fit for an assembly or council or any religious observance, festive, solemn View this entry on the original dictionary page scan.
vidatraSee dur-- and su-vid/atra-. View this entry on the original dictionary page scan.
vidatriyaSee su-vidatr/iya-. View this entry on the original dictionary page scan.
vidattamfn. given out, distributed on View this entry on the original dictionary page scan.
vidayA1. -dayate-, to divide, sever, destroy ; to distribute, bestow, be liberal with (instrumental case) View this entry on the original dictionary page scan.
vidāyam. division, distribution, (varia lectio) View this entry on the original dictionary page scan.
vidāyam. permission to go away, dismissal with good wishes (in this sense perhaps not a Sanskrit word; see $). View this entry on the original dictionary page scan.
viḍāyatanīyaSee under 2. viś-. View this entry on the original dictionary page scan.
vidāyinmfn. granting, causing, effecting View this entry on the original dictionary page scan.
vidāyyamfn. to be found View this entry on the original dictionary page scan.
viḍbandham. constipation View this entry on the original dictionary page scan.
viḍbhaṅgam. diarrhoea View this entry on the original dictionary page scan.
viḍbhavamfn. equals -ja- View this entry on the original dictionary page scan.
viḍbhedam. equals -bhaṅga- View this entry on the original dictionary page scan.
viḍbhedinmfn. laxative View this entry on the original dictionary page scan.
viḍbhedinn. (prob.) equals -lavaṇa- View this entry on the original dictionary page scan.
viḍbhidf. equals -bhaṅga- View this entry on the original dictionary page scan.
viḍbhojinmfn. equals -bhuj- View this entry on the original dictionary page scan.
viḍbhujmfn. feeding on ordure View this entry on the original dictionary page scan.
viḍbhujm. a dung-beetle or a similar insect View this entry on the original dictionary page scan.
viḍḍan. bone View this entry on the original dictionary page scan.
viddaṇācāryam. Name of an author. View this entry on the original dictionary page scan.
viḍḍasiṃham. Name of a man View this entry on the original dictionary page scan.
viddhamfn. (past participle of vyadh-) pierced, perforated, penetrated, stabbed, struck, wounded, beaten, torn, hurt, injured etc. View this entry on the original dictionary page scan.
viddhamfn. cleft, split, burst asunder View this entry on the original dictionary page scan.
viddhamfn. (with śūlāyām-) impaled View this entry on the original dictionary page scan.
viddhamfn. opposed, impeded View this entry on the original dictionary page scan.
viddhamfn. thrown, sent View this entry on the original dictionary page scan.
viddhamfn. stung, incited, set in motion View this entry on the original dictionary page scan.
viddhamfn. filled or affected or provided or joined or mixed with (instrumental case or compound) View this entry on the original dictionary page scan.
viddhamfn. like, resembling View this entry on the original dictionary page scan.
viddham. Echites Scholaris View this entry on the original dictionary page scan.
viddhan. a wound View this entry on the original dictionary page scan.
viddhakam. a kind of harrow View this entry on the original dictionary page scan.
viddhakarṇamf(ī-)n. having the ears pierced or slit View this entry on the original dictionary page scan.
viddhakarṇam. and f(ā-, ī-,or ikā-). Clypea Hernandifolia View this entry on the original dictionary page scan.
viddhaparkaṭīf. Pongamia Glabra View this entry on the original dictionary page scan.
viddhaprajananam. Name of śaṇḍila- View this entry on the original dictionary page scan.
viddhaśālabhañjikāf. Name of a drama by rāja-śekhara-. View this entry on the original dictionary page scan.
viddhatvan. the being penetrated or affected with View this entry on the original dictionary page scan.
viddhāyudhan. a bow of a particular length View this entry on the original dictionary page scan.
viddhif. the act of piercing, perforating etc. View this entry on the original dictionary page scan.
videgham. (older form of vi-deha- q.v) Name of a man View this entry on the original dictionary page scan.
videhaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
videhamfn. bodiless, incorporeal View this entry on the original dictionary page scan.
videhamfn. deceased, dead (also videha-prāpta-) etc. View this entry on the original dictionary page scan.
videham. (/a-) (see vi-degh/a-) Name of a country (= the modern Tirhut) etc. View this entry on the original dictionary page scan.
videham. a king of vi-deha- (especially applied to janaka-) View this entry on the original dictionary page scan.
videham. Name of a medical author (also called -pati-,or dhipa-) View this entry on the original dictionary page scan.
videhāf. the capital city of vi-deha- id est mithilā- View this entry on the original dictionary page scan.
videham. plural the people of vi-deha- View this entry on the original dictionary page scan.
videhādhipam. - See viheha- View this entry on the original dictionary page scan.
videhādhipatim. equals ha-rāja- View this entry on the original dictionary page scan.
videhajāf. "daughter of janaka-", Name of sītā- View this entry on the original dictionary page scan.
videhakam. (fr. vi-deha-) Name of a mountain View this entry on the original dictionary page scan.
videhakan. Name of a varṣa- View this entry on the original dictionary page scan.
videhakaivalyaprāptif. the attainment of emancipation after death View this entry on the original dictionary page scan.
videhamuktif. deliverance through release from the body ( videhamuktikathana ti-kathana-n. and videhamuktyādikathana ty-ādi-kathana- n.Name of two treatises) View this entry on the original dictionary page scan.
videhamuktikathanan. videhamukti
videhamuktyādikathanan. videhamukti
videhanagaran. (), the city of mithilā- View this entry on the original dictionary page scan.
videhanagarīf. (), the city of mithilā- View this entry on the original dictionary page scan.
videhapatim. lord of mithilā- View this entry on the original dictionary page scan.
videharājam. a king of vi-deha- View this entry on the original dictionary page scan.
videhatvan. bodilessness (accusative with gataḥ-= deceased, dead) View this entry on the original dictionary page scan.
videśaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
videśam. another country, foreign country, abroad etc. View this entry on the original dictionary page scan.
videśam. a particular place (see -stha-) View this entry on the original dictionary page scan.
videśagamfn. going abroad View this entry on the original dictionary page scan.
videśagamanan. the act of going abroad or on a journey View this entry on the original dictionary page scan.
videśagatamfn. gone abroad View this entry on the original dictionary page scan.
videśajamfn. "born or produced abroad", foreign, exotic View this entry on the original dictionary page scan.
videśaniratamfn. taking delight in going abroad View this entry on the original dictionary page scan.
videśasthamfn. remaining abroad, living in a foreign country etc. View this entry on the original dictionary page scan.
videśasthamfn. standing apart or in a particular place View this entry on the original dictionary page scan.
videśasthamfn. occurring elsewhere View this entry on the original dictionary page scan.
videśavāsam. staying abroad, absence View this entry on the original dictionary page scan.
videśavāsinmfn. dwelling abroad View this entry on the original dictionary page scan.
videśinmfn. belonging to another country, foreign View this entry on the original dictionary page scan.
videśīyamfn. belonging to another country, foreign View this entry on the original dictionary page scan.
videśyamfn. foreign (opp. to saṃ-deśya-) View this entry on the original dictionary page scan.
videvamfn. (v/i--) godless, hostile to gods (as demons)
videvamfn. performed without gods (as a sacrifice)
videvam. (for 1.See) game at dice View this entry on the original dictionary page scan.
videvamind. unerotically (confer, compare su-- deva-), View this entry on the original dictionary page scan.
videvanan. dicing View this entry on the original dictionary page scan.
videyamfn. to be given or granted View this entry on the original dictionary page scan.
videyaSee under vi--. View this entry on the original dictionary page scan.
viḍgandha viḍ-graha- etc. See under 3. viṣ-. View this entry on the original dictionary page scan.
viḍgandhan. equals -lavaṇa- View this entry on the original dictionary page scan.
viḍghātam. a particular urinary disease View this entry on the original dictionary page scan.
viḍgraham. stoppage or obstruction of the feces, constipation View this entry on the original dictionary page scan.
vidh cl.6 P. -vidhati- (in also te-), to worship, honour a god (dative case locative case,or accusative) with (instrumental case) ; to present reverentially, offer, dedicate ; to be gracious or kind, befriend (said of indra-) View this entry on the original dictionary page scan.
vidh (or vindh-) cl.6 A1. vindh/ate-, to be destitute or bereft of, lack, want (instrumental case or accusative) View this entry on the original dictionary page scan.
vidhweak form of vyadh-. View this entry on the original dictionary page scan.
vidhmfn. (in fine compositi or 'at the end of a compound') piercing, penetrating (see marmā--, mṛgā--, śvā--, hṛdayā-vidh-). View this entry on the original dictionary page scan.
vidh cl.1 A1. vedhate-, to ask, beg (varia lectio for vith- q.v) View this entry on the original dictionary page scan.
vidham. piercing, perforating (for other meaningsSee 2. vidha-, column 3) . View this entry on the original dictionary page scan.
vidhāP. A1. -dadhāti-, -dhatte-, to distribute, apportion, grant, bestow etc. etc. (with kāmam-,to fulfil a wish) ; to furnish, supply, procure (with ātmanaḥ-,"for one's self") ; to spread, diffuse ; to put in order, arrange, dispose, prepare, make ready ; to divide, parcel out ; to ordain, direct, enjoin, settle, appoint etc. ; to form, create, build, establish, found etc. ; to perform, effect, produce, cause, occasion, make, do etc. (like kṛ-to be translated variously in connection with various nouns exempli gratia, 'for example' with siṃhatvam-,to change into a lion;with saciva-tām-,to assume the office of a minister;with veṣam-,to put on a garment;with vṛttim-,to secure a maintenance;with upāyam-,to devise a means;with mantram-,to hold a consultation;with rājyam-,to carry on government, rule;with saṃdhim-,to conclude peace;with kalaham-,to pick up a quarrel;with vairam-,to declare war;with lajjām-,to display bashfulness;with kolāhalam-,to raise a clamour;with cumbanaṃ-,to give a kiss) ; to make, render (with two accusative) etc. ; to contrive or manage that (yathā-) ; to put or lay on or in, direct towards (locative case) etc. (with hṛdaye-,to take to heart;with agrataḥ-,or adhaḥ-,to place before or below) ; to send out, despatch (spies) ; to take trouble with (dative case) ; to treat, deal with (accusative) : Passive voice -dhīyate-, to be distributed etc. ; to be allotted or intended for (genitive case) ; to be accounted, pass for (Nominal verb) : Causal -dhāpayati-, to cause to put, cause to be laid ; cause to put in order or arrange or fix : Desiderative -dhitsati-, te-, to wish to distribute or bestow ; to wish to decide or determine or fix or establish ; to wish to find out or devise (a means) ; to wish to procure or acquire ; to wish to perform or accomplish anything, intend, purpose ; to wish to make or render (two accusative)
vidhamn. of vidhā- (in fine compositi or 'at the end of a compound') (for 1.See column 2) View this entry on the original dictionary page scan.
vidham. measure, form, kind View this entry on the original dictionary page scan.
vidham. food for an elephant (see vi-dhāna-) View this entry on the original dictionary page scan.
vidham. equals ṛddhi- (see next) . View this entry on the original dictionary page scan.
vidhāf. division, part, portion (often in fine compositi or 'at the end of a compound' ="fold"; see eka--, bahu-vidha-etc.;also adverb in tri--and dvi-vidhā- q.v) View this entry on the original dictionary page scan.
vidhāf. form, manner, kind, sort etc. (yayā kayā-cid vidhayā-,in whatsoever way, anyhow;often in fine compositi or 'at the end of a compound'; see asmad-- evaṃ--, nānā-vidha-etc.) View this entry on the original dictionary page scan.
vidhāf. fodder View this entry on the original dictionary page scan.
vidhāf. increase (equals ṛddhi-) View this entry on the original dictionary page scan.
vidhāf. wages, hire View this entry on the original dictionary page scan.
vidhāf. pronunciation View this entry on the original dictionary page scan.
vidhāf. equals vedhana- (see 1. vidha-). View this entry on the original dictionary page scan.
vidham(or -dhmā-) P. -dhamati- (Epic also te-), to blow away, scatter, disperse, destroy : Causal -dhmāpayati-, to extinguish, View this entry on the original dictionary page scan.
vidhama(2. sg. imperative), View this entry on the original dictionary page scan.
vidhamāf. Name of a female demon View this entry on the original dictionary page scan.
vidhamacūḍāf. gaRa mayūra-vyaṃsakādi-. View this entry on the original dictionary page scan.
vidhamanamfn. blowing out, extinguishing View this entry on the original dictionary page scan.
vidhamanamfn. blowing away, destroying ( vidhamanatā -- f.) View this entry on the original dictionary page scan.
vidhamanan. the act of blowing away or asunder View this entry on the original dictionary page scan.
vidhamanatāf. vidhamana
vidhanamfn. devoid of wealth, poor View this entry on the original dictionary page scan.
vidhana vi-dhanuṣka- etc. See . View this entry on the original dictionary page scan.
vidhānamf(ī-)n. disposing, arranging, regulating View this entry on the original dictionary page scan.
vidhānamf(ī-)n. acting, performing, possessing, having View this entry on the original dictionary page scan.
vidhānam. Name of a sādhya- View this entry on the original dictionary page scan.
vidhānan. order, measure, disposition, arrangement, regulation, rule, precept, method, manner etc. (instrumental case sg. and plural,and vidhānatas -tas- ind.according to rule or precept; saṃkhyā-vidhānāt-,according to mathematical method, mathematically; deśa-kāla-vidhānena-,in the right place and at the right time) View this entry on the original dictionary page scan.
vidhānan. medical prescription or regulation, diet View this entry on the original dictionary page scan.
vidhānan. fate, destiny View this entry on the original dictionary page scan.
vidhānan. taking measures, contriving, managing etc. View this entry on the original dictionary page scan.
vidhānan. a means, expedient View this entry on the original dictionary page scan.
vidhānan. setting up (machines) View this entry on the original dictionary page scan.
vidhānan. creating, creation View this entry on the original dictionary page scan.
vidhānan. performance (especially of prescribed acts or rites), execution, making, doing, accomplishing etc. View this entry on the original dictionary page scan.
vidhānan. enumeration, statement of particulars View this entry on the original dictionary page scan.
vidhānan. (in dramatic language) conflict of different feelings, occasion for joy and sorrow View this entry on the original dictionary page scan.
vidhānan. (in gram.) affixing, prefixing, taking as an affix etc. View this entry on the original dictionary page scan.
vidhānan. an elephant's fodder etc. (only worship;wealth;wages;sending;act of hostility etc.) View this entry on the original dictionary page scan.
vidhānagam. "rule-goer", a Pandit, teacher View this entry on the original dictionary page scan.
vidhānagumpham. Name of work View this entry on the original dictionary page scan.
vidhānajñamfn. one who knows rules or precepts View this entry on the original dictionary page scan.
vidhānajñam. a teacher, Pandit View this entry on the original dictionary page scan.
vidhānakamfn. disposing, arranging, one who knows how to arrange
vidhānakan. ordinance, regulation, rule View this entry on the original dictionary page scan.
vidhānakan. distress, pain (equals vyathā-) View this entry on the original dictionary page scan.
vidhānakalpam. Name of work View this entry on the original dictionary page scan.
vidhānakhaṇḍamn. (?) Name of work View this entry on the original dictionary page scan.
vidhānamālāf. Name of work View this entry on the original dictionary page scan.
vidhānapārijātam. Name of work View this entry on the original dictionary page scan.
vidhānarahasyan. Name of work View this entry on the original dictionary page scan.
vidhānaratnan. Name of work View this entry on the original dictionary page scan.
vidhānaratnamālāf. Name of work View this entry on the original dictionary page scan.
vidhānasaptamīf. Name of the 7th day in the light half of māgha- View this entry on the original dictionary page scan.
vidhānasārasaṃgraham. Name of work View this entry on the original dictionary page scan.
vidhanatāf. poverty View this entry on the original dictionary page scan.
vidhānatasind. vidhāna
vidhānatilakan. Name of work View this entry on the original dictionary page scan.
vidhānayuktamfn. agreeable to rule or precept View this entry on the original dictionary page scan.
vidhanīkṛP. -karoti-, to impoverish View this entry on the original dictionary page scan.
vidhānoktamfn. proclaimed or enjoined according to rule or (sacred) precept View this entry on the original dictionary page scan.
vidhanus mfn. having no bow View this entry on the original dictionary page scan.
vidhanuṣkamfn. having no bow View this entry on the original dictionary page scan.
vidhanvanmfn. having no bow View this entry on the original dictionary page scan.
vidhāram. (prob.) a receptacle (others"running through", fr.1. dhāv-). View this entry on the original dictionary page scan.
vidharaṇa vi-dhartṛ- etc. See vi-dhṛ-. View this entry on the original dictionary page scan.
vidharaṇamf(ī-)n. checking, restraining View this entry on the original dictionary page scan.
vidhāraṇamf(ī-)n. dividing, separating View this entry on the original dictionary page scan.
vidhāraṇan. stopping, detaining (a carriage) View this entry on the original dictionary page scan.
vidhāraṇan. checking, restraining, retention, suppression, etc. View this entry on the original dictionary page scan.
vidhāraṇan. bearing, carrying etc. View this entry on the original dictionary page scan.
vidhāraṇan. maintaining, supporting
vidharaṇīf. maintaining, supporting View this entry on the original dictionary page scan.
vidhārayamfn. (prob.) disposing, arranging View this entry on the original dictionary page scan.
vidhārayitavyamfn. to be (or being) supported or maintained View this entry on the original dictionary page scan.
vidhārayitṛmfn. equals dhāraya- (used to explain vi-dhartṛ-) View this entry on the original dictionary page scan.
vidhārinmfn. checking, restraining View this entry on the original dictionary page scan.
vidharmamfn. (for 2.See vi-dhṛ-) wrong, unjust, unlawful (also maka-) View this entry on the original dictionary page scan.
vidharmamfn. devoid of attributes or qualities (equals nir-guṇa-,said of kṛṣṇa-) () View this entry on the original dictionary page scan.
vidharmam. wrong, injustice View this entry on the original dictionary page scan.
vidharmanmfn. (for 2.See vi-dhṛ-) acting wrongly or unlawfully View this entry on the original dictionary page scan.
vidharmanm. (for 1.See) a maintainer, arranger, disposer View this entry on the original dictionary page scan.
vidharmann. that which encircles or surrounds, receptacle, boundaries, circumference View this entry on the original dictionary page scan.
vidharmann. disposition, arrangement, order, rule View this entry on the original dictionary page scan.
vidharmann. Name of a sāman- View this entry on the original dictionary page scan.
vidharmasthamfn. "abiding in wrong", unjust View this entry on the original dictionary page scan.
vidharmatasind. wrongly, unlawfully View this entry on the original dictionary page scan.
vidharmika varia lectio for -dharmaka- (See above) . View this entry on the original dictionary page scan.
vidharminmfn. transgressing the law (as speech) View this entry on the original dictionary page scan.
vidharminmfn. of a different kind View this entry on the original dictionary page scan.
vidhartṛm. a distributer, arranger, supporter View this entry on the original dictionary page scan.
vidhasm. equals vedhas- or brahman- View this entry on the original dictionary page scan.
vidhātāf. equals madya- View this entry on the original dictionary page scan.
vidhātavyamfn. to be fixed or settled View this entry on the original dictionary page scan.
vidhātavyamfn. to be got or procured View this entry on the original dictionary page scan.
vidhātavyamfn. to be performed or accomplished or exhibited etc. View this entry on the original dictionary page scan.
vidhātavyamfn. to be striven after or cared for View this entry on the original dictionary page scan.
vidhātavyan. impersonal or used impersonally with yathā-,"care must be taken that" View this entry on the original dictionary page scan.
vidhātavyan. to be used or employed or appointed View this entry on the original dictionary page scan.
vidhātṛmf(trī-)n. distributing. arranging, disposing etc. View this entry on the original dictionary page scan.
vidhātṛm. a distributer, disposer, arranger, accomplisher, maker, author, creator etc. View this entry on the original dictionary page scan.
vidhātṛm. a granter, giver, bestower View this entry on the original dictionary page scan.
vidhātṛm. Name of brahmā- (as the creator of the world and disposer of men's fate, sometimes in plural equals prajā-pati- exempli gratia, 'for example' ;sometimes vi-dhātṛ- is mentioned together with dhātṛ- exempli gratia, 'for example' ;both are supposed to be the sons of brahmā-[ ]or of bhṛgu-[ ];in vidhātṛ- is the regent of the 2nd tithi-, while brahmā- presides over the first) etc. View this entry on the original dictionary page scan.
vidhātṛm. Fate or Destiny (personified) View this entry on the original dictionary page scan.
vidhātṛm. Name of viṣṇu- View this entry on the original dictionary page scan.
vidhātṛm. of śiva- View this entry on the original dictionary page scan.
vidhātṛm. of kāma- (god of love) View this entry on the original dictionary page scan.
vidhātṛm. of viśva-karman- View this entry on the original dictionary page scan.
vidhātṛf. (trī-) See below View this entry on the original dictionary page scan.
vidhātrāyusm. the sunflower View this entry on the original dictionary page scan.
vidhātṛbhūm. "son of brahmā-", Name of nārada- View this entry on the original dictionary page scan.
vidhātrīf. a female creator, mother of (compound), View this entry on the original dictionary page scan.
vidhātṛkāf. (used to explain vidhavā-) View this entry on the original dictionary page scan.
vidhātṛvaśātind. from the will of brahmā-, through the power of destiny View this entry on the original dictionary page scan.
vidhautamfn. cleansed by washing View this entry on the original dictionary page scan.
vidhāvP. -dhāvati-, to run or flow off, trickle through ; to flow away, disappear ; to run away, be scattered or dispersed ; to run between (antar-,said of a road) ; to run through, perambulate ; to rush upon (Aorist vy-adhāviṣṭa- varia lectio vyabādhiṣṭa-). View this entry on the original dictionary page scan.
vidhāv(only Pass.pf. -dadhāvire-), to wash off View this entry on the original dictionary page scan.
vidhavain compound for - below. View this entry on the original dictionary page scan.
vidhavāf. (according to to some fr. vi-+ dhava-See 2. dhav/a-,p.513) a husbandless woman, widow (also with nārī-, yoṣit-, strī-etc.) etc. View this entry on the original dictionary page scan.
vidhavāf. bereft of a king (a country) [ confer, compare Greek ; Latin vidua; Gothic widuwo7; German wituwa,witewe,Witwe; Anglo-Saxon wuduwe,widewe; English widow.] View this entry on the original dictionary page scan.
vidhavaNom. (fr. 1. vidhu-) P. vati-, to resemble the moon View this entry on the original dictionary page scan.
vidhavādharmam. "duty of a widow", Name of chapter of the View this entry on the original dictionary page scan.
vidhavāgāminm. one who has intercourse with a widow View this entry on the original dictionary page scan.
vidhavanaSee under vi-dhū-. View this entry on the original dictionary page scan.
vidhāvanan. running hither and thither View this entry on the original dictionary page scan.
vidhavanan. shaking off View this entry on the original dictionary page scan.
vidhavanan. agitation, trembling View this entry on the original dictionary page scan.
vidhavāstrīf. a widow View this entry on the original dictionary page scan.
vidhavatāf. widowhood View this entry on the original dictionary page scan.
vidhavāvedana(v-) n. marrying a widow View this entry on the original dictionary page scan.
vidhavāvivāham. "marrying a widow", Name of work View this entry on the original dictionary page scan.
vidhavāvivāhakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
vidhavāvivāhavicāram. Name of work View this entry on the original dictionary page scan.
vidhavayoṣitf. a widow View this entry on the original dictionary page scan.
vidhāvitamfn. run in different directions, dispersed View this entry on the original dictionary page scan.
vidhavyan. agitation, trembling, tremor View this entry on the original dictionary page scan.
vidhāvyan. shaking, agitation View this entry on the original dictionary page scan.
vidhāyakamfn. enjoining, containing an injunction View this entry on the original dictionary page scan.
vidhāyakamfn. performing, exhibiting View this entry on the original dictionary page scan.
vidhāyakamfn. consigning, delivering, one who entrusts or deposits anything ( vidhāyakatva -tva- n.) View this entry on the original dictionary page scan.
vidhāyakam. a founder, builder, establisher View this entry on the original dictionary page scan.
vidhāyakatvan. vidhāyaka
vidhāyinmfn. regulating, prescribing, containing an injunction or ordinance with regard to (compound) View this entry on the original dictionary page scan.
vidhāyinmfn. performing, accomplishing View this entry on the original dictionary page scan.
vidhāyinmfn. causing, occasioning View this entry on the original dictionary page scan.
vidhāyinmfn. placing, fixing, securing View this entry on the original dictionary page scan.
vidhāyinmfn. delivering, entrusting View this entry on the original dictionary page scan.
vidhāyinm. a founder, builder, establisher View this entry on the original dictionary page scan.
viḍhḍhala varia lectio for viṭṭhala- q.v View this entry on the original dictionary page scan.
vidheyamfn. to be bestowed or procured View this entry on the original dictionary page scan.
vidheyamfn. to be used or employed (a-vidh-) View this entry on the original dictionary page scan.
vidheyamfn. to be (or being) enjoined (as a rule) View this entry on the original dictionary page scan.
vidheyamfn. to be stated or settled or established View this entry on the original dictionary page scan.
vidheyamfn. to be performed or practised or done etc. View this entry on the original dictionary page scan.
vidheyamfn. to be drawn (as a line) View this entry on the original dictionary page scan.
vidheyamfn. to be kindled (as fire) View this entry on the original dictionary page scan.
vidheyamfn. to be exhibited or displayed or shown or betrayed View this entry on the original dictionary page scan.
vidheyamfn. docile, compliant, submissive, liable to be ruled or governed or influenced by, subject or obedient to (genitive case or compound) etc. View this entry on the original dictionary page scan.
vidheyamfn. (in fine compositi or 'at the end of a compound') subdued or overcome by View this entry on the original dictionary page scan.
vidheyan. what is to be done, duty, necessity View this entry on the original dictionary page scan.
vidheyajñamfn. knowing what ought to be done View this entry on the original dictionary page scan.
vidheyamārgam. the seeking to do a necessary act View this entry on the original dictionary page scan.
vidheyapadan. an object to be accomplished View this entry on the original dictionary page scan.
vidheyatāf. fitness to be (or"state of being") prescribed or enjoined, (opp. to niṣiddha--) View this entry on the original dictionary page scan.
vidheyatāf. docility, submission View this entry on the original dictionary page scan.
vidheyātmanmfn. having the soul (well) subdued or controlled View this entry on the original dictionary page scan.
vidheyatvan. applicability, usefulness View this entry on the original dictionary page scan.
vidheyatvan. dependency, submission View this entry on the original dictionary page scan.
vidheyatvan. necessity of being established or stated View this entry on the original dictionary page scan.
vidheyavartinmfn. submissive to another's will, obedient View this entry on the original dictionary page scan.
vidheyīin compound for dheya-. View this entry on the original dictionary page scan.
vidheyībhuyaind. (in fine compositi or 'at the end of a compound') submissive or subject to View this entry on the original dictionary page scan.
vidheyīkṛtamfn. subdued or subject to another's will, dependent View this entry on the original dictionary page scan.
vidhim. (for 2.See) a worshipper, one who does homage View this entry on the original dictionary page scan.
vidhim. (for 1.See) a rule, formula, injunction, ordinance, statute, precept, law, direction (especially for the performance of a rite as given in the brāhmaṇa- portion of the veda-, which according to to consists of two parts, 1. vidhi-,"precepts or commandments" exempli gratia, 'for example' yajeta-,"he ought to sacrifice", kuryāt-,"he ought to perform";2. artha-vāda-, "explanatory statements"as to the origin of rites and use of the mantra-s, mixed up with legends and illustrations) etc. (see ) View this entry on the original dictionary page scan.
vidhim. a grammatical rule or precept View this entry on the original dictionary page scan.
vidhim. any prescribed act or rite or ceremony View this entry on the original dictionary page scan.
vidhim. use, employment, application View this entry on the original dictionary page scan.
vidhim. method, manner or way of acting, mode of life, conduct, behaviour etc. View this entry on the original dictionary page scan.
vidhim. a means, expedient for (dative case locative case,or compound; adhvavidhinā-,by means of id est along the road) View this entry on the original dictionary page scan.
vidhim. any act or action, performance, accomplishment, contrivance, work, business (in fine compositi or 'at the end of a compound' often pleonastically exempli gratia, 'for example' mathana-vidhi-,the [act of] disturbing) etc. View this entry on the original dictionary page scan.
vidhim. creation (also plural) View this entry on the original dictionary page scan.
vidhim. fate, destiny etc. View this entry on the original dictionary page scan.
vidhim. the creator View this entry on the original dictionary page scan.
vidhim. Name of brahmā- View this entry on the original dictionary page scan.
vidhim. of viṣṇu- View this entry on the original dictionary page scan.
vidhim. of agni- at the prāyaścitta- View this entry on the original dictionary page scan.
vidhim. a physician time View this entry on the original dictionary page scan.
vidhim. fodder, food for elephants or horses View this entry on the original dictionary page scan.
vidhif. Name of a goddess View this entry on the original dictionary page scan.
vidhī(or dīdhī-,only subjunctive -dīdhayaḥ-and -dīdhyaḥ-), to be uncertain, hesitate View this entry on the original dictionary page scan.
vidhibhūṣaṇan. Name of work View this entry on the original dictionary page scan.
vidhidarśaka m. "rule-shower", a priest who sees that a sacrifice is conducted according to prescribed rules and corrects any derivation from them View this entry on the original dictionary page scan.
vidhidarśinm. "rule-shower", a priest who sees that a sacrifice is conducted according to prescribed rules and corrects any derivation from them View this entry on the original dictionary page scan.
vidhideśakam. equals -darśaka- View this entry on the original dictionary page scan.
vidhidṛṣṭamfn. prescribed by rule View this entry on the original dictionary page scan.
vidhidvaidhan. diversity of rule, variance of rite View this entry on the original dictionary page scan.
vidhighnamfn. "rule-destroying", one who deviates from or disregards rules or disturbs modes of proceeding. View this entry on the original dictionary page scan.
vidhihīnamfn. destitute of rule, unauthorised, irregular
vidhijñamfn. "rule-knowing", one who knows the prescribed mode or form View this entry on the original dictionary page scan.
vidhijñamfn. learned in ritual View this entry on the original dictionary page scan.
vidhijñam. a Brahman who knows the ritual View this entry on the original dictionary page scan.
vidhikaramf(ī-)n. executing commands View this entry on the original dictionary page scan.
vidhikaram. a servant View this entry on the original dictionary page scan.
vidhikṛtmfn. or m. idem or 'm. a servant ' View this entry on the original dictionary page scan.
vidhilopam. transgression of a commandment View this entry on the original dictionary page scan.
vidhilopakamfn. transgressing commandment View this entry on the original dictionary page scan.
vidhimantrapuraskṛtamind. in accordance with rule and with the due recitation of mantra-s or mystical texts View this entry on the original dictionary page scan.
vidhinirūpaṇan. Name of work View this entry on the original dictionary page scan.
vidhiniṣedhatāf. the being precept and prohibition View this entry on the original dictionary page scan.
vidhiparyāgatamfn. come into possession through destiny View this entry on the original dictionary page scan.
vidhiprasaṅgam. idem or 'm. the application of a rule, acting according to rule ' View this entry on the original dictionary page scan.
vidhiprayogam. the application of a rule, acting according to rule View this entry on the original dictionary page scan.
vidhiprayuktamfn. performed according to rule View this entry on the original dictionary page scan.
vidhipūrvakam( ) ( ) ind. according to rule, duly. View this entry on the original dictionary page scan.
vidhipūrvam( ) ind. according to rule, duly. View this entry on the original dictionary page scan.
vidhiputram. Name of nārada- View this entry on the original dictionary page scan.
vidhirasāyanan. Name of work View this entry on the original dictionary page scan.
vidhirasāyanadūṣaṇan. Name of work View this entry on the original dictionary page scan.
vidhirasāyanasukhopajīvif. Name of work View this entry on the original dictionary page scan.
vidhirasāyanasukhopayoginīf. Name of work View this entry on the original dictionary page scan.
vidhirasāyanavyākhyāf. Name of work View this entry on the original dictionary page scan.
vidhiratnan. Name of various works. View this entry on the original dictionary page scan.
vidhiratnakṛtm. Name of an author View this entry on the original dictionary page scan.
vidhiratnamālāf. Name of work View this entry on the original dictionary page scan.
vidhirūpanirūpaṇan. Name of work View this entry on the original dictionary page scan.
vidhisāram. Name of a king (wrong reading for bimbi-s-). View this entry on the original dictionary page scan.
vidhiṣedha(only vidhiṣedhatas -tas- ind.), commandment and prohibition View this entry on the original dictionary page scan.
vidhiṣedhatasind. vidhiṣedha
vidhiśoṇitīyamfn. treating of the blood in its normal state View this entry on the original dictionary page scan.
vidhisudhākaram. Name of work View this entry on the original dictionary page scan.
vidhisvarūpavādārtham. Name of work View this entry on the original dictionary page scan.
vidhisvarūpavicāram. Name of work View this entry on the original dictionary page scan.
vidhitasind. according to rule View this entry on the original dictionary page scan.
vidhitrayaparitrānan. Name of work View this entry on the original dictionary page scan.
vidhitsāf. intention to do, intention, design, purpose, desire for (compound) etc. View this entry on the original dictionary page scan.
vidhitsāf. the wish to make or turn into (compound) View this entry on the original dictionary page scan.
vidhitsamānamfn. (fr. Desiderative) wishing to distribute or bestow etc. View this entry on the original dictionary page scan.
vidhitsamānamfn. intending to do, scheming, planning, interested, selfish View this entry on the original dictionary page scan.
vidhitsitamfn. intended View this entry on the original dictionary page scan.
vidhitsitan. intention, purpose View this entry on the original dictionary page scan.
vidhitsumfn. wishing to do or make, purposing to perform (accusative) View this entry on the original dictionary page scan.
vidhitvan. the state of being a rule View this entry on the original dictionary page scan.
vidhivādam. Name of work View this entry on the original dictionary page scan.
vidhivādārtham. idem or 'm. idem or 'm. Name of work ' ' View this entry on the original dictionary page scan.
vidhivādavicāram. idem or 'm. Name of work ' View this entry on the original dictionary page scan.
vidhivadhūf. "wife of brahmā-", sarasvatī- View this entry on the original dictionary page scan.
vidhivaśātind. through the power of fate or destiny View this entry on the original dictionary page scan.
vidhivatind. according to rule, duly View this entry on the original dictionary page scan.
vidhivicāram. Name of work View this entry on the original dictionary page scan.
vidhivihitamfn. established by rule View this entry on the original dictionary page scan.
vidhiviparyayam. contrariety of fate, misfortune View this entry on the original dictionary page scan.
vidhivivekam. Name of work View this entry on the original dictionary page scan.
vidhiyajñam. a sacrifice performed according to rule View this entry on the original dictionary page scan.
vidhiyajñam. a ceremonial act of worship View this entry on the original dictionary page scan.
vidhiyogam. the observance of a rule View this entry on the original dictionary page scan.
vidhiyogam. dispensation of fate (equals vidhiyogāt gāt- ind.or vidhiyogatas -tas- ind.according to the ruling of fate) View this entry on the original dictionary page scan.
vidhiyogam. combining for any act or rite View this entry on the original dictionary page scan.
vidhiyogātind. vidhiyoga
vidhiyogatasind. vidhiyoga
vidhmāSee vi-dham-, p.967. View this entry on the original dictionary page scan.
vidhmāpanamfn. (fr. Causal) scattering, dispersing View this entry on the original dictionary page scan.
vidhṛP. A1. -dharati-, te- (only perfect tense -dadhāra-), to hold, bear, carry : Causal -dhārayati- (rarely te-;Ved. infinitive mood -dhart/ari-), to keep asunder or apart, separate, divide, distribute ; to arrange, manage, contrive ; to keep off, withhold from (ablative) ; to lay hold of, seize, hold fast ; to check, restrain ; to support, maintain ; (with vapūṃṣi-) to possess or have bodies ; (with manas-) to keep the mind fixed upon (locative case) ; to preserve, take care of : Intensive (only imperfect tense vy-/adardhar-) to divide, separate View this entry on the original dictionary page scan.
vidhṛṣCaus. -dharṣayati-, to violate, spoil, injure, annoy, trouble View this entry on the original dictionary page scan.
vidhṛṣṭif. (in a formula) View this entry on the original dictionary page scan.
vidhṛtamfn. kept asunder, divided, separated etc. View this entry on the original dictionary page scan.
vidhṛtamfn. kept off, avoided View this entry on the original dictionary page scan.
vidhṛtamfn. stopped, checked, suppressed, restrained etc. View this entry on the original dictionary page scan.
vidhṛtamfn. held, borne (with śirasā-, mūrdhnā-or dhni-,borne on the head id est highly esteemed;with svodareṇa-,borne in one's own body) View this entry on the original dictionary page scan.
vidhṛtamfn. held, possessed View this entry on the original dictionary page scan.
vidhṛtamfn. saved, preserved View this entry on the original dictionary page scan.
vidhṛtamfn. (with antare-) pledged View this entry on the original dictionary page scan.
vidhṛtan. wrong reading for vi-dhūta- (q.v) View this entry on the original dictionary page scan.
vidhṛtāyudhamfn. holding weapons View this entry on the original dictionary page scan.
vidhṛtif. (v/i--) separation, division, partition, arrangement, regulation View this entry on the original dictionary page scan.
vidhṛtif. keeping away View this entry on the original dictionary page scan.
vidhṛtif. anything that separates or divides, a boundary-line, barrier View this entry on the original dictionary page scan.
vidhṛtif. Name of two blades of grass which indicate a boundary-line between barhis- and prastara- View this entry on the original dictionary page scan.
vidhṛtim. a particular sattra- View this entry on the original dictionary page scan.
vidhṛtim. Name of a particular divine being View this entry on the original dictionary page scan.
vidhṛtim. of a king View this entry on the original dictionary page scan.
vidhuSee . View this entry on the original dictionary page scan.
vidhumfn. (prob. fr.2. vidh-;for 2. vi-dh/u-See vi-dhū-, column 3) lonely, solitary (applied to the moon; according to to equals vi-dhātṛ-, vi-dhārayitṛ-) View this entry on the original dictionary page scan.
vidhum. the moon View this entry on the original dictionary page scan.
vidhum. ( also, "camphor;Name of brahmā- and of viṣṇu-;a rākṣasa-;wind;an expiatory oblation;time; equals āyudha-") View this entry on the original dictionary page scan.
vidhum. Name of a prince (varia lectio vipra-). View this entry on the original dictionary page scan.
vidhūP. A1. -dhūnoti-, -dhūnute- (later also -dhunoti-, -dhunute-; infinitive mood -dhavitum-,or -dhotum-), to shake about, move to and fro, agitate, toss about (A1.also "one's self") etc. ; to fan, kindle (fire) ; to shake off, drive away, scatter, disperse, remove, destroy etc. ; (A1.) to shake off from one's self, relinquish, abandon, give up etc.: Passive voice -dhūyate- (Epic also ti-), to be shaken or agitated : Causal -dhūnayati-, to cause to shake about etc. ; to shake violently, agitate, harass, annoy View this entry on the original dictionary page scan.
vidhum. (for 1.See column 2) palpitation, throbbing (of the heart) View this entry on the original dictionary page scan.
vidhudinan. a lunar day View this entry on the original dictionary page scan.
vidhuguptim. Name of a man View this entry on the original dictionary page scan.
vidhukrāntam. (in music) a kind of measure View this entry on the original dictionary page scan.
vidhukṣayam. the wane of the moon, the dark nights of the month View this entry on the original dictionary page scan.
vidhūmamf(ā-)n. smokeless, not smoking (said of fire) etc. ( vidhūme me- ind.when no smoke is seen ) View this entry on the original dictionary page scan.
vidhūmam. Name of a vasu- View this entry on the original dictionary page scan.
vidhumaṇḍalan. the moon's disc View this entry on the original dictionary page scan.
vidhumāsam. a lunar month View this entry on the original dictionary page scan.
vidhumayamf(ī-)n. consisting of moons View this entry on the original dictionary page scan.
vidhūmeind. vidhūma
vidhūmramfn. quite grey View this entry on the original dictionary page scan.
vidhuṃtudam. "moon-troubler", Name of rāhu- or the personified ascending node (causing the moon's eclipses) View this entry on the original dictionary page scan.
vidhumukhī f. a moon-faced woman View this entry on the original dictionary page scan.
vidhunanan. equals dhūnana- View this entry on the original dictionary page scan.
vidhūnanamf(ī-)n. (fr. Causal) causing to move to and fro View this entry on the original dictionary page scan.
vidhūnanan. shaking, agitation View this entry on the original dictionary page scan.
vidhūnanan. waving, undulating View this entry on the original dictionary page scan.
vidhūnanan. repugnance, repulsion (as of love) View this entry on the original dictionary page scan.
vidhūnitamfn. shaken, agitated, harassed, annoyed View this entry on the original dictionary page scan.
vidhūpP. -dhūpāyati-, to emit vapour, smoke ; Passive voice -dhūpyate- idem or 'mfn. shaken, agitated, harassed, annoyed ' View this entry on the original dictionary page scan.
vidhūpamfn. without perfume or incense View this entry on the original dictionary page scan.
vidhupañjaram. a scimitar, sabre View this entry on the original dictionary page scan.
vidhuparidhvaṃsam. distress id est eclipse of the moon, View this entry on the original dictionary page scan.
vidhupriyāf. "dear to the moon", a lunar mansion or nakṣatra- (personified as a nymph, the daughter of dakṣa- and wife of the Moon) View this entry on the original dictionary page scan.
vidhuramf(ā-)n. destitute of a shaft (as a carriage) (perhaps"damaged"= vidhura-2See sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
vidhuraSee . View this entry on the original dictionary page scan.
vidhuramf(ā-)n. (for 1.See) bereft, bereaved (especially of any loved person) , alone, solitary
vidhuramf(ā-)n. (in fine compositi or 'at the end of a compound') separated from, destitute of, wanting View this entry on the original dictionary page scan.
vidhuramf(ā-)n. suffering from want, miserable, helpless, distressed etc. View this entry on the original dictionary page scan.
vidhuramf(ā-)n. perplexed, troubled, depressed, dejected ( vidhuram am- ind.) View this entry on the original dictionary page scan.
vidhuramf(ā-)n. adverse, unfavourable, hostile View this entry on the original dictionary page scan.
vidhuram. a rākṣasa- View this entry on the original dictionary page scan.
vidhuram. a widower View this entry on the original dictionary page scan.
vidhurāf. curds mixed with sugar and spices View this entry on the original dictionary page scan.
vidhuran. adversity, calamity, distress ( also equals viśleṣa-, praviśleṣa-or pariśleṣa-) View this entry on the original dictionary page scan.
vidhuran. dual number Name of two particular joints of the body View this entry on the original dictionary page scan.
vidhuradarśanan. the sight of anything alarming, agitation, uneasiness View this entry on the original dictionary page scan.
vidhuramind. vidhura
vidhuratāf. View this entry on the original dictionary page scan.
vidhuratvan. want, trouble, distress View this entry on the original dictionary page scan.
vidhurayaNom. P. yati-, to put in a miserable condition, deject, depress View this entry on the original dictionary page scan.
vidhurīkṛtamfn. dejected, distressed View this entry on the original dictionary page scan.
vidhuritamfn. dejected, depressed View this entry on the original dictionary page scan.
vidhuritan. plural adversities, calamities View this entry on the original dictionary page scan.
vidhūsaramfn. "dust-coloured", grey View this entry on the original dictionary page scan.
vidhutamfn. shaken about or off, dispersed, removed, abandoned, relinquished View this entry on the original dictionary page scan.
vidhūtamfn. shaken or tossed about etc. View this entry on the original dictionary page scan.
vidhūtamfn. shaken off, dispelled, removed, discarded, abandoned, relinquished etc. View this entry on the original dictionary page scan.
vidhūtamfn. trembling, tremulous View this entry on the original dictionary page scan.
vidhūtamfn. unsteady View this entry on the original dictionary page scan.
vidhūtan. the repelling of affection, repugnance View this entry on the original dictionary page scan.
vidhutabandhanamfn. released from bonds View this entry on the original dictionary page scan.
vidhūtakalmaṣamfn. having sin dispelled or removed, delivered from sin View this entry on the original dictionary page scan.
vidhūtakeśamfn. having hair tossed about or dishevelled View this entry on the original dictionary page scan.
vidhutamārtyamfn. one who has shaken off what is human or corporeal View this entry on the original dictionary page scan.
vidhūtanidramfn. roused from sleep, awakened (varia lectio vinīta-n-) View this entry on the original dictionary page scan.
vidhutapakṣamfn. shaking one's wings View this entry on the original dictionary page scan.
vidhūtapapmanmfn. delivered from evil or sin View this entry on the original dictionary page scan.
vidhutatriliṅgamfn. liberated from the three qualities View this entry on the original dictionary page scan.
vidhūtaveśamfn. shaking one's garment View this entry on the original dictionary page scan.
vidhutif. shaking, agitating, tossing about View this entry on the original dictionary page scan.
vidhutif. removal, destruction View this entry on the original dictionary page scan.
vidhūtif. shaking or tossing about View this entry on the original dictionary page scan.
vidhūtif. tremor, agitation View this entry on the original dictionary page scan.
vidhutvan. the state or condition of (being) the moon View this entry on the original dictionary page scan.
vidhuvadanāf. a moon-faced woman View this entry on the original dictionary page scan.
vidhuvanan. trembling, tremor View this entry on the original dictionary page scan.
vidhvaṃs(or dhvas-) A1. -dhvaṃsate- (rarely ti-), to fall to pieces, crumble into dust or powder, be scattered or dispersed or destroyed, perish etc. etc.: Causal -dhvaṃsayati- (ind.p. -dhvaṃsya-,or -dhvasya-), to cause to fall to pieces or crumble, dash to pieces, crush, destroy, annihilate etc. ; to hurt, injure View this entry on the original dictionary page scan.
vidhvaṃsam. ruin, destruction, hurt, injury etc. View this entry on the original dictionary page scan.
vidhvaṃsam. cessation (of a disease) View this entry on the original dictionary page scan.
vidhvaṃsam. insult, offence View this entry on the original dictionary page scan.
vidhvaṃsam. violation (of a woman) View this entry on the original dictionary page scan.
vidhvaṃsakam. a debaucher, violator (of a woman) View this entry on the original dictionary page scan.
vidhvaṃsanamfn. causing to fall, ruining, destroying, removing View this entry on the original dictionary page scan.
vidhvaṃsanan. the act of causing to fall etc. View this entry on the original dictionary page scan.
vidhvaṃsanan. insulting, violating (a woman) View this entry on the original dictionary page scan.
vidhvaṃsinmfn. falling to pieces, perishing View this entry on the original dictionary page scan.
vidhvaṃsinmfn. causing to fall, ruining, destroying etc. View this entry on the original dictionary page scan.
vidhvaṃsinmfn. insulting, violating (a woman) View this entry on the original dictionary page scan.
vidhvaṃsinmfn. hostile, adverse View this entry on the original dictionary page scan.
vidhvaṃsinīf. a particular magical formula View this entry on the original dictionary page scan.
vidhvaṃsitamfn. (fr. Causal) dashed or broken to pieces, destroyed View this entry on the original dictionary page scan.
vidhvastamfn. fallen asunder, fallen to pieces, dispersed, ruined, destroyed etc. View this entry on the original dictionary page scan.
vidhvastamfn. whirled up (as dust) View this entry on the original dictionary page scan.
vidhvastamfn. (in astronomy) darkened obscured, eclipsed View this entry on the original dictionary page scan.
vidhvastakavacamfn. one whose armour is destroyed View this entry on the original dictionary page scan.
vidhvastanagarāśramamfn. containing ruined cities and hermitages View this entry on the original dictionary page scan.
vidhvastaparaguṇamfn. one who detracts from the merits of another View this entry on the original dictionary page scan.
vidhvastatāf. ruin, destruction View this entry on the original dictionary page scan.
vidhvastavipaṇāpaṇamfn. (a town) whose market and trade are ruined View this entry on the original dictionary page scan.
vidhyin compound before vowels for 2. vidhi-. View this entry on the original dictionary page scan.
vidhyamfn. (from vyadh-) to be pierced or perforated, View this entry on the original dictionary page scan.
vidhyādim. the commencement of an action View this entry on the original dictionary page scan.
vidhyalaṃkāram. a kind of rhetorical figure View this entry on the original dictionary page scan.
vidhyalaṃkriyāf. a kind of rhetorical figure View this entry on the original dictionary page scan.
vidhyantam. a concluding act View this entry on the original dictionary page scan.
vidhyantatvan. View this entry on the original dictionary page scan.
vidhyaparādham. transgression of a rule View this entry on the original dictionary page scan.
vidhyaparādhaprāyaścittan. Name of work View this entry on the original dictionary page scan.
vidhyaparādhaprāyaścittaprayogam. Name of work View this entry on the original dictionary page scan.
vidhyaparādhaprāyaścittasūtran. Name of work View this entry on the original dictionary page scan.
vidhyapāśrayam. adherence to a rule View this entry on the original dictionary page scan.
vidhyātmakamfn. consisting of a positive injunction (opp. to pratiṣedhātm-) View this entry on the original dictionary page scan.
vidīdhayuSee a-v-. View this entry on the original dictionary page scan.
vidīdhitimfn. rayless View this entry on the original dictionary page scan.
vidīgayam. a species of gallinaceous bird (= śveta-baka- Scholiast or Commentator) View this entry on the original dictionary page scan.
vidikcaṅgam. a sort of yellow bird View this entry on the original dictionary page scan.
viḍīnan. ( ḍī-) the act of flying aslant or obliquely (one of the different modes of flight attributed to birds;others being ava--, uḍ--, ni--, pari--, pra--, saṃ-ḍīna-,and ḍīna-ḍīnaka- q.v) View this entry on the original dictionary page scan.
viḍīnakan. flying apart View this entry on the original dictionary page scan.
viḍināthakavim. (also written viḷi-n-) Name of an author View this entry on the original dictionary page scan.
vidīp(only A1. imperfect tense vy-adīpanta-), to shine forth, shine very brightly : Causal -dīpayati-, to shine upon, illuminate View this entry on the original dictionary page scan.
vidīpakam. a lantern (Calcutta edition f(ikā-).) View this entry on the original dictionary page scan.
vidīpitamfn. (fr. Causal) illuminated, bright View this entry on the original dictionary page scan.
vidīpitamfn. inflamed, incensed View this entry on the original dictionary page scan.
vidīptamfn. shining, bright View this entry on the original dictionary page scan.
vidīptatejasmfn. of bright splendour View this entry on the original dictionary page scan.
vidīrṇaSee under vi-dṝ-. View this entry on the original dictionary page scan.
vidīrṇamfn. rent asunder, torn, split, broken, wounded, burst open, ripped up, expanded, opened etc. View this entry on the original dictionary page scan.
vidīrṇahṛdayamfn. broken-hearted View this entry on the original dictionary page scan.
vidīrṇamukhamfn. open-mouthed View this entry on the original dictionary page scan.
vidiśf. an intermediate point of the compass (as south east) etc. View this entry on the original dictionary page scan.
vidiśmfn. going into different quarters or regions View this entry on the original dictionary page scan.
vidiśāf. an intermediate quarter or region View this entry on the original dictionary page scan.
vidiśāf. Name of a river and the town situated on it (the capital of the district of Dasarna now called Bilsa) etc. View this entry on the original dictionary page scan.
vidiśāf. of a town situated on the vetravatī- View this entry on the original dictionary page scan.
viditamfn. known, understood, learnt, perceived, known as (Nominal verb) etc. (viditam astu vaḥ-or astu vo viditam-,"let it be understood by you","know that") View this entry on the original dictionary page scan.
viditamfn. promised, agreed View this entry on the original dictionary page scan.
viditamfn. represented View this entry on the original dictionary page scan.
viditamfn. apprised, informed View this entry on the original dictionary page scan.
viditam. a learned man, sage View this entry on the original dictionary page scan.
viditāf. Name of a jaina- goddess View this entry on the original dictionary page scan.
viditan. information, representation View this entry on the original dictionary page scan.
vidivP. A1. -dīvyati-, te-, to lose at play ; to play View this entry on the original dictionary page scan.
viḍjamfn. produced from ordure View this entry on the original dictionary page scan.
viḍjan. a fungus View this entry on the original dictionary page scan.
viḍlavaṇan. a medicinal salt (commonly called Vitlaban or Bitnoben) View this entry on the original dictionary page scan.
vidmann. knowledge, intelligence, wisdom (dative case vidm/ane-as Vedic or Veda infinitive mood to know, to learn) View this entry on the original dictionary page scan.
vidmanamfn. (fr. prec.) View this entry on the original dictionary page scan.
vidmanāpasmfn. (fr. instrumental case of vidman-,+ apas-) working skilfully or carefully View this entry on the original dictionary page scan.
vidoham. "wrong or excessive milking", taking too much profit out of anything View this entry on the original dictionary page scan.
vidohamfn. false or excessive milking out or exploiting View this entry on the original dictionary page scan.
vidohaSee . View this entry on the original dictionary page scan.
viḍojasor viḍ-aujas- m. (also written biḍ-;said to be fr. viḍ-= viś-2+ ojas-) Name of indra- (in as two words, meaning"the vaiśya- and his trade") .
vidoṣam. a fault, sin, offence View this entry on the original dictionary page scan.
vidoṣaSee column 1. View this entry on the original dictionary page scan.
vidṝP. -dṛṇāti-, to tear asunder or to pieces, lacerate etc. ; to cleave, open (Aorist subjunctive -darṣasi-) : Passive voice -dīryate- (Epic also ti-), to be torn or rent asunder, split open etc. ; to be torn with grief or anguish : Causal -dārayati-, to cause to burst asunder, rend or tear to pieces, lacerate etc. ; to open ; to scatter, disperse ; to push away : Intensive -dardarīti-, to tear or split in pieces, burst asunder, open View this entry on the original dictionary page scan.
vidran. (prob. invented to explain vi-dradhi-) = chidra-, a hole, chasm View this entry on the original dictionary page scan.
vidradhamf(ā-)n. (of doubtful origin and meaning) ( equals viddha-; durga- equals vikuṣitādho-bhāga- equals vi-dṛḍha-;others = undressed, naked, fr. vi-+ dradha- equals dradhas-) View this entry on the original dictionary page scan.
vidradham. a kind of disease (equals vi-dradhi-) View this entry on the original dictionary page scan.
vidradhif. (said to be fr. vi-+ dṝ-; according to to others fr. vidra-+ dhā-) an abscess (especially when deep-seated or internal) etc. (dhī- ) View this entry on the original dictionary page scan.
vidradhināśanam. "abscess-destroyer", Hyperanthera Moringa View this entry on the original dictionary page scan.
vidradradhikāf. a kind of abscess (which accompanies diabetes) View this entry on the original dictionary page scan.
vidrai(or drā-,only A1. pr.p. -drāṇa-), to awake from sleep View this entry on the original dictionary page scan.
vidraṣṭṛmfn. seeing clearly or distinctly View this entry on the original dictionary page scan.
vidravam. running asunder or away, flight etc. View this entry on the original dictionary page scan.
vidravam. panic, agitation etc. View this entry on the original dictionary page scan.
vidravam. flowing out, oozing View this entry on the original dictionary page scan.
vidravam. melting, liquefaction View this entry on the original dictionary page scan.
vidravam. censure, reproach View this entry on the original dictionary page scan.
vidravam. intellect, understanding View this entry on the original dictionary page scan.
vidrāvam. flight, retreat View this entry on the original dictionary page scan.
vidrāvam. liquefaction View this entry on the original dictionary page scan.
vidrāvakamfn. driving away View this entry on the original dictionary page scan.
vidrāvakamfn. causing to melt, liquefying View this entry on the original dictionary page scan.
vidravaṇan. running away View this entry on the original dictionary page scan.
vidrāvaṇamfn. putting to flight View this entry on the original dictionary page scan.
vidrāvaṇamfn. agitating, perplexing View this entry on the original dictionary page scan.
vidrāvaṇam. Name of a dānava- View this entry on the original dictionary page scan.
vidrāvaṇan. the act of putting to flight View this entry on the original dictionary page scan.
vidrāvaṇan. fleeing, flight View this entry on the original dictionary page scan.
vidrāvinmfn. running away, fleeing, escaping View this entry on the original dictionary page scan.
vidrāvinmfn. (?) putting to flight, defeating (See vajra-vidrāviṇī-). View this entry on the original dictionary page scan.
vidrāvitamfn. caused to disperse, driven away, defeated, routed R View this entry on the original dictionary page scan.
vidrāvitamfn. liquefied, fused View this entry on the original dictionary page scan.
vidrāvyamfn. to be put to flight or driven away View this entry on the original dictionary page scan.
vidriyaSee a-vidriy/a-. View this entry on the original dictionary page scan.
vidṛśmfn. eyeless, blind View this entry on the original dictionary page scan.
vidṛśSee under 3. v/i-, . View this entry on the original dictionary page scan.
vidṛś(only Passive voice and A1. -dṛśyate-; Aorist vy-adarśi-; see vi-paś-), to be clearly visible, become apparent, appear etc.: Causal -darśayati-, to cause to see, show ; to teach View this entry on the original dictionary page scan.
vidṛtif. a suture in the skull View this entry on the original dictionary page scan.
vidruP. -dravati-, to run apart or in different directions, disperse, run away, escape etc. ; to part asunder, become divided, burst : Causal -drāvayati-, to cause to disperse, drive or scare away, put to flight View this entry on the original dictionary page scan.
vidruh(only A1. perfect tense -dudruhe-), to injure, do wrong (with dative case) View this entry on the original dictionary page scan.
vidrumamfn. treeless View this entry on the original dictionary page scan.
vidruman. (according to to m.)"peculiar tree" , coral etc. View this entry on the original dictionary page scan.
vidrumam. a young sprout or shoot View this entry on the original dictionary page scan.
vidrumam. equals vṛkṣa- View this entry on the original dictionary page scan.
vidrumam. Name of a mountain View this entry on the original dictionary page scan.
vidrumacchavim. "coral-coloured", Name of śiva- View this entry on the original dictionary page scan.
vidrumacchāyamfn. "coral-coloured"and"affording no tree-shade" (see 1. vi-druma-) View this entry on the original dictionary page scan.
vidrumadaṇḍam. a branch of coral View this entry on the original dictionary page scan.
vidrumadehalīf. a threshold of coral View this entry on the original dictionary page scan.
vidrumalatāf. equals -daṇḍa- (also -latikā- ) View this entry on the original dictionary page scan.
vidrumalatāf. a kind of fragrant substance View this entry on the original dictionary page scan.
vidrumalatāf. Name of a woman View this entry on the original dictionary page scan.
vidrumamayamf(ī-)n. consisting of coral View this entry on the original dictionary page scan.
vidrumatāf. the condition of a [fivefold] branch of coral [said of the hand] View this entry on the original dictionary page scan.
vidrumataṭamfn. having banks of coral View this entry on the original dictionary page scan.
vidrumavanan. equals -daṇḍa- View this entry on the original dictionary page scan.
vidrutamfn. run away or asunder, running to and fro, flown, fled (n. impersonal or used impersonally) etc. View this entry on the original dictionary page scan.
vidrutamfn. burst asunder, destroyed View this entry on the original dictionary page scan.
vidrutamfn. agitated, perplexed, distraught View this entry on the original dictionary page scan.
vidrutamfn. liquefied, fluid (as an oily or metallic substance when heated) View this entry on the original dictionary page scan.
vidrutan. (prob.) a particular manner of fighting (in which flight is simulated?) View this entry on the original dictionary page scan.
vidrutāf. (scilicet sirā-) unsuccessful blood letting (caused by a patient's moving his limbs hither and thither) View this entry on the original dictionary page scan.
vidrutif. running, course View this entry on the original dictionary page scan.
vidrutif. flight View this entry on the original dictionary page scan.
viḍu viḍula- wrong reading for vid-. View this entry on the original dictionary page scan.
vidumfn. intelligent, wise View this entry on the original dictionary page scan.
vidum. the hollow between the frontal globes of an elephant View this entry on the original dictionary page scan.
vidum. Name of a man View this entry on the original dictionary page scan.
vidum. or f. Name of a deity of the bodhi- tree View this entry on the original dictionary page scan.
vidu(or -) P. -dunoti-, to consume or destroy by burning ; A1. -dunute-, -dūyate- (Epic also ti-), to be agitated or afflicted or distressed View this entry on the original dictionary page scan.
vidu vidura-, vidula- See under 1. vid-, . View this entry on the original dictionary page scan.
vidud(prob.) = Vendidad View this entry on the original dictionary page scan.
viduhP. -dogdhi-, to milk out, drain, exploit View this entry on the original dictionary page scan.
vidulam. Calamus Rotang or Fasciculatus View this entry on the original dictionary page scan.
vidulam. of a prince View this entry on the original dictionary page scan.
vidulāf. a species of Euphorbia View this entry on the original dictionary page scan.
vidulāf. Name of a woman View this entry on the original dictionary page scan.
vidūnamfn. distressed, afflicted View this entry on the original dictionary page scan.
vidupam. Name of a king View this entry on the original dictionary page scan.
vidūraSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
viduramfn. knowing, wise, intelligent, skilled in (compound) View this entry on the original dictionary page scan.
viduram. a learned or clever man View this entry on the original dictionary page scan.
viduram. an intriguer View this entry on the original dictionary page scan.
viduram. Name of the younger brother of dhṛta-rāṣṭra- and pāṇḍu- (they were all three sons of vyāsa-, but only the latter two by the two widows of vicitra-vīrya-;when vyāsa- wanted a third son, the elder widow sent him one of her slave-girls, dressed in her own clothes, and this girl became the mother of vidura-, who is sometimes called kṣattṛ-, as if he were the son of a kṣatriya- man and śūdra- woman vidura- is described as sarva-buddhimatāṃ varaḥ-and is one of the wisest characters in the mahā-bhārata-, always ready with good advice both for his nephews, the pāṇḍava-s, and for his brother dhṛta-rāṣṭra-) (see ) View this entry on the original dictionary page scan.
vidūramf(ā-)n. very remote or distant etc. (accusative with kṛ-,to remove; vidūram vi-dūram- ind.far distant, far away ; vi-dūrāt-or ra-tas-,from afar, far away; re-,far distant; ra- in the beginning of a compound far, from afar) View this entry on the original dictionary page scan.
vidūramf(ā-)n. far removed from, not attainable by (genitive case) View this entry on the original dictionary page scan.
vidūramf(ā-)n. (in fine compositi or 'at the end of a compound') not caring for View this entry on the original dictionary page scan.
vidūram. Name of a son of kuru- (Bombay edition) View this entry on the original dictionary page scan.
vidūram. of a mountain or town or any locality (see ) View this entry on the original dictionary page scan.
vidūrabhūmif. Name of a locality (equals vidūra-) View this entry on the original dictionary page scan.
vidūrādrim. Name of a mountain View this entry on the original dictionary page scan.
vidūragamfn. going far away View this entry on the original dictionary page scan.
vidūragamfn. far-spreading (as scent) View this entry on the original dictionary page scan.
vidūragamanan. the going far away View this entry on the original dictionary page scan.
vidurāgamanaparvann. Name of chs. 200-206 of View this entry on the original dictionary page scan.
viḍūrajafor vi-dūra-ja-, . (Cf. vaiḍurya-.) View this entry on the original dictionary page scan.
vidūrajan. cat's eye (a sort of jewel) View this entry on the original dictionary page scan.
vidūrajātamfn. grown a long way off View this entry on the original dictionary page scan.
vidūrakramaṇakṣamamfn. able to run far away View this entry on the original dictionary page scan.
vidurākrūravaradam. Name of kṛṣṇa- View this entry on the original dictionary page scan.
vidūramind. vidūra
viduranītif. Name of chs. 32-39 of View this entry on the original dictionary page scan.
viduraprajāgaram. Name of chs. 32-39 of View this entry on the original dictionary page scan.
vidūraratnan. equals -ja- View this entry on the original dictionary page scan.
vidūrasaṃśravamfn. audible a long way off View this entry on the original dictionary page scan.
viduratāf. the state or condition of (being) vidura- View this entry on the original dictionary page scan.
vidūratāf. equals next View this entry on the original dictionary page scan.
vidūratham. (perhaps for vidūra-ratha-) Name of a muni- View this entry on the original dictionary page scan.
vidūratham. of a son of the 12th manu- View this entry on the original dictionary page scan.
vidūratham. of a king View this entry on the original dictionary page scan.
vidūratham. of a descendant of vṛṣṇi- View this entry on the original dictionary page scan.
vidūratham. of a son of kuru- View this entry on the original dictionary page scan.
vidūratham. of a son of bhajamāna- and father of śūra- View this entry on the original dictionary page scan.
vidūratham. of a son of su-ratha- and father of ṛkṣa- (sārvabhauma-) View this entry on the original dictionary page scan.
vidūratham. of a son of citra-- ratha- View this entry on the original dictionary page scan.
vidūratham. of the father of su-nīti- and su-mati- etc. View this entry on the original dictionary page scan.
vidūratham. of a man who was killed by his wife View this entry on the original dictionary page scan.
vidūratham. see View this entry on the original dictionary page scan.
vidūratvan. a great distance (ablative"from afar") View this entry on the original dictionary page scan.
vidūravigatamfn. "come from afar", of lowest origin View this entry on the original dictionary page scan.
vidūrayaNom. P. yati-, to drive far away (varia lectio) View this entry on the original dictionary page scan.
vidūrībhūP. -bhavati-, to become far distant View this entry on the original dictionary page scan.
vidūrodbhāvitan. equals ra-ja- View this entry on the original dictionary page scan.
viduṣweak form of vidvas-, in compound View this entry on the original dictionary page scan.
vidusmfn. wise, attentive, heedful View this entry on the original dictionary page scan.
viduṣP. -duṣyati-, to be defiled, commit a fault or sin, transgress : Causal -dūṣayati-, to defile, corrupt, disgrace ; (with upahāsaiḥ-) to deride, ridicule View this entry on the original dictionary page scan.
vidūṣakamfn. defiling, disgracing View this entry on the original dictionary page scan.
vidūṣakamfn. facetious, witty
vidūṣakam. a jester, wag, buffoon (especially in dramatic language) the jocose companion and confidential friend of the hero of a play (he acts the same confidential part towards the king or hero, that her female companions do towards the heroine;his business is to excite mirth in person and attire, and to make himself the universal butt;a curious regulation requires him to be a Brahman, or higher in caste than the king himself; see ) etc. View this entry on the original dictionary page scan.
vidūṣakam. a libertine, catamite View this entry on the original dictionary page scan.
vidūṣakam. Name of a Brahman View this entry on the original dictionary page scan.
vidūṣaṇamf(ā-)n. defiling, detracting, corrupting View this entry on the original dictionary page scan.
vidūṣaṇan. censuring, reviling, abuse, satire View this entry on the original dictionary page scan.
vidūṣaṇakamfn. equals prec. View this entry on the original dictionary page scan.
viduṣīf. (Comparative degree ṣī-tarā- ;fr. vidvas-) a wise woman View this entry on the original dictionary page scan.
viduṣitamfn. soiled, defiled, disgraced View this entry on the original dictionary page scan.
viduṣitara viduṣ-ṭara- etc. See . View this entry on the original dictionary page scan.
viduṣkṛtamfn. free from sins or faults or transgressions View this entry on the original dictionary page scan.
viduṣmatmfn. full of learned men View this entry on the original dictionary page scan.
viduṣṭaramfn. (Comparative degree for vidvat-tara-,fr. idem or 'weak form of vidvas-, in compound ') wiser or very wise View this entry on the original dictionary page scan.
vidvacin compound for vidvat-. View this entry on the original dictionary page scan.
vidvaccakoram. (with bhaṭṭa-) Name of a lexicographer View this entry on the original dictionary page scan.
vidvaccittaprasādinīf. Name of work View this entry on the original dictionary page scan.
vidvadin compound for vidvat-. View this entry on the original dictionary page scan.
vidvadbhūṣaṇapadyasaṃgraham. Name of work View this entry on the original dictionary page scan.
vidvaddeśīya mfn. equals vidvat-kalpa- View this entry on the original dictionary page scan.
vidvaddeśyamfn. equals vidvat-kalpa- View this entry on the original dictionary page scan.
vidvadvallabham. Name of work View this entry on the original dictionary page scan.
vidvadvinodakāvyan. Name of work View this entry on the original dictionary page scan.
vidvadvinodamañjūṣāf. Name of work View this entry on the original dictionary page scan.
vidvadvivādam. Name of work View this entry on the original dictionary page scan.
vidvajin compound for vidvat-. View this entry on the original dictionary page scan.
vidvajjanam. a wise man, sage, seer View this entry on the original dictionary page scan.
vidvajjanamadabhañjanan. Name of work View this entry on the original dictionary page scan.
vidvajjanamanoharāf. Name of work View this entry on the original dictionary page scan.
vidvajjanaparisevif. Name of a kiṃ-narī- View this entry on the original dictionary page scan.
vidvajjanavallabham. Name of work View this entry on the original dictionary page scan.
vidvajjanavallabhīyan. Name of work View this entry on the original dictionary page scan.
vidvalamf(ā-)n. clever, artful View this entry on the original dictionary page scan.
vidvanmfn. equals vidv/as- View this entry on the original dictionary page scan.
vidvanin compound for vidvat-. View this entry on the original dictionary page scan.
vidvanmaṇḍanan. Name of work View this entry on the original dictionary page scan.
vidvanmanoharāf. Name of work View this entry on the original dictionary page scan.
vidvanmanoramāf. Name of work View this entry on the original dictionary page scan.
vidvanmanorañjinīf. Name of work View this entry on the original dictionary page scan.
vidvanmodataraṃgiṇīf. Name of a survey of philosophical and religious systems. View this entry on the original dictionary page scan.
vidvanmodinīf. Name of a commentator or commentary on by rāmabhadra-. View this entry on the original dictionary page scan.
viḍvarāham. a tame or village hog View this entry on the original dictionary page scan.
vidvasmf(/uṣī-)n. one who knows, knowing, understanding, learned, intelligent, wise, mindful of, familiar with, skilled in (accusative locative case,or compound) etc. (see vidvat-tara-, vidvat-tama-, viduṣṭara-, viduṣī-tara-) View this entry on the original dictionary page scan.
vidvasm. a wise man, sage, seer View this entry on the original dictionary page scan.
vidvasm. Name of a Brahman View this entry on the original dictionary page scan.
vidvatin compound for vidvas-. View this entry on the original dictionary page scan.
vidvat vidvas- etc. See p.964. View this entry on the original dictionary page scan.
vidvatkalpamfn. a little learned, slightly learned View this entry on the original dictionary page scan.
vidvatkaṇṭhapāśam. Name of a poem. View this entry on the original dictionary page scan.
vidvatprabodhinīf. Name of work View this entry on the original dictionary page scan.
vidvatsaṃnyāsalakṣaṇan. Name of work View this entry on the original dictionary page scan.
vidvattāf. () scholarship, science, wisdom. View this entry on the original dictionary page scan.
vidvattamam. "wisest, very wise", Name of śiva- View this entry on the original dictionary page scan.
vidvattaramfn. wiser, very wise (see viduṣ-ṭara-). View this entry on the original dictionary page scan.
vidvattvan. () scholarship, science, wisdom. View this entry on the original dictionary page scan.
vidveṣam. hatred, dislike, contempt, aversion to (locative case or genitive case) etc. (ṣaṃ-gam-,to make one's self odious; ṣaṃ-kṛ-,with locative case,to show hostility towards; ṣaṃ-grah-,with locative case,to conceive hatred against) View this entry on the original dictionary page scan.
vidveṣam. a magical act or formula used for exciting hatred or enmity (also vidveṣakarman -karman- n.) View this entry on the original dictionary page scan.
vidveṣam. proud indifference (even for desired objects) View this entry on the original dictionary page scan.
vidveṣam. a class of evil demons View this entry on the original dictionary page scan.
vidveṣakamfn. hating, adverse to (compound) View this entry on the original dictionary page scan.
vidveṣakarmann. vidveṣa
vidveṣaṇamfn. causing to hate, rendering hostile View this entry on the original dictionary page scan.
vidveṣaṇam. one who hates, a hater View this entry on the original dictionary page scan.
vidveṣaṇam. Name of a female demon (daughter of duḥ-saha-) (varia lectio for ṣiṇī-) View this entry on the original dictionary page scan.
vidveṣaṇan. hating, disliking, having an aversion to (genitive case or compound)
vidveṣaṇan. the being hated or disliked, a means for making one's self hateful View this entry on the original dictionary page scan.
vidveṣaṇan. exciting hatred or enmity View this entry on the original dictionary page scan.
vidveṣaṇan. a magical act performed to excite hatred View this entry on the original dictionary page scan.
vidveṣaṇīf. a woman of resentful disposition View this entry on the original dictionary page scan.
vidveṣas(v/i--) mfn. opposing or resisting enmity View this entry on the original dictionary page scan.
vidveṣavīram. Name of a chief of the śaiva-s View this entry on the original dictionary page scan.
vidveṣinmf(iṇī-)n. hating, hostile, inimical to (genitive case or compound) etc. View this entry on the original dictionary page scan.
vidveṣinmf(iṇī-)n. (in fine compositi or 'at the end of a compound') rivalling or vying with View this entry on the original dictionary page scan.
vidveṣiṇīf. Name of a female demon (see ṣaṇī-) View this entry on the original dictionary page scan.
vidveṣiprabhavamfn. proceeding from an enemy View this entry on the original dictionary page scan.
vidveṣitāf. hatred, enmity View this entry on the original dictionary page scan.
vidveṣṭṛmfn. one who hates, an enemy View this entry on the original dictionary page scan.
vidveṣyamfn. hated, disliked, hateful to (compound) View this entry on the original dictionary page scan.
vivighātam. equals -ghāta- View this entry on the original dictionary page scan.
vidviP. A1. -dveṣṭi-, -dviṣṭe-, to dislike, hate, be hostile to (accusative) ; (A1.) to hate each other mutually, dislike one another : Causal -dveṣayati-, to cause to dislike, render an enemy, make hostile towards one another View this entry on the original dictionary page scan.
vidvimfn. hating, hostile, an enemy to (mostly in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vidviṣamfn. idem or 'mfn. hating, hostile, an enemy to (mostly in fine compositi or 'at the end of a compound') ' View this entry on the original dictionary page scan.
vidviṣāṇamfn. idem or 'mfn. idem or 'mfn. idem or 'mfn. hating, hostile, an enemy to (mostly in fine compositi or 'at the end of a compound') ' ' ' View this entry on the original dictionary page scan.
vidviṣatmfn. idem or 'mfn. idem or 'mfn. hating, hostile, an enemy to (mostly in fine compositi or 'at the end of a compound') ' ' View this entry on the original dictionary page scan.
vidviṣṭamfn. hated, disliked, odious View this entry on the original dictionary page scan.
vidviṣṭamfn. hostile to (locative case) View this entry on the original dictionary page scan.
vidviṣṭamfn. (in fine compositi or 'at the end of a compound') opposite or contrary View this entry on the original dictionary page scan.
vidviṣṭatāf. hatred, dislike View this entry on the original dictionary page scan.
vidya(for 2.See) equals vidyā- (in fine compositi or 'at the end of a compound';See a-v- kṛta-vidya-, samāna-vidya--). View this entry on the original dictionary page scan.
vidyāf. knowledge (see kāla-jāta-v-), science, learning, scholarship, philosophy etc. etc. (according to some there are four vidyā-s or sciences, 1. trayī-,the triple veda-;2. ānvīkṣikī-,logic and metaphysics;3. daṇḍa-nīti-,the science of government;4. vārttā-,practical arts, such as agriculture, commerce, medicine etc.;and adds a fifth, viz. ātma-vidyā-,knowledge of soul or of spiritual truth;according to others, vidyā- has fourteen divisions, viz. the four veda-s, the six vedāṅga-s, the purāṇa-s, the mīmāṃsā-. nyāya-, and dharma- or law;or with the four upa-veda-s, eighteen divisions;others reckon 33 and even 64 sciences[ equals kalās-or arts];Knowledge is also personified and identified with durgā-;she is even said to have composed prayers and magical formulas)
vidyāf. any knowledge whether true or false (with pāśupata-s) View this entry on the original dictionary page scan.
vidyāf. a spell, incantation View this entry on the original dictionary page scan.
vidyāf. magical skill View this entry on the original dictionary page scan.
vidyāf. a kind of magical pill (which placed in the mouth is supposed to give the power of ascending to heaven) View this entry on the original dictionary page scan.
vidyāf. Premna Spinosa View this entry on the original dictionary page scan.
vidyāf. a mystical Name of the letter i- View this entry on the original dictionary page scan.
vidyāf. a small bell (see vidyāmaṇi-). 1. View this entry on the original dictionary page scan.
vidyan. finding, acquiring, gaining (See pativ-and putra-v-). View this entry on the original dictionary page scan.
vidya vidyā- etc. See . View this entry on the original dictionary page scan.
vidya vidyamāna- etc. See p.965.
vidyābalan. the power of magic View this entry on the original dictionary page scan.
vidyābhājmfn. learned View this entry on the original dictionary page scan.
vidyābharaṇam. (bh-) Name of an author View this entry on the original dictionary page scan.
vidyābharaṇīf. Name of his work View this entry on the original dictionary page scan.
vidyābhaṭṭam. Name of an author View this entry on the original dictionary page scan.
vidyābhaṭṭapaddhatif. Name of work View this entry on the original dictionary page scan.
vidyābhimānam. (bh-) the fancy or idea that one possesses learning View this entry on the original dictionary page scan.
vidyābhimānavatmfn. imagining one's self learned View this entry on the original dictionary page scan.
vidyābhīpsin(yabh-) mfn. desiring knowledge View this entry on the original dictionary page scan.
vidyābhṛtm. equals -dhara- a fairy View this entry on the original dictionary page scan.
vidyābhūṣaṇam. Name of an author View this entry on the original dictionary page scan.
vidyābhyāsa(bh-) m. practice or pursuit of learning, application to books, study View this entry on the original dictionary page scan.
vidyācakran. lexicography View this entry on the original dictionary page scan.
vidyācakravartinm. Name of an author View this entry on the original dictionary page scan.
vidyācaṇamfn. famous for learning, learned (see -cuñcu-; caṇa-and cuñcu-are regarded by as taddhita- affixes) . View this entry on the original dictionary page scan.
vidyācaraṇasampannamfn. perfect in knowledge and of good moral conduct View this entry on the original dictionary page scan.
vidyācitmfn. puffed up by science View this entry on the original dictionary page scan.
vidyācuñcumfn. equals -caṇa- above View this entry on the original dictionary page scan.
vidyādalam. Betula Bhojpatra (whose leaves are used for writing) View this entry on the original dictionary page scan.
vidyādānan. the imparting of knowledge, instruction in science (especially sacred science) View this entry on the original dictionary page scan.
vidyādaśakan. Name of work View this entry on the original dictionary page scan.
vidyādātṛmfn. one who gives or imparts knowledge, a teacher View this entry on the original dictionary page scan.
vidyādāyādam. the inheritor of a science View this entry on the original dictionary page scan.
vidyādevīf. "goddess of learning", a female divinity peculiar to the jaina-s (16 are named) View this entry on the original dictionary page scan.
vidyādhāmamuniśiṣyam. Name of an author View this entry on the original dictionary page scan.
vidyādhanan. the treasure of knowledge, wealth consisting in learning View this entry on the original dictionary page scan.
vidyādharamfn. possessed of science or spells. View this entry on the original dictionary page scan.
vidyādharam. a kind of supernatural being (dwelling in the himālaya-, attending upon śiva-, and possessed of magical power), fairy ( vidyādharatva -tva- n.) etc. View this entry on the original dictionary page scan.
vidyādharam. (also -kavi-, cārya-) Name of various scholars View this entry on the original dictionary page scan.
vidyādharam. a kind of metre View this entry on the original dictionary page scan.
vidyādharam. (in music) a kind of measure View this entry on the original dictionary page scan.
vidyādharaf(ā-and ī-). Name of a surāṅganā- View this entry on the original dictionary page scan.
vidyādharam. Name of a daughter of śūra-sena- View this entry on the original dictionary page scan.
vidyādhāra(dh-) m. "receptacle of knowledge", a great scholar View this entry on the original dictionary page scan.
vidyādharābhram. a particular mixture View this entry on the original dictionary page scan.
vidyādharacakravartinm. a supreme lord of the vidyā-dhara-s View this entry on the original dictionary page scan.
vidyādharādhīśam. equals ra-cakra-vartin- ( vidyādharādhīśatā -- f.) View this entry on the original dictionary page scan.
vidyādharādhīśatāf. vidyādharādhīśa
vidyādharamahācakravartinm. the paramount lord of all fairy-like beings ( vidyādharamahācakravartitā ti-- f.) View this entry on the original dictionary page scan.
vidyādharamahācakravartitāf. vidyādharamahācakravartin
vidyādharapiṭaka(?) m. Name of work View this entry on the original dictionary page scan.
vidyādhararasam. a particular mixture View this entry on the original dictionary page scan.
vidyādharatālam. (in music) a kind of measure (equals vidyā-dhara-) View this entry on the original dictionary page scan.
vidyādharatvan. vidyādhara
vidyādharayantran. an apparatus for sublimating quicksilver View this entry on the original dictionary page scan.
vidyādharendram. a prince of the vidyā-dhara-s ( vidyādharendratā -- f. vidyādharendratva -tva-, n.) View this entry on the original dictionary page scan.
vidyādharendram. Name of jāmbavat- View this entry on the original dictionary page scan.
vidyādharendratāf. vidyādharendra
vidyādharendratvan. vidyādharendra
vidyādharīf. a female of the above class of supernatural beings, fairy, sylph etc. View this entry on the original dictionary page scan.
vidyādharībhūto become a vidyā-dhara- View this entry on the original dictionary page scan.
vidyādharīparijanamfn. attended by vidyā-dharī-s View this entry on the original dictionary page scan.
vidyādharīvilāsam. Name of work View this entry on the original dictionary page scan.
vidyādhidevatā(dh-) f. the tutelary deity of science, sarasvatī- View this entry on the original dictionary page scan.
vidyādhigama(dh-) m. acquisition of knowledge, study View this entry on the original dictionary page scan.
vidyādhipa(dh-) m. "lord of knowledge", (prob.) Name of śiva- View this entry on the original dictionary page scan.
vidyādhipati(dh-) m. Name of two poets View this entry on the original dictionary page scan.
vidyādhirāja (dh-) m. Name of scholar. View this entry on the original dictionary page scan.
vidyādhirājatīrthan. Name of scholar. View this entry on the original dictionary page scan.
vidyādhirāya(dh-) m. Name of scholar. View this entry on the original dictionary page scan.
vidyādhīśamunim. Name of scholar. View this entry on the original dictionary page scan.
vidyādhīśanātham. Name of scholar. View this entry on the original dictionary page scan.
vidyādhīśasvāminm. Name of scholar. View this entry on the original dictionary page scan.
vidyādhīśatīrtha(dh-) n. Name of scholar. View this entry on the original dictionary page scan.
vidyādhīśavaḍerum. Name of scholar. View this entry on the original dictionary page scan.
vidyādhram. equals -dhara-, a fairy View this entry on the original dictionary page scan.
vidyāgama(g-) m. acquirement of knowledge, proficiency in science View this entry on the original dictionary page scan.
vidyāgaṇam. plural Name of a particular Buddhist work View this entry on the original dictionary page scan.
vidyāgītāf. Name of work View this entry on the original dictionary page scan.
vidyāgrahaṇan. acquisition of science View this entry on the original dictionary page scan.
vidyāgurum. an instructor in science (especially in sacred science) View this entry on the original dictionary page scan.
vidyāhīnamfn. destitute of knowledge, unlearned, uninstructed View this entry on the original dictionary page scan.
vidyājambhakavārttikamfn. exercising magic of various kinds View this entry on the original dictionary page scan.
vidyākalpasūtran. Name of work View this entry on the original dictionary page scan.
vidyākaramfn. causing wisdom, giving knowledge or science View this entry on the original dictionary page scan.
vidyākaram. (k-) "mine of learning", a learned man View this entry on the original dictionary page scan.
vidyākaram. Name of a teacher View this entry on the original dictionary page scan.
vidyākaram. (also ra-vājapeyin-) Name of an author View this entry on the original dictionary page scan.
vidyākaramiśramaithilam. Name of an author View this entry on the original dictionary page scan.
vidyākarmann. the study of sacred science View this entry on the original dictionary page scan.
vidyākarmann. (dual number) knowledge and action View this entry on the original dictionary page scan.
vidyākośagṛhan. a library View this entry on the original dictionary page scan.
vidyākośasamāśrayam. a library View this entry on the original dictionary page scan.
vidyālabdhamfn. acquired or gained by learning View this entry on the original dictionary page scan.
vidyālābham. acquisition of learning View this entry on the original dictionary page scan.
vidyālābham. any acquirement gained by learning View this entry on the original dictionary page scan.
vidyālaharīf. Name of work View this entry on the original dictionary page scan.
vidyālaṃkāra(l-) m. Name of authors View this entry on the original dictionary page scan.
vidyālaṃkārabhaṭṭācāryam. Name of authors View this entry on the original dictionary page scan.
vidyālayam. (l-) abode or seat of learning, a school, college View this entry on the original dictionary page scan.
vidyālayam. Name of a place. View this entry on the original dictionary page scan.
vidyāmadam. pride in one's learning View this entry on the original dictionary page scan.
vidyāmādhavam. Name of two authors. View this entry on the original dictionary page scan.
vidyāmādhavīyan. Name of work View this entry on the original dictionary page scan.
vidyāmāhātmyan. Name of work View this entry on the original dictionary page scan.
vidyāmaheśvaram. "lord of science", Name of śiva- View this entry on the original dictionary page scan.
vidyamānamfn. (Passive voice pr. p.)"being found" , existent, existing, present, real (see a-vid-). View this entry on the original dictionary page scan.
vidyamānakeśamfn. one who possesses hair View this entry on the original dictionary page scan.
vidyamānamatimfn. possessing understanding, wise View this entry on the original dictionary page scan.
vidyamānatāf. View this entry on the original dictionary page scan.
vidyamānatvan. existence, presence View this entry on the original dictionary page scan.
vidyāmaṇḍalakan. "circle of knowledge", a library View this entry on the original dictionary page scan.
vidyāmandiran. a school-house, college View this entry on the original dictionary page scan.
vidyāmaṇim. a small bell View this entry on the original dictionary page scan.
vidyāmaṭham. a college, monastic school View this entry on the original dictionary page scan.
vidyāmātrasiddhif. View this entry on the original dictionary page scan.
vidyāmātrasiddhitridaśaśāstrakārikāf. Name of Buddhist works. View this entry on the original dictionary page scan.
vidyāmayamf(ī-)n. consisting of or absorbed in knowledge View this entry on the original dictionary page scan.
vidyāmṛtavarṣiṇīf. Name of work View this entry on the original dictionary page scan.
vidyānagaran. ( ) or f(ī-). () Name of a city. View this entry on the original dictionary page scan.
vidyānandam. (n-) "delight in knowledge" View this entry on the original dictionary page scan.
vidyānandam. Name of chapter of the pañca-daśī- View this entry on the original dictionary page scan.
vidyānandam. of various authors View this entry on the original dictionary page scan.
vidyānandanātham. Name of an author View this entry on the original dictionary page scan.
vidyānandanibandham. Name of work View this entry on the original dictionary page scan.
vidyānātham. ( ) Name of various authors or scholars. View this entry on the original dictionary page scan.
vidyānāthabhaṭṭam. () Name of various authors or scholars. View this entry on the original dictionary page scan.
vidyānidhim. () Name of various authors or scholars. View this entry on the original dictionary page scan.
vidyānidhitīrtham. () Name of various authors or scholars. View this entry on the original dictionary page scan.
vidyānivāsam. Name of various men View this entry on the original dictionary page scan.
vidyānivāsabhaṭṭācāryam. Name of various men
vidyāntam. (n-) the end of an apprenticeship View this entry on the original dictionary page scan.
vidyāntam. the end of knowledge View this entry on the original dictionary page scan.
vidyāntagamfn. one who has completely mastered his profession View this entry on the original dictionary page scan.
vidyānulomālipi(!) f. (n-) a particular manner of writing View this entry on the original dictionary page scan.
vidyānupālanan. (n-) encouragement or cultivation of science View this entry on the original dictionary page scan.
vidyānupālanan. acquiring learning, studying View this entry on the original dictionary page scan.
vidyānupālinmfn. (n-) cherishing or encouraging science, acquiring learning View this entry on the original dictionary page scan.
vidyānupālinmfn. faithfully preserving (traditional) learning View this entry on the original dictionary page scan.
vidyānusevana(n-) n. the cultivation of science View this entry on the original dictionary page scan.
vidyānusevin(n-) mfn. cultivating learning, engaged in study. View this entry on the original dictionary page scan.
vidyānyāsam. Name of a mantra-. View this entry on the original dictionary page scan.
vidyāpaddhatif. Name of several works. View this entry on the original dictionary page scan.
vidyāpariṇayam. Name of several dramas. View this entry on the original dictionary page scan.
vidyāpatim. the chief scholar at a court ( vidyāpatitva -tva- n.) View this entry on the original dictionary page scan.
vidyāpatim. (also ti-svāmin-) Name of various authors or scholars View this entry on the original dictionary page scan.
vidyāpatitvan. vidyāpati
vidyāphalan. the fruit of learning View this entry on the original dictionary page scan.
vidyāpīṭhan. seat of knowledge View this entry on the original dictionary page scan.
vidyāpradānan. equals -dāna- above View this entry on the original dictionary page scan.
vidyāpradānan. Name of a chapter of the View this entry on the original dictionary page scan.
vidyāprakāśacikitsāf. Name of work View this entry on the original dictionary page scan.
vidyāprāptif. acquirement of knowledge View this entry on the original dictionary page scan.
vidyāprāptif. any acquisition made by learning View this entry on the original dictionary page scan.
vidyāpravādan. Name of one of the pūrva-s or oldest writings of the jaina-s. View this entry on the original dictionary page scan.
vidyārājam. a king of knowledge, lord of spells View this entry on the original dictionary page scan.
vidyārājam. Name of viṣṇu- View this entry on the original dictionary page scan.
vidyārājam. of a saint View this entry on the original dictionary page scan.
vidyārāmam. Name of an author View this entry on the original dictionary page scan.
vidyārambham. (r-) beginning of study View this entry on the original dictionary page scan.
vidyārambham. Name of a chapter of the View this entry on the original dictionary page scan.
vidyāraṇyam. (also ya-tīrtha-, ya-yati-, ya-yogin-, ya-svāmin-, bhāratī-tīrthavidyāraṇya-) Name of various scholars View this entry on the original dictionary page scan.
vidyāraṇyabhāṣyan. Name of work View this entry on the original dictionary page scan.
vidyāraṇyajātakan. Name of work View this entry on the original dictionary page scan.
vidyāraṇyamūlan. Name of work View this entry on the original dictionary page scan.
vidyāraṇyanārāyaṇīyan. (?) Name of work View this entry on the original dictionary page scan.
vidyāraṇyapañcadaśīf. Name of work View this entry on the original dictionary page scan.
vidyāraṇyasaṃgraham. Name of work View this entry on the original dictionary page scan.
vidyārāśim. Name of śiva- View this entry on the original dictionary page scan.
vidyāratnan. the jewel of learning View this entry on the original dictionary page scan.
vidyāratnan. valuable knowledge View this entry on the original dictionary page scan.
vidyāratnan. Name of work View this entry on the original dictionary page scan.
vidyāratnākaram. Name of work View this entry on the original dictionary page scan.
vidyārcanamañjarī(r-) f. Name of work View this entry on the original dictionary page scan.
vidyārjanan. (r-) acquirement of knowledge View this entry on the original dictionary page scan.
vidyārjanan. acquiring anything by knowledge or by teaching View this entry on the original dictionary page scan.
vidyārjita(r-) mfn. acquired or gained by knowledge View this entry on the original dictionary page scan.
vidyārṇava(r-) m. Name of work View this entry on the original dictionary page scan.
vidyārtham. the seeking for knowledge View this entry on the original dictionary page scan.
vidyārthamfn. desirous of knowledge View this entry on the original dictionary page scan.
vidyārthadīpikāf. Name of work View this entry on the original dictionary page scan.
vidyārthaprakāśikāf. Name of work View this entry on the original dictionary page scan.
vidyārthinmfn. (r-) desirous of knowledge View this entry on the original dictionary page scan.
vidyārthinm. a student, pupil View this entry on the original dictionary page scan.
vidyāsādhanan. Name of work View this entry on the original dictionary page scan.
vidyāsadmann. "abode of learning", a school View this entry on the original dictionary page scan.
vidyāsāgaram. "ocean of knowledge", Name of various scholars View this entry on the original dictionary page scan.
vidyāsāgarapāram. Name of work View this entry on the original dictionary page scan.
vidyāsampradānan. equals -dāna- View this entry on the original dictionary page scan.
vidyāsnāta( ) () mfn. one who has finished his studentship and completed his study of the veda-s. View this entry on the original dictionary page scan.
vidyāsnātaka() mfn. one who has finished his studentship and completed his study of the veda-s. View this entry on the original dictionary page scan.
vidyāśrutasampannamfn. well equipped with secular and sacred science View this entry on the original dictionary page scan.
vidyāsthānan. a branch of knowledge View this entry on the original dictionary page scan.
vidyātasind. in consequence or by virtue of knowledge View this entry on the original dictionary page scan.
vidyātasind. also = ablative of vidyā-. View this entry on the original dictionary page scan.
vidyātīrthan. knowledge compared to a sacred bathing-place View this entry on the original dictionary page scan.
vidyātīrthan. Name of a bathing-place View this entry on the original dictionary page scan.
vidyātīrthan. of śiva- View this entry on the original dictionary page scan.
vidyātīrthan. of an author View this entry on the original dictionary page scan.
vidyātīrthaśiṣyam. Name of sāyaṇa- View this entry on the original dictionary page scan.
vidyātvan. the state or idea of vidyā- View this entry on the original dictionary page scan.
vidyāvadhūf. a goddess thought to preside over learning (see vidyādhidevatā-). View this entry on the original dictionary page scan.
vidyāvāgīśa("master in science and speech") m. Name of a scholar View this entry on the original dictionary page scan.
vidyāvāgīśabhaṭṭācāryam. Name of a scholar View this entry on the original dictionary page scan.
vidyāvallabham. a particular mixture View this entry on the original dictionary page scan.
vidyāvaṃśam. a chronological list of teachers in any branch of science View this entry on the original dictionary page scan.
vidyāvatmfn. possessed of learning, learned etc. View this entry on the original dictionary page scan.
vidyāvataṃsa(v-) m. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vidyāvatīf. Name of an apsaras- View this entry on the original dictionary page scan.
vidyāvatīf. of a surāṅganā- View this entry on the original dictionary page scan.
vidyāvayovṛddhamfn. advanced in learning and years View this entry on the original dictionary page scan.
vidyāvedavratasnātamfn. one completely versed in religious observances and the veda- and the sciences (see vidyā-vrata-sn-, veda-vidyā-vrata-sn-). View this entry on the original dictionary page scan.
vidyāvedavratavat mfn. one completely versed in religious observances and the veda- and the sciences (see vidyā-vrata-sn-, veda-vidyā-vrata-sn-). View this entry on the original dictionary page scan.
vidyāveśmana school house, college View this entry on the original dictionary page scan.
vidyāvidmfn. learned View this entry on the original dictionary page scan.
vidyāvihīnamfn. destitute of knowledge, ignorant View this entry on the original dictionary page scan.
vidyāvikrayam. "sale of knowledge", instruction in return for payment View this entry on the original dictionary page scan.
vidyāvilāsam. (prob.) Name of a king View this entry on the original dictionary page scan.
vidyāvilāsam. of work View this entry on the original dictionary page scan.
vidyāvinodam. (also cārya-) Name of various scholars View this entry on the original dictionary page scan.
vidyāvinodam. of various works. View this entry on the original dictionary page scan.
vidyāviruddhamfn. conflicting with science View this entry on the original dictionary page scan.
vidyāviruddhatāf. View this entry on the original dictionary page scan.
vidyāviśāradam. Name of a scholar View this entry on the original dictionary page scan.
vidyāviśāradam. of a minister View this entry on the original dictionary page scan.
vidyāviṣayehomavidhim. Name of work View this entry on the original dictionary page scan.
vidyāviśiṣṭamfn. distinguished for learning, possessed of science View this entry on the original dictionary page scan.
vidyāvratan. a particular religious observance View this entry on the original dictionary page scan.
vidyāvratam. (prob.) a kind of magician View this entry on the original dictionary page scan.
vidyāvratakamfn. () one who is completely versed in the veda- and religious observances View this entry on the original dictionary page scan.
vidyāvratakam. a Brahman who has finished his studentship View this entry on the original dictionary page scan.
vidyāvratasnātamfn. () one who is completely versed in the veda- and religious observances View this entry on the original dictionary page scan.
vidyāvṛddhamfn. old in knowledge, increased in learning
vidyāvyākhyānamaṇḍapam. n. a hall where the science are explained, college View this entry on the original dictionary page scan.
vidyāvyasanan. idem or 'm. the pursuit of science ' View this entry on the original dictionary page scan.
vidyāvyavasāyam. the pursuit of science View this entry on the original dictionary page scan.
vidyendrasarasvatīm. Name of an author View this entry on the original dictionary page scan.
vidyeśam. "lord of knowledge", Name of śiva- View this entry on the original dictionary page scan.
vidyeśam. equals vidyeśvara- ( vidyeśatva -tva- n.) View this entry on the original dictionary page scan.
vidyeśatvan. vidyeśa
vidyeśvaram. (with śaiva-s) Name of a class of emancipated beings View this entry on the original dictionary page scan.
vidyeśvaram. Name of a magician View this entry on the original dictionary page scan.
vidyikaSee vāyov-. View this entry on the original dictionary page scan.
vidyopārjanan. () () acquisition of knowledge. View this entry on the original dictionary page scan.
vidyopārjanāf. () acquisition of knowledge. View this entry on the original dictionary page scan.
vidyopārjitamfn. acquired by learning View this entry on the original dictionary page scan.
vidyopayogam. acquisition of learning from (ablative) View this entry on the original dictionary page scan.
vidyotirreg. ablative of 2. vidyut- (in and didy/ot-).
vidyotamfn. flashing, glittering View this entry on the original dictionary page scan.
vidyotam. a flash of light, lightning View this entry on the original dictionary page scan.
vidyotam. Name of a son of dharma- and lambā- (father of stanayitnu-,"the Thunder") View this entry on the original dictionary page scan.
vidyotāf. Name of an apsaras- View this entry on the original dictionary page scan.
vidyotakamfn. irradiating, illuminating, illustrating View this entry on the original dictionary page scan.
vidyotamānaSee vi-dyut-. View this entry on the original dictionary page scan.
vidyotanamfn. idem or 'mfn. irradiating, illuminating, illustrating ' View this entry on the original dictionary page scan.
vidyotanan. lightning View this entry on the original dictionary page scan.
vidyotayitavyamfn. (fr. Causal) to be illustrated or illuminated View this entry on the original dictionary page scan.
vidyotinmfn. irradiating, illustrating View this entry on the original dictionary page scan.
vidyotpattif. Name of work View this entry on the original dictionary page scan.
vidyottaratāpinīf. Name of work View this entry on the original dictionary page scan.
vidyucin compound for 2. vidyut-. View this entry on the original dictionary page scan.
vidyucchatru(for śatru-) m. Name of a rākṣasa- View this entry on the original dictionary page scan.
vidyucchikhāf. (for śikhā-) a kind of plant with a poisonous root View this entry on the original dictionary page scan.
vidyucchikhāf. Name of a rākṣasī- View this entry on the original dictionary page scan.
vidyudin compound for 2. vidyut-. View this entry on the original dictionary page scan.
vidyudakṣam. Name of a daitya- View this entry on the original dictionary page scan.
vidyudambhasf. Name of a river View this entry on the original dictionary page scan.
vidyuddāmann. "garland or mass of lightning", a flash or streak of forked lightning. View this entry on the original dictionary page scan.
vidyuddhasta(vidy/ud--) mfn. (for vidy/ud-+ hasta-) holding a glittering weapon in the hand View this entry on the original dictionary page scan.
vidyuddhvajam. Name of an asura- View this entry on the original dictionary page scan.
vidyuddyotam. the brightness of lightning View this entry on the original dictionary page scan.
vidyuddyotāf. Name of a princess View this entry on the original dictionary page scan.
vidyudratha(vidyut--) mfn. "borne on a glittering car"or"having lightning for a vehicle" View this entry on the original dictionary page scan.
vidyudunmeṣam. a flash of lightning View this entry on the original dictionary page scan.
vidyudvallīf. a flash of lightning View this entry on the original dictionary page scan.
vidyudvarcasm. Name of a divine being View this entry on the original dictionary page scan.
vidyudvarṇāf. Name of an apsaras- (see vidyutparṇā-). View this entry on the original dictionary page scan.
vidyudvat wrong reading for vidyut-vat- (q.v) View this entry on the original dictionary page scan.
vidyujin compound for 2. vidyut-. View this entry on the original dictionary page scan.
vidyujjihvamfn. having a lightning-like tongue View this entry on the original dictionary page scan.
vidyujjihvam. Name of a rākṣasa- View this entry on the original dictionary page scan.
vidyujjihvam. of a yakṣa- View this entry on the original dictionary page scan.
vidyujjihvāf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
vidyujjvālam. Name of a serpent-demon View this entry on the original dictionary page scan.
vidyujjvālāf. the flashing of lightning View this entry on the original dictionary page scan.
vidyujjvālāf. Methonica Superba View this entry on the original dictionary page scan.
vidyulin compound for 2. vidyut-. View this entry on the original dictionary page scan.
vidyullakṣaṇan. Name of the 59th pariśiṣṭa- of the View this entry on the original dictionary page scan.
vidyullatāf. "lightning-creeper", forked lightning View this entry on the original dictionary page scan.
vidyullatāf. Name of commentator or commentary View this entry on the original dictionary page scan.
vidyullekhāf. a streak of lightning View this entry on the original dictionary page scan.
vidyullekhāf. a kind of metre View this entry on the original dictionary page scan.
vidyullekhāf. Name of a certain merchant's wife View this entry on the original dictionary page scan.
vidyullocanam. a particular samādhi- View this entry on the original dictionary page scan.
vidyullocanāf. Name of a nāga- maid View this entry on the original dictionary page scan.
vidyunin compound for 2. vidyut-. View this entry on the original dictionary page scan.
vidyunmahas(vidy/un--) mfn. "rejoicing lightning"or"brilliant with lightning" View this entry on the original dictionary page scan.
vidyunmālam. Name of a monkey View this entry on the original dictionary page scan.
vidyunmālāf. a wreath of lightning etc. View this entry on the original dictionary page scan.
vidyunmālāf. a kind of metre etc. View this entry on the original dictionary page scan.
vidyunmālāf. Name of a yakṣī- View this entry on the original dictionary page scan.
vidyunmālāf. of a daughter of su-roha- View this entry on the original dictionary page scan.
vidyunmālinmfn. wreathed with lightning View this entry on the original dictionary page scan.
vidyunmālinm. Name of an asura- View this entry on the original dictionary page scan.
vidyunmālinm. of a rākṣasa- View this entry on the original dictionary page scan.
vidyunmālinm. of a god View this entry on the original dictionary page scan.
vidyunmālinm. of a vidyā-dhara- View this entry on the original dictionary page scan.
vidyunmaṇḍalavatmfn. wreathed with lightning (a cloud) View this entry on the original dictionary page scan.
vidyunmat(vidy/un--) mfn. containing lightning, gleaming, glittering View this entry on the original dictionary page scan.
vidyunmukhan. a particular phenomenon in the sky View this entry on the original dictionary page scan.
vidyutmfn. (for 2.See under vi-dyut-) devoid of splendour, lustreless View this entry on the original dictionary page scan.
vidyutA1. -dyotate- (Ved. also P.), to flash forth, lighten, shine forth (as the rising sun) etc. (v/i-dyotate-,"it lightens"; vi-dy/otamāne-,"when it lightens") ; to hurl away by a stroke of lightning ; to illuminate : Causal -dyotayati-, to illuminate, irradiate, enlighten, make brilliant etc.: Intensive (only. vi-d/avidyutat-) to shine brightly View this entry on the original dictionary page scan.
vidyutmfn. flashing, shining, glittering View this entry on the original dictionary page scan.
vidyutm. a particular samādhi- View this entry on the original dictionary page scan.
vidyutm. Name of an asura- View this entry on the original dictionary page scan.
vidyutm. of a rākṣasa- View this entry on the original dictionary page scan.
vidyutf. lightning (rarely n.), a flashing thunderbolt (as the weapon of the marut-s) etc. View this entry on the original dictionary page scan.
vidyutf. the dawn View this entry on the original dictionary page scan.
vidyutf. plural Name of the four daughters of prajā-pati- bahuputra- View this entry on the original dictionary page scan.
vidyutf. a species of the ati-jagatī- metre View this entry on the original dictionary page scan.
vidyutāf. = vidyut-2, lightning (See comp.) View this entry on the original dictionary page scan.
vidyutāf. a particular sakti- View this entry on the original dictionary page scan.
vidyutāf. Name of an apsaras- View this entry on the original dictionary page scan.
vidyutākṣa(itākṣa-) m. "lightning-eyed", Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
vidyutayaNom. A1. yate-, to flash or gleam (like lightning), be radiant View this entry on the original dictionary page scan.
vidyutkampam. the quivering or flashing of lightning View this entry on the original dictionary page scan.
vidyutkaśam. () Name of a rākṣasa- View this entry on the original dictionary page scan.
vidyutkaśinm. of a king of the rākṣasa-s View this entry on the original dictionary page scan.
vidyutkeśinm. () Name of a rākṣasa- View this entry on the original dictionary page scan.
vidyutkeśinm. (śin-) of a king of the rākṣasa-s View this entry on the original dictionary page scan.
vidyutparṇāf. Name of an apsaras- View this entry on the original dictionary page scan.
vidyutpātam. a stroke of lightning View this entry on the original dictionary page scan.
vidyutpatākam. "having lightning for its banner", Name of one of the seven clouds at the destruction of the world View this entry on the original dictionary page scan.
vidyutprabhamfn. flashing like lightning View this entry on the original dictionary page scan.
vidyutprabham. Name of a ṛṣi- View this entry on the original dictionary page scan.
vidyutprabham. of a king of the daitya-s View this entry on the original dictionary page scan.
vidyutprabhāf. Name of a granddaughter of the daitya- bali- View this entry on the original dictionary page scan.
vidyutprabham. of the daughter of a king of the rākṣasa-s View this entry on the original dictionary page scan.
vidyutprabham. of the daughter of a king of the yakṣa-s View this entry on the original dictionary page scan.
vidyutprabham. of a surāṅganā- View this entry on the original dictionary page scan.
vidyutprabham. of a serpent-maiden View this entry on the original dictionary page scan.
vidyutprabham. plural Name of a class of āpsarasa-s View this entry on the original dictionary page scan.
vidyutprapatanan. a stroke of lightning View this entry on the original dictionary page scan.
vidyutpriyan. "lightning-loved", brass, bell-metal View this entry on the original dictionary page scan.
vidyutpuñjam. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vidyutpuñjāf. Name of his daughter View this entry on the original dictionary page scan.
vidyutsampātamind. like a flash of lightning, id est in an instant, in a trice View this entry on the original dictionary page scan.
vidyutsanimfn. bringing lightning View this entry on the original dictionary page scan.
vidyutvatmfn. containing or charged with lightning (a cloud) View this entry on the original dictionary page scan.
vidyutvatm. a thunder-cloud View this entry on the original dictionary page scan.
vidyutvatm. Name of a mountain View this entry on the original dictionary page scan.
vidyutyamfn. being or existing in lightning (see ) View this entry on the original dictionary page scan.
vi(only Aorist -gāt-), to go or pass away, disappear View this entry on the original dictionary page scan.
vigadamf(ā-)n. (for 2.See under vi-gad-) free from disease, healthy, well View this entry on the original dictionary page scan.
vigadam. ( gad-;for 1.See) talking or sounding variously, confused shouting View this entry on the original dictionary page scan.
vigāḍhamfn. plunged into, entered (ambhasi vigāḍha-mātre-,"at the very moment of the water being plunged into") , one who has entered or plunged into, bathing in (locative case) View this entry on the original dictionary page scan.
vigāḍhamfn. (a weapon) that has deeply penetrated View this entry on the original dictionary page scan.
vigāḍhamfn. come on, advanced, begun, set in, taken place etc.
vigāḍhamfn. flowing copiously View this entry on the original dictionary page scan.
vigāḍhamfn. deep, excessive View this entry on the original dictionary page scan.
vigāḍhamanmathamfn. one whose passion has become deep or ardent View this entry on the original dictionary page scan.
vigāḍhṛmfn. one who plunges or penetrates into (genitive case) View this entry on the original dictionary page scan.
vigāḍhṛmfn. one who agitates or disturbs View this entry on the original dictionary page scan.
vigaditamfn. talked or spoken about, spread abroad (as a report) View this entry on the original dictionary page scan.
vigāhA1. -gāhate- (Epic also ti-), to plunge or dive into, bathe in, enter, penetrate, pervade, betake one's self into (accusative or locative case) etc. ; to pierce ; to agitate, disturb ; to be engrossed by or intent upon, ponder ; to follow, practise ; to reach, obtain ; to approach, fall (as night) : Passive voice -gāhyate-, to be plunged into or penetrated, to be entered into or engaged upon View this entry on the original dictionary page scan.
vigāhamfn. one who plunges into or penetrates (said of agni-) (see dur-vigāha-). View this entry on the original dictionary page scan.
vigāhyamfn. to be plunged into or entered (as the Ganges) View this entry on the original dictionary page scan.
vigaiP. -gāyati- (only Passive voice -gīyate-), to decry, abuse, reproach View this entry on the original dictionary page scan.
vigalP. -galati-, to flow or ooze away, drain off, dry up, melt or pass away, fall out or down, disappear, vanish View this entry on the original dictionary page scan.
vigalitamfn. flowed away, drained off, dried up View this entry on the original dictionary page scan.
vigalitamfn. melted away, dissolved View this entry on the original dictionary page scan.
vigalitamfn. fallen down or out, slipped out of (ablative) View this entry on the original dictionary page scan.
vigalitamfn. slackened, untied (See -nīvi-) View this entry on the original dictionary page scan.
vigalitamfn. dishevelled (See -keśa-) View this entry on the original dictionary page scan.
vigalitamfn. passed away, disappeared, vanished View this entry on the original dictionary page scan.
vigalitamfn. come forth View this entry on the original dictionary page scan.
vigalitabandhamfn. having the band loosened View this entry on the original dictionary page scan.
vigalitakeśamfn. having dishevelled hair View this entry on the original dictionary page scan.
vigalitalajjamfn. free from shame, bold View this entry on the original dictionary page scan.
vigalitanīvimfn. having the knot untied View this entry on the original dictionary page scan.
vigalitaśucmfn. freed from sorrow View this entry on the original dictionary page scan.
vigalitavasanamfn. destitute of garments, unclothed View this entry on the original dictionary page scan.
vigamP. -gacchati-, to go asunder, sever, separate ; to go away, depart, disappear, cease, die etc. etc.: Causal -gamayati-, to cause to go or pass away, speed (time) View this entry on the original dictionary page scan.
vigamam. going away, departure, cessation, end, absence etc. View this entry on the original dictionary page scan.
vigamam. (in fine compositi or 'at the end of a compound') abstention from, avoidance View this entry on the original dictionary page scan.
vigamacandram. Name of a prince View this entry on the original dictionary page scan.
vigāmann. a step, pace, stride (applied to the three strides of viṣṇu-) View this entry on the original dictionary page scan.
vigaṇP. -gaṇayati- (ind.p. -gaṇayya-), to reckon, compute, calculate (Passive voice to be reckoned id est amount to) ; to deliberate, consider, ponder etc. ; to regard as, take for (with double accusative) ; to esteem, regard (a-vigaṇayya-,"not taking notice of") ; to disregard, take no notice of View this entry on the original dictionary page scan.
vigānaSee under vi-gai-. View this entry on the original dictionary page scan.
vigānan. inconsistency, contradiction View this entry on the original dictionary page scan.
vigānan. repugnance View this entry on the original dictionary page scan.
vigānan. ill-report, detraction View this entry on the original dictionary page scan.
vigaṇanan. paying off, discharge (of a debt) View this entry on the original dictionary page scan.
vigaṇanan. reckoning, computing View this entry on the original dictionary page scan.
vigaṇanan. considering, deliberating View this entry on the original dictionary page scan.
vigandhamfn. having a bad smell View this entry on the original dictionary page scan.
vigandhamfn. odourless View this entry on the original dictionary page scan.
vigandhakam. Terminalia Catappa View this entry on the original dictionary page scan.
vigandhimfn. ill-smelling, stinking View this entry on the original dictionary page scan.
vigandhikāf. equals hapuṣā- View this entry on the original dictionary page scan.
vigaṇḍīran. a kind of small amaranth
vigaṇitamfn. reckoned, calculated View this entry on the original dictionary page scan.
vigaṇitamfn. considered, weighed View this entry on the original dictionary page scan.
vigaṇitamfn. reckoned off, discharged (as a debt) View this entry on the original dictionary page scan.
vigaram. "not swallowing", an abstemious man View this entry on the original dictionary page scan.
vigaram. a naked ascetic View this entry on the original dictionary page scan.
vigaram. a mountain View this entry on the original dictionary page scan.
vigarbhāf. delivered of a living child or fetus View this entry on the original dictionary page scan.
vigarhA1. -garhate- (rarely ti-), to blame, abuse, revile, reproach, despise, contemn etc.: Causal -garhayati-, to revile, rail at, vituperate View this entry on the original dictionary page scan.
vigarham. gaRa puṣkarādi-. View this entry on the original dictionary page scan.
vigarhāf. blame, censure View this entry on the original dictionary page scan.
vigarhaṇan. and f(ā-). the act of blaming, censure, reproach (naṃ-kṛ-,to blame) View this entry on the original dictionary page scan.
vigarhaṇīyamfn. reprehensible, bad, wicked View this entry on the original dictionary page scan.
vigarhinmfn. (in fine compositi or 'at the end of a compound') blaming View this entry on the original dictionary page scan.
vigarhiṇīf. a place abounding in vi-garha- gaRa puṣkarādi-. View this entry on the original dictionary page scan.
vigarhitamfn. blamed, reprehensible, prohibited, forbidden by (instrumental case genitive case,or compound) or on account of (compound) etc. View this entry on the original dictionary page scan.
vigarhitācāramfn. of reprehensible conduct View this entry on the original dictionary page scan.
vigarhyamfn. censurable, reprehensible View this entry on the original dictionary page scan.
vigarhyakathāf. reprehensible speech, censure View this entry on the original dictionary page scan.
vigarhyatāf. blame, reproach, censure (-tām pra--,to incur censure) View this entry on the original dictionary page scan.
vigarjP. -garjati-, to roar out, cry out View this entry on the original dictionary page scan.
vigarjāf. plural the roaring or thundering (of the ocean) View this entry on the original dictionary page scan.
vigatan. (for 2.See under vi-gam-) the flight of birds View this entry on the original dictionary page scan.
vigatamfn. (for 1.See under 1. v/i-) gone asunder, dispersed View this entry on the original dictionary page scan.
vigatamfn. gone away, departed, disappeared, ceased, gone (often in the beginning of a compound) etc. View this entry on the original dictionary page scan.
vigatamfn. dead, deceased View this entry on the original dictionary page scan.
vigatamfn. (in fine compositi or 'at the end of a compound') abstaining or desisting from View this entry on the original dictionary page scan.
vigatamfn. come from (see vidūra-vigata-), destitute of light, obscured, gloomy, dark View this entry on the original dictionary page scan.
vigatāf. a girl in love with another or unfit for marriage View this entry on the original dictionary page scan.
vigatabhayam. "free from fear", Name of a Brahman View this entry on the original dictionary page scan.
vigatabhīmfn. fearless View this entry on the original dictionary page scan.
vigatadvaṃdvam. "free from pairs of opposites", a buddha- (see dvaṃdva-) View this entry on the original dictionary page scan.
vigatajñānamfn. one who has lost his wits View this entry on the original dictionary page scan.
vigatajvaramfn. cured of fever, freed from feverishness or morbid feeling, freed from trouble or distress of mind View this entry on the original dictionary page scan.
vigatajvaramfn. exempt from decay View this entry on the original dictionary page scan.
vigatakalmaṣamfn. free from stain or soil or sin, sinless, pure, righteous
vigataklamamfn. one whose fatigues have ceased, relieved from fatigue View this entry on the original dictionary page scan.
vigatalakṣaṇamf(ā-)n. "devoid of good or lucky marks", unfortunate View this entry on the original dictionary page scan.
vigatamanyumfn. free from resentment View this entry on the original dictionary page scan.
vigatanāsikamf(ī-)n. noseless View this entry on the original dictionary page scan.
vigatanayanamfn. eyeless, blind View this entry on the original dictionary page scan.
vigatapuṃskamfn. castrated View this entry on the original dictionary page scan.
vigatarāgamfn. devoid of passion or affection ( vigatarāgadhvaja -dhvaja- m.Name of a preceptor ) View this entry on the original dictionary page scan.
vigatarāgadhvajam. vigatarāga
vigatārtavāf. a woman in whom the menstrual excretion has ceased View this entry on the original dictionary page scan.
vigatasaṃkalpamfn. devoid of purpose or design, without resolution View this entry on the original dictionary page scan.
vigatasaṃtrāsamfn. free from terror, intrepid View this entry on the original dictionary page scan.
vigatāśaṅkamfn. āśaṅkā
vigatasnehamfn. void of affection ( vigatasnehasauhṛda -sauhṛda- mfn.one who has relinquished love and friendship) View this entry on the original dictionary page scan.
vigatasnehasauhṛdamfn. vigatasneha
vigatāśokam. Name of a younger brother or a grandson of aśoka- View this entry on the original dictionary page scan.
vigataspṛhamfn. devoid of wish or desire, indifferent View this entry on the original dictionary page scan.
vigataśrīkamfn. destitute of fortune or splendour, unfortunate View this entry on the original dictionary page scan.
vigatāsumfn. lifeless, dead View this entry on the original dictionary page scan.
vigatatvan. the having disappeared, disappearance View this entry on the original dictionary page scan.
vigāthāand 1. View this entry on the original dictionary page scan.
vigatoddhavam. "free from levity", Name of buddha- View this entry on the original dictionary page scan.
vighanamfn. (for 2.See sub voce, i.e. the word in the Sanskrit order) not stiff or very stiff (See pūrṇa-vighana-) View this entry on the original dictionary page scan.
vighanamfn. cloudless (locative case"under a cloudless sky") View this entry on the original dictionary page scan.
vighanamfn. ( han-;for 1.See) injuring, hurting View this entry on the original dictionary page scan.
vighanam. an implement for striking, mallet, hammer View this entry on the original dictionary page scan.
vighanam. Name of two ekāha-s ( vighanatva -tv/a- n. ) View this entry on the original dictionary page scan.
vighanam. Name of indra- View this entry on the original dictionary page scan.
vighanatvan. vighana
vighanendum. a cloudless moon View this entry on the original dictionary page scan.
vighaninmfn. slaying, killing () View this entry on the original dictionary page scan.
vigharṣaṇan. ( ghṛṣ-) rubbing View this entry on the original dictionary page scan.
vighasam. or n. ( ghas-) food View this entry on the original dictionary page scan.
vighasam. the residue of an oblation of food (offered to the gods, to deceased ancestors, to a guest, or to a spiritual preceptor) (sam bahu-kṛ-,to make an ample meal) . View this entry on the original dictionary page scan.
vighasaśa() () mfn. one who eats the remains of an offering. View this entry on the original dictionary page scan.
vighasaśin() mfn. one who eats the remains of an offering. View this entry on the original dictionary page scan.
vighaṭ(often confounded with vi-ghaṭṭ-) A1. -ghaṭate-, to go or fly apart, become separate, disperse ; to be broken or interrupted or marred or frustrated or destroyed : Causal -ghaṭayati-, to tear or rend asunder, separate, disperse ; to mar, frustrate, annihilate, destroy View this entry on the original dictionary page scan.
vighātam. a stroke, blow with (compound) View this entry on the original dictionary page scan.
vighātam. breaking off or in pieces View this entry on the original dictionary page scan.
vighātam. driving back, warding off View this entry on the original dictionary page scan.
vighātam. destruction, ruin View this entry on the original dictionary page scan.
vighātam. removal, prohibition, prevention, interruption, impediment, obstacle etc. View this entry on the original dictionary page scan.
vighātam. failure, want of success View this entry on the original dictionary page scan.
vighātakamfn. impeding, interrupting View this entry on the original dictionary page scan.
vighaṭanan. breaking up, separation, dispersion, destruction, ruin View this entry on the original dictionary page scan.
vighātanamfn. warding off, averting View this entry on the original dictionary page scan.
vighātanan. impeding, interrupting, disturbing View this entry on the original dictionary page scan.
vighātanasiddhif. the settling or removal of obstacles or impediments View this entry on the original dictionary page scan.
vighaṭikāf. a particular measure of time (= 1/23 ghaṭikā-) View this entry on the original dictionary page scan.
vighātinmfn. fighting, slaying View this entry on the original dictionary page scan.
vighātinmfn. hurting, injuring View this entry on the original dictionary page scan.
vighātinmfn. opposing, impeding, preventing, interrupting View this entry on the original dictionary page scan.
vighaṭitamfn. broken, separated, divided, severed View this entry on the original dictionary page scan.
vighaṭṭ(see vi-ghaṭ-) A1. -ghaṭṭate-, to smash or break to pieces ; P. -ghaṭṭayati-, to strike or force asunder, open (a door), sever, disperse etc. ; to shake, stir, rub against View this entry on the original dictionary page scan.
vighaṭṭanamfn. opening View this entry on the original dictionary page scan.
vighaṭṭanāf. striking against View this entry on the original dictionary page scan.
vighaṭṭanāf. rubbing, friction View this entry on the original dictionary page scan.
vighaṭṭanāf. separation View this entry on the original dictionary page scan.
vighaṭṭanan. rubbing, friction View this entry on the original dictionary page scan.
vighaṭṭanan. moving to and fro, stirring, shaking (also plural) View this entry on the original dictionary page scan.
vighaṭṭanan. striking against View this entry on the original dictionary page scan.
vighaṭṭanan. striking asunder, forcing apart, hewing in pieces View this entry on the original dictionary page scan.
vighaṭṭanan. loosening, untying View this entry on the original dictionary page scan.
vighaṭṭanīyamfn. to be shaken or broken (manaḥ vighaṭṭanīyam-,"one should rack or cudgel one's brains about", with locative case) View this entry on the original dictionary page scan.
vighaṭṭanīyamfn. to be forced asunder or broken open, to be separated or set at variance View this entry on the original dictionary page scan.
vighaṭṭinmfn. (in fine compositi or 'at the end of a compound') rubbing View this entry on the original dictionary page scan.
vighaṭṭitamfn. broken, opened etc. View this entry on the original dictionary page scan.
vighaṭṭitamfn. violated, betrayed View this entry on the original dictionary page scan.
vighaṭṭitamfn. untied, undone View this entry on the original dictionary page scan.
vighaṭṭitamfn. hurt, offended View this entry on the original dictionary page scan.
vighnam. a breaker, destroyer View this entry on the original dictionary page scan.
vighnam. (Epic also n.) an obstacle, impediment, hindrance, opposition, prevention, interruption, any difficulty or trouble etc. View this entry on the original dictionary page scan.
vighnam. Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnam. Carissa Carandas View this entry on the original dictionary page scan.
vighnādhipam. equals vighna-pati- View this entry on the original dictionary page scan.
vighnadhvaṃsam. the removal of obstacles View this entry on the original dictionary page scan.
vighnahantṛm. "remover or destroyer of obstacles", Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnahārinmfn. removing obstacles View this entry on the original dictionary page scan.
vighnahārinm. Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnajitm. "conqueror of obstacles", Name of the god gaṇeśa- (this deity being supposed capable of either causing or removing difficulties and being therefore worshipped at the commencement of all undertakings)
vighnaka(in fine compositi or 'at the end of a compound') equals vi-ghna-, preventing, hindering View this entry on the original dictionary page scan.
vighnakaramfn. causing any obstacle or interruption, opposing, impeding, obstructing View this entry on the original dictionary page scan.
vighnakārinmfn. idem or 'mfn. idem or 'mfn. causing any obstacle or interruption, opposing, impeding, obstructing ' ' View this entry on the original dictionary page scan.
vighnakārinmfn. fearful or terrible to be looked at View this entry on the original dictionary page scan.
vighnakartṛmfn. idem or 'mfn. causing any obstacle or interruption, opposing, impeding, obstructing ' View this entry on the original dictionary page scan.
vighnakṛtmfn. equals -kara- etc. View this entry on the original dictionary page scan.
vighnaleśam. a slight obstacle View this entry on the original dictionary page scan.
vighnanāśakamfn. who or what removes obstacles or difficulties View this entry on the original dictionary page scan.
vighnanāśakam. Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnanāśanan. destruction or removal of obstacles View this entry on the original dictionary page scan.
vighnanāśanam. Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnanāyakam. "obstacle-chief", Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnāntakam. equals ghna-nāśaka- View this entry on the original dictionary page scan.
vighnapatim. "lord of obstacles", Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnapratikriyāf. counteraction or removal of an impediment View this entry on the original dictionary page scan.
vighnarājm. "obstacle king", Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnarājam. idem or 'm. "obstacle king", Name of gaṇeśa- ' View this entry on the original dictionary page scan.
vighnarājam. Name of an author View this entry on the original dictionary page scan.
vighnasiddhif. the settling or removal of obstacles View this entry on the original dictionary page scan.
vighnatantritamfn. gaRa tārakādi- (perhaps for vighnita-and tantrita-) View this entry on the original dictionary page scan.
vighnavatmfn. having obstacles, obstructed by difficulties or impediments View this entry on the original dictionary page scan.
vighnavighātam. removal of obstacles View this entry on the original dictionary page scan.
vighnavināyakam. "obstacle remover", Name of gaṇeśa- View this entry on the original dictionary page scan.
vighnayaNom. P. yati-, to impede, check, obstruct View this entry on the original dictionary page scan.
vighneśam. equals ghnapati- View this entry on the original dictionary page scan.
vighneśam. plural (with śaiva-s) Name of those who have attained a particular degree of emancipation View this entry on the original dictionary page scan.
vighneśadānavidhim. Name of work View this entry on the original dictionary page scan.
vighneśakāntāf. white-blossomed dūrvā- grass View this entry on the original dictionary page scan.
vighneśānam. equals -ghnapati- View this entry on the original dictionary page scan.
vighneśānakāntāf. equals ghneśa-kāntā- View this entry on the original dictionary page scan.
vighneśavāhanam. "vehicle of gaṇeśa-", a kind of rat View this entry on the original dictionary page scan.
vighneśvaram. equals ghna-pati- View this entry on the original dictionary page scan.
vighneśvaram. Name of a teacher ( vighneśvarakavaca -kavaca- n. vighneśvarasaṃhitā -saṃhitā- f. vighneśvarasahasranāman -sahasra-nāman- n. vighneśvarāṣṭottaraśata varāṣṭottara-śata- n.Name of works.) View this entry on the original dictionary page scan.
vighneśvarakavacan. vighneśvara
vighneśvarasahasranāmann. vighneśvara
vighneśvarasaṃhitāf. vighneśvara
vighneśvarāṣṭottaraśatan. vighneśvara
vighnitamfn. impeded, stopped, prevented, obstructed etc. View this entry on the original dictionary page scan.
vighnitadṛṣṭipātamfn. one whose sight is impeded, blinded View this entry on the original dictionary page scan.
vighnitakarmanmfn. one who is interrupted in his work View this entry on the original dictionary page scan.
vighnitapadamfn. one whose steps are impeded View this entry on the original dictionary page scan.
vighnitasamāgamasukhamfn. having the joy of union frustrated View this entry on the original dictionary page scan.
vighnitecchamfn. one whose wishes are disappointed, frustrated in one's desires View this entry on the original dictionary page scan.
vighoṣaṇan. the act of proclaiming aloud, proclamation, crying View this entry on the original dictionary page scan.
vighrāP. -jighrāti-, to smell or scent out, find out by smelling ; to smell, sniff, smell at View this entry on the original dictionary page scan.
vighṛṣṭamfn. excessively rubbed, sore View this entry on the original dictionary page scan.
vighṛtamf(ā-)n. (1. ghṛ-) besprinkled, dripping View this entry on the original dictionary page scan.
vighūṇikāf. the nose View this entry on the original dictionary page scan.
vighūrṇP. A1. -ghūrṇati-, te-, to roll or whirl about, be agitated View this entry on the original dictionary page scan.
vighūrṇanan. (orf(ā-).) swaying to and fro View this entry on the original dictionary page scan.
vighūrṇitamfn. rolled about, rolling, shaken, agitated View this entry on the original dictionary page scan.
vighuṣ(only ind.p. -ghuṣya-), to cry or proclaim aloud View this entry on the original dictionary page scan.
vighuṣṭamfn. proclaimed loudly, cried View this entry on the original dictionary page scan.
vighuṣṭamfn. made to resound, resounding, resonant, vocal View this entry on the original dictionary page scan.
vigītamfn. inconsistent, contradictory ( vigītatva -tva- n. ) View this entry on the original dictionary page scan.
vigītamfn. abused, reproached View this entry on the original dictionary page scan.
vigītamfn. sung or said in various ways View this entry on the original dictionary page scan.
vigītamfn. sung badly View this entry on the original dictionary page scan.
vigītatvan. vigīta
vigīti(for 2.See vi-gai-) f. two kinds of the āryā- metre View this entry on the original dictionary page scan.
viglaiCaus. -glāpayati-, to weary, distress, afflict View this entry on the original dictionary page scan.
viglāpanan. weariness, fatigue View this entry on the original dictionary page scan.
vigna vigra- See under vij-. View this entry on the original dictionary page scan.
vignamfn. shaken, agitated, terrified, alarmed View this entry on the original dictionary page scan.
vigopam. exposure, commitment View this entry on the original dictionary page scan.
vigṝ(only -gṛṇīṣe-in a very obscure passage ,where others read -vṛṇīṣe-). View this entry on the original dictionary page scan.
vigra mfn. (perhaps) strong, vigorous (according to equals medhāvin-) View this entry on the original dictionary page scan.
vigramfn. noseless (prob. for vi-ghra- see jighra-) View this entry on the original dictionary page scan.
vigramfn. (perhaps) strong, vigorous (according to equals medhāvin-) View this entry on the original dictionary page scan.
vigramfn. noseless (prob. for vi-ghra- see jighra-) View this entry on the original dictionary page scan.
vigrahP. A1. -gṛhṇāti-, ṇīte- (Ved. also -gṛbhṇāti-, ṇīte-), to stretch out or apart, spread out ; to distribute, divide (especially to draw out fluids at several times) ; to hold apart, separate, isolate ; (in gram.) to analyse (see vi-graha-) ; to wage war, fight against (accusative) ; to quarrel, contend with (instrumental case with or without saha-,or rdham-) etc. ; to seize, lay hold of (accusative or locative case) ; to receive in a friendly manner, welcome ; to perceive, observe : Causal -grāhayati-, to cause to fight, cause to wage war against, das-. : Desiderative -jighṛkṣati-, to wish to fight against View this entry on the original dictionary page scan.
vigrahamfn. (for 2.See vi-grah-) freed from"the Seizer" id est rāhu- (said of the moon) View this entry on the original dictionary page scan.
vigraham. (for 1.See p.950. column 2) keeping apart or asunder, isolation View this entry on the original dictionary page scan.
vigraham. division, View this entry on the original dictionary page scan.
vigraham. distribution (especially of fluids see vi-grah-) View this entry on the original dictionary page scan.
vigraham. (in gram.) independence (of a word, as opp. to composition) View this entry on the original dictionary page scan.
vigraham. separation, resolution, analysis, resolution of a compound word into its constituent parts, the separation or analysis of any word capable of separation (such words are kṛdanta-s, taddhita-s, all samāsa-s or compound words, ekaśeṣa-s, and all derivative verbs like desideratives etc.;the only words incapable of resolution being the simple verb, the singular of the noun, and a few indeclinables not derived from roots;all compounds being called nitya-or"fixed", when their meaning cannot be ascertained through an analysis of their component parts; see jamad-agni-) etc. View this entry on the original dictionary page scan.
vigraham. discord, quarrel, contest, strife, war with (instrumental case with or without saha-, rdham-or sākam- locative case genitive case with upari-,or compound) etc. View this entry on the original dictionary page scan.
vigraham. (one of the 6 guṇa-s or measures of policy [ see under guṇa-],also applied to the conflict of hostile planets, in this sense also n. ; accusative with kṛ-,to make or wage war) View this entry on the original dictionary page scan.
vigraham. separate id est individual form or shape, form, figure, the body etc. (also applied to the shape of a rainbow; accusative with grah-, pari-grah-, kṛ-, upā--,to assume a form) View this entry on the original dictionary page scan.
vigraham. an ornament, decoration View this entry on the original dictionary page scan.
vigraham. (in sāṃkhya-) an element View this entry on the original dictionary page scan.
vigraham. Name of śiva-
vigraham. of one of skanda-'s attendants View this entry on the original dictionary page scan.
vigrāham. a particular kind of recitation View this entry on the original dictionary page scan.
vigrahadhyānan. Name of a stotra- View this entry on the original dictionary page scan.
vigrahagrahaṇan. the assumption of a form View this entry on the original dictionary page scan.
vigrāhamind. in portions, successively View this entry on the original dictionary page scan.
vigrahaṇan. diffusion, distribution View this entry on the original dictionary page scan.
vigrahaṇan. taking hold of, seizure View this entry on the original dictionary page scan.
vigrahapāladevam. Name of a king View this entry on the original dictionary page scan.
vigrahaparamfn. intent on war, engaged in fighting View this entry on the original dictionary page scan.
vigrahaparigraham. equals -grahaṇa- View this entry on the original dictionary page scan.
vigraharājam. Name of various kings View this entry on the original dictionary page scan.
vigraharājam. of a poet View this entry on the original dictionary page scan.
vigrahāvaran. "hinder part of the body", the back View this entry on the original dictionary page scan.
vigrahavatmfn. having form or figure, embodied, incarnate etc. View this entry on the original dictionary page scan.
vigrahavatmfn. having a handsome form or shape, fine, beautiful View this entry on the original dictionary page scan.
vigrahavyāvartanīf. Name of work View this entry on the original dictionary page scan.
vigrahayaNom. P. yati-, to contend or fight with (rdham-) View this entry on the original dictionary page scan.
vigrahecchumfn. eager for combat View this entry on the original dictionary page scan.
vigrahinmfn. waging war View this entry on the original dictionary page scan.
vigrahinmfn. a minister of war View this entry on the original dictionary page scan.
vigrāhitamfn. "taken hold of", prejudiced View this entry on the original dictionary page scan.
vigrāhyamfn. to be warred upon or contended with View this entry on the original dictionary page scan.
vigrath(or granth-) P. -grathnāti-, to connect, tie or bind together, wind round View this entry on the original dictionary page scan.
vigrathitamfn. (v/i--) tied together View this entry on the original dictionary page scan.
vigrathitamfn. bound up (as a wound) View this entry on the original dictionary page scan.
vigrathitamfn. having knots or tubercles View this entry on the original dictionary page scan.
vigrathitamfn. hindered, impeded View this entry on the original dictionary page scan.
vigṛhītamfn. stretched out or apart etc. View this entry on the original dictionary page scan.
vigṛhītamfn. changed View this entry on the original dictionary page scan.
vigṛhyaind. having stretched out or apart etc. View this entry on the original dictionary page scan.
vigṛhyaind. having warred against or contended with, aggressive, inimical (See compound) View this entry on the original dictionary page scan.
vigṛhyamfn. to be (or being) separated or isolated, independent (in the pada-pāṭha-) View this entry on the original dictionary page scan.
vigṛhyagamanan. aggressive movement, hostile advance View this entry on the original dictionary page scan.
vigṛhyasambhāṣāf. idem or 'm. word-fight, discussion, disputation ' View this entry on the original dictionary page scan.
vigṛhyāsanan. "besieging"or"sulkily encamping with" (instrumental case) View this entry on the original dictionary page scan.
vigṛhyavādam. word-fight, discussion, disputation View this entry on the original dictionary page scan.
vigṛhyayānan. aggressive movement, hostile advance View this entry on the original dictionary page scan.
vigrīva(v/i--) mfn. having the neck twisted or cut off View this entry on the original dictionary page scan.
vigūḍhamfn. ( guh-) concealed, hidden View this entry on the original dictionary page scan.
vigūḍhamfn. blamed, censured View this entry on the original dictionary page scan.
vigūḍhacārinmfn. proceeding or acting secretly View this entry on the original dictionary page scan.
vigulphamfn. (see vi-phalka-) abundant, plentiful View this entry on the original dictionary page scan.
viguṇamfn. without a string (See below) View this entry on the original dictionary page scan.
viguṇamfn. deficient, imperfect, destitute of (compound) etc. View this entry on the original dictionary page scan.
viguṇamfn. unsuccessful, ineffective View this entry on the original dictionary page scan.
viguṇamfn. adverse (as fortune) (varia lectio) View this entry on the original dictionary page scan.
viguṇamfn. void of qualities View this entry on the original dictionary page scan.
viguṇamfn. destitute of merits, wicked, bad etc. View this entry on the original dictionary page scan.
viguṇamfn. disordered, corrupted (as the humours of the body) View this entry on the original dictionary page scan.
viguṇatāf. disordered condition, corruption View this entry on the original dictionary page scan.
viguṇīkṛP. -karoti-, to detach the string of a bow View this entry on the original dictionary page scan.
vigup Desiderative -jugupsate-, to shrink away from, wish to conceal from View this entry on the original dictionary page scan.
viA1. -jihīte-, to go apart, become expanded, start asunder, open, fly open, gape, yawn : Caus: -hāpayati-, to cause to gape, open View this entry on the original dictionary page scan.
viha(only in the beginning of a compound) the sky, air. View this entry on the original dictionary page scan.
viind. equals svarga-, heaven View this entry on the original dictionary page scan.
viP. -jahāti-, (ind.p. -hāya-See below) , to leave behind, relinquish, quit, abandon etc. etc. (with śarīram-, prāṇan-etc., "to abandon the body or life", to die) ; to give up, cast off, renounce, resign etc. ; to be deprived of, lose ; to get rid of or free from (accusative) ; to desist from (ablative) ; to stop, pause : Passive voice -hīyate- (Aorist -hāyi-), to be left behind ; to be inferior to (ablative) ; to be lost : Causal -hāpayati- See next: Desiderative -jihāsati-, to wish to leave or abandon View this entry on the original dictionary page scan.
vihaga vihaṃ-ga- etc. See under vi-- 1. - below. View this entry on the original dictionary page scan.
vihagam. "sky-goer", a bird etc. View this entry on the original dictionary page scan.
vihagam. an arrow View this entry on the original dictionary page scan.
vihagam. the sun View this entry on the original dictionary page scan.
vihagam. the moon View this entry on the original dictionary page scan.
vihagam. a planet View this entry on the original dictionary page scan.
vihagam. a particular configuration of stars (when all the planets are situated in the 4th and 10th houses) View this entry on the original dictionary page scan.
vihagagādhipam. (equals -pati-) View this entry on the original dictionary page scan.
vihagagālayam. "abode of birds."the air, sky View this entry on the original dictionary page scan.
vihagagopaghuṣṭamfn. resonant with birds View this entry on the original dictionary page scan.
vihagapatim. "king of birds", Name of garuḍa- View this entry on the original dictionary page scan.
vihagavegam. "having the swiftness of a bird", Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vihagendram. (equals -pati-), View this entry on the original dictionary page scan.
vihagendrasaṃhitāf. Name of Tantric work View this entry on the original dictionary page scan.
vihagendrasampātam. Name of Tantric work View this entry on the original dictionary page scan.
vihalham. (of unknown meaning) View this entry on the original dictionary page scan.
vihaṃgamfn. sky-going, flying View this entry on the original dictionary page scan.
vihaṃgam. equals vihaga-, a bird etc. View this entry on the original dictionary page scan.
vihaṃgam. an arrow View this entry on the original dictionary page scan.
vihaṃgam. a cloud View this entry on the original dictionary page scan.
vihaṃgam. the sun View this entry on the original dictionary page scan.
vihaṃgam. the moon View this entry on the original dictionary page scan.
vihaṃgam. Name of a serpent-demon View this entry on the original dictionary page scan.
vihaṃgahanm. a bird-killer, bird-catcher View this entry on the original dictionary page scan.
vihaṃgakam. a little bird, any bird View this entry on the original dictionary page scan.
vihaṃgamamfn. moving in the sky, flying View this entry on the original dictionary page scan.
vihaṃgamam. (in fine compositi or 'at the end of a compound' f(ā-).) a bird etc. View this entry on the original dictionary page scan.
vihaṃgamam. the sun View this entry on the original dictionary page scan.
vihaṃgamam. Name of a class of gods under the 11th manu- View this entry on the original dictionary page scan.
vihaṃgamāf. a female bird View this entry on the original dictionary page scan.
vihaṃgamam. next View this entry on the original dictionary page scan.
vihaṃgamikāf. a sort of yoke (equals vihaṃ-gikā-) View this entry on the original dictionary page scan.
vihaṃgarājam. (equals vihaga-pati-) View this entry on the original dictionary page scan.
vihaṃgārātim. "bird-enemy", a falcon or hawk. View this entry on the original dictionary page scan.
vihaṃgikāf. a sort of pole or yoke for carrying burdens View this entry on the original dictionary page scan.
vihaṃgikāf. Name of a woman View this entry on the original dictionary page scan.
vihan(often wrong reading for ni-han-) P. -hanti-, to strike apart or asunder, disperse, shatter, break, destroy ; to beat asunder, extend (a skin) ; to tear off ; to unbind, loosen (hair) ; to ward off, repel ; to keep back, withhold, refuse ; to hinder, interrupt, disturb, prevent, frustrate, annihilate etc.: Passive voice -hanyate-, to be frustrated or disappointed, exert one's self in vain : Causal -ghātayati-, te-, to beat, vanquish, defeat ; (A1.) to afflict, distress, annoy ; to interrupt, disturb on : Desiderative -jighāṃsati-, to wish to interrupt or disturb : Intensive (-jījahi-?), to harm, injure
vihāna(?) m. n. morning, dawn View this entry on the original dictionary page scan.
vihananan. (only ) killing, slaying View this entry on the original dictionary page scan.
vihananan. hurting, injury View this entry on the original dictionary page scan.
vihananan. opposition, obstruction View this entry on the original dictionary page scan.
vihananan. a bow-like instrument for carding cotton. View this entry on the original dictionary page scan.
vihantavyamfn. to be destroyed View this entry on the original dictionary page scan.
vihantṛmfn. one who destroys or frustrates or disappoints (with genitive case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vihāpitamfn. (fr. Causal) caused to abandon or give up etc. View this entry on the original dictionary page scan.
vihāpitamfn. given View this entry on the original dictionary page scan.
vihāpitamfn. extorted View this entry on the original dictionary page scan.
vihāpitan. a gift, donation
viharam. taking away, removing, shifting, changing View this entry on the original dictionary page scan.
viharam. separation, disunion, absence View this entry on the original dictionary page scan.
vihāram. (once in n.) distribution, transposition (of words) View this entry on the original dictionary page scan.
vihāram. arrangement or disposition (of the 3 sacred fires;also applied to the fires themselves or the space between them), View this entry on the original dictionary page scan.
vihāram. too great expansion of the organs of speech (consisting in too great lengthening or drawling in pronunciation, opp. to saṃ-hāra- q.v) View this entry on the original dictionary page scan.
vihāram. walking for pleasure or amusement, wandering, roaming etc. View this entry on the original dictionary page scan.
vihāram. sport, play, pastime, diversion, enjoyment, pleasure ("in"or"with" compound; in fine compositi or 'at the end of a compound' also = taking delight in) etc. View this entry on the original dictionary page scan.
vihāram. a place of recreation, pleasure-ground etc. View this entry on the original dictionary page scan.
vihāram. (with Buddhists or jaina-s) a monastery or temple (originally a hall where the monks met or walked about;afterwards these halls were used as temples) etc. (see ) View this entry on the original dictionary page scan.
vihāram. consecration for a sacrifice View this entry on the original dictionary page scan.
vihāram. Name of the country of magadha- (called Bihar or Behar from the number of Buddhist monasteriesSee ) View this entry on the original dictionary page scan.
vihāram. the shoulder View this entry on the original dictionary page scan.
vihāram. a particular bird (equals bindurekaka-) View this entry on the original dictionary page scan.
vihāram. equals vaijayanta- View this entry on the original dictionary page scan.
vihārabhadram. Name of a man View this entry on the original dictionary page scan.
vihārabhūmif. equals -deśa- View this entry on the original dictionary page scan.
vihārabhūmim. a grazing-ground, pasturage View this entry on the original dictionary page scan.
vihāradāsīf. a female attendant of a convent or temple View this entry on the original dictionary page scan.
vihāradeśam. a place of recreation, pleasure-ground View this entry on the original dictionary page scan.
vihāragṛhan. a pleasure-house, play-house, theatre View this entry on the original dictionary page scan.
vihārājiran. (equals radeśa-) View this entry on the original dictionary page scan.
vihārakamf(ikā-)n. delighting in (compound) View this entry on the original dictionary page scan.
vihārakamf(ikā-)n. serving for the amusement of (compound) View this entry on the original dictionary page scan.
vihārakamf(ikā-)n. roaming or walking about, a roamer View this entry on the original dictionary page scan.
vihārakamf(ikā-)n. belonging to a Buddhist temple or convent View this entry on the original dictionary page scan.
vihārakārikāf. plural Name of work View this entry on the original dictionary page scan.
vihārakrīḍāmṛgam. a toy-antelope to play with View this entry on the original dictionary page scan.
viharaṇan. the act of taking away or removing or changing or transposing View this entry on the original dictionary page scan.
viharaṇan. opening, expanding View this entry on the original dictionary page scan.
viharaṇan. stepping out View this entry on the original dictionary page scan.
viharaṇan. going about for pleasure or exercise, roaming, strolling View this entry on the original dictionary page scan.
viharaṇan. taking out for a walk or for airing View this entry on the original dictionary page scan.
viharaṇan. moving to and fro, brandishing View this entry on the original dictionary page scan.
vihāraṇan. pleasure, delight (in fine compositi or 'at the end of a compound' = delighting in) View this entry on the original dictionary page scan.
viharaṇīyamfn. to be taken away View this entry on the original dictionary page scan.
viharaṇīyamfn. to be rambled or sported
vihāraśailam. a pleasure-mountain View this entry on the original dictionary page scan.
vihāraśayanan. a pleasure-couch View this entry on the original dictionary page scan.
vihārasthalīf. () View this entry on the original dictionary page scan.
vihārasthānan. () View this entry on the original dictionary page scan.
vihāravanan. a pleasure-grove View this entry on the original dictionary page scan.
vihāravāpīf. "pleasure-pond", Name of work View this entry on the original dictionary page scan.
vihāravārin. water for sporting or playing about in View this entry on the original dictionary page scan.
vihārāvasatham. (equals ra-gṛha-) View this entry on the original dictionary page scan.
vihāravatmfn. possessing a place of recreation View this entry on the original dictionary page scan.
vihāravatmfn. (in fine compositi or 'at the end of a compound') delighting in View this entry on the original dictionary page scan.
vihārayātrāf. a pleasure-walk View this entry on the original dictionary page scan.
vihārinmfn. wandering about for pleasure, roaming, strolling etc. View this entry on the original dictionary page scan.
vihārinmfn. going as far as, extending to (compound) View this entry on the original dictionary page scan.
vihārinmfn. dependent on (compound) View this entry on the original dictionary page scan.
vihārinmfn. enjoying one's self with, delighting in, given or addicted to, fond of (compound) etc. View this entry on the original dictionary page scan.
vihārinmfn. charming, beautiful (varia lectio) View this entry on the original dictionary page scan.
vihāriṇīf. a girl too fond of gadding about (unfit for marriage) View this entry on the original dictionary page scan.
vihārisiṃham. Name of a king View this entry on the original dictionary page scan.
viharṣam. excessive joy or gladness View this entry on the original dictionary page scan.
viharṣamfn. joyless, sad View this entry on the original dictionary page scan.
viharṣa vi-hasta- etc. See . View this entry on the original dictionary page scan.
vihartṛm. one who takes away, a robber View this entry on the original dictionary page scan.
vihartṛm. one who rambles about or enjoys himself View this entry on the original dictionary page scan.
vihāruhāf. a species of plant View this entry on the original dictionary page scan.
viharyP. -haryati-, to scorn, repudiate (see a-viharyata-kratu-). View this entry on the original dictionary page scan.
vihasP. -hasati-, to laugh loudly, burst out laughing etc. ; to laugh at (accusative,rarely genitive case) View this entry on the original dictionary page scan.
vihāsam. laughing, laughter View this entry on the original dictionary page scan.
vihāsamfn. opened View this entry on the original dictionary page scan.
vihasanan. idem or 'f. gentle laughter, smiling (varia lectio sitikā-).' View this entry on the original dictionary page scan.
vihasatikāf. gentle laughter, smiling (varia lectio sitikā-). View this entry on the original dictionary page scan.
vihasitamfn. laughing, smiling View this entry on the original dictionary page scan.
vihasitamfn. laughed, smiled at View this entry on the original dictionary page scan.
vihasitan. laughter, laughing, smiling View this entry on the original dictionary page scan.
vihasitikāSee hasatikā-. View this entry on the original dictionary page scan.
vihastamfn. without a hand or trunk, handless ( vihastatā -- f. ) View this entry on the original dictionary page scan.
vihastamfn. unhandy, inexperienced (See a-vih-) View this entry on the original dictionary page scan.
vihastamfn. confounded, perplexed, helpless ( vihastatā -- f. ) View this entry on the original dictionary page scan.
vihastamfn. (in fine compositi or 'at the end of a compound') completely absorbed in View this entry on the original dictionary page scan.
vihastamfn. adroit, skilled, experienced (in; compound) View this entry on the original dictionary page scan.
vihastamfn. wise, learned View this entry on the original dictionary page scan.
vihastam. a eunuch View this entry on the original dictionary page scan.
vihastatāf. vihasta
vihastatāf. vihasta
vihastitamfn. confused, embarrassed View this entry on the original dictionary page scan.
vihatf. equals vehat- View this entry on the original dictionary page scan.
vihatamfn. torn up, furrowed View this entry on the original dictionary page scan.
vihatamfn. struck or beaten away or dashed out (of a person's hand) View this entry on the original dictionary page scan.
vihatamfn. struck or touched or visited by (instrumental case or compound) View this entry on the original dictionary page scan.
vihatamfn. warded off, repelled View this entry on the original dictionary page scan.
vihatamfn. rejected, repulsed View this entry on the original dictionary page scan.
vihatamfn. disturbed, impeded View this entry on the original dictionary page scan.
vihatif. a stroke, blow View this entry on the original dictionary page scan.
vihatif. striking, killing View this entry on the original dictionary page scan.
vihatif. prevention, removal View this entry on the original dictionary page scan.
vihatif. repulse, defeat View this entry on the original dictionary page scan.
vihatim. a friend, companion View this entry on the original dictionary page scan.
vihavam. invocation View this entry on the original dictionary page scan.
vihavīyan. "containing the word vihava- ", Name of the hymn View this entry on the original dictionary page scan.
vihavya mfn. to be invoked or invited or desired View this entry on the original dictionary page scan.
vihavyam. (with āṅgirasa-) Name of the supposed author of View this entry on the original dictionary page scan.
vihavyam. of a son of varcas- View this entry on the original dictionary page scan.
vihavyāf. Name of particular bricks View this entry on the original dictionary page scan.
vihavyaf. (scilicet kta-) Name of (see havīya-) View this entry on the original dictionary page scan.
vihavyamfn. to be invoked or invited or desired View this entry on the original dictionary page scan.
vihavyam. (with āṅgirasa-) Name of the supposed author of View this entry on the original dictionary page scan.
vihavyam. of a son of varcas- View this entry on the original dictionary page scan.
vihavyāf. Name of particular bricks View this entry on the original dictionary page scan.
vihavyam. (scilicet kta-) Name of (see havīya-) View this entry on the original dictionary page scan.
vihāyaind. leaving behind id est at a distance from (accusative) View this entry on the original dictionary page scan.
vihāyaind. disregarding, overlooking, setting aside = more than (accusative) etc. View this entry on the original dictionary page scan.
vihāyaind. in spite of, notwithstanding (accusative) View this entry on the original dictionary page scan.
vihāyaind. excepting, with the exception of (accusative) View this entry on the original dictionary page scan.
vihāyas(v/i--) mfn. (for 2., from which perhaps it is scarcely separableSee vi--) vigorous, active, mighty (according to to Scholiast or Commentator equals mahat-, vañcanavat-, vyāptṛ-, vividha-gamana-yukta-). View this entry on the original dictionary page scan.
vihāyasmn. (for 1.See) the open space (see vi-yat-), air, sky, atmosphere etc. (also vihāyasaḥsthalī saḥ-sthalī- f.or vihāyasastala sas-tala- n.; instrumental case -,"through the sky") View this entry on the original dictionary page scan.
vihāyasm. a bird View this entry on the original dictionary page scan.
vihāyasamn. heaven, sky, atmosphere View this entry on the original dictionary page scan.
vihāyasam. a bird View this entry on the original dictionary page scan.
vihāyasāgāminmfn. able to move through the sky View this entry on the original dictionary page scan.
vihāyasaḥsthalīf. vihāyas
vihāyasastalan. vihāyas
vihel Causal A1. -helayate-, to vex, annoy (Bombay edition -ghātayate-). View this entry on the original dictionary page scan.
viheṭh Causal P. -heṭhayati-, to hurt, injure View this entry on the original dictionary page scan.
viheṭham. hurt, injury View this entry on the original dictionary page scan.
viheṭhakamfn. hurting, injuring, an injurer View this entry on the original dictionary page scan.
viheṭhakamfn. a reviler View this entry on the original dictionary page scan.
viheṭhanan. the act of hurting, injuring, distressing, afflicting etc. View this entry on the original dictionary page scan.
vihiṃsP. -hiṃsati-, to injure severely, hurt, damage etc.: Causal -hiṃsayati- idem or 'f. a species of plant ' View this entry on the original dictionary page scan.
vihiṃsāf. ( ) idem or 'n. () idem or 'f. the act of harming or injuring (with locative case) ' (with genitive case or in fine compositi or 'at the end of a compound')' (with genitive case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vihiṃsakamfn. injuring, hurting, harming (with genitive case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vihiṃsanan. () idem or 'f. the act of harming or injuring (with locative case) ' (with genitive case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vihiṃsatāf. the act of harming or injuring (with locative case) View this entry on the original dictionary page scan.
vihiṃsitamfn. injured, hurt, damaged etc. View this entry on the original dictionary page scan.
vihiṃsraSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vihiṃsraSee a-vihiṃsra-. View this entry on the original dictionary page scan.
vihīnamfn. entirely abandoned or left etc. View this entry on the original dictionary page scan.
vihīnamfn. low, vulgar View this entry on the original dictionary page scan.
vihīnamfn. (in the beginning of a compound) wanting, missing, absent View this entry on the original dictionary page scan.
vihīnamfn. destitute or deprived of, free from (instrumental case ablative,or compound) etc. View this entry on the original dictionary page scan.
vihīnaf. (in fine compositi or 'at the end of a compound') absence or want of View this entry on the original dictionary page scan.
vihīnatāf. abandonment View this entry on the original dictionary page scan.
vihīnatilakamf(ā-)n. having no coloured sectarian mark (See tilaka-) on the forehead View this entry on the original dictionary page scan.
vihīnavarṇamfn. of low caste View this entry on the original dictionary page scan.
vihīnayonimfn. of low origin View this entry on the original dictionary page scan.
vihīnitamfn. deprived of (with inst.) View this entry on the original dictionary page scan.
vihitamfn. (forSee under vi-dhā-) improper, unfit, not good View this entry on the original dictionary page scan.
vihitaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vihitamfn. (fr., vi--1. dhā-,p.967;for 1. vi-hita-See) distributed, divided, apportioned, bestowed, supplied etc. View this entry on the original dictionary page scan.
vihitamfn. put in order, arranged, determined, fixed, ordained, ordered etc. View this entry on the original dictionary page scan.
vihitamfn. prescribed, decreed, enjoined etc. View this entry on the original dictionary page scan.
vihitamfn. destined or meant for (Nominal verb) View this entry on the original dictionary page scan.
vihitamfn. contrived, performed, made, accomplished, done etc. View this entry on the original dictionary page scan.
vihitamfn. supplied, endowed, furnished with or possessed of (instrumental case) (see su-vihita-) View this entry on the original dictionary page scan.
vihitan. an order, command, decree View this entry on the original dictionary page scan.
vihitadurgaracanamfn. one who has enjoined the building of a fortress View this entry on the original dictionary page scan.
vihitāgasmfn. one who has committed a fault, faulty, wicked View this entry on the original dictionary page scan.
vihitakṣaṇamfn. eager for the right moment, intent upon (artham-) (see kṛta-kṣ-) View this entry on the original dictionary page scan.
vihitāñjalimfn. making a respectful obeisance View this entry on the original dictionary page scan.
vihitapratiṣiddhamfn. enjoined and prohibited ( vihitapratiṣiddhatva -tva- n.) View this entry on the original dictionary page scan.
vihitapratiṣiddhatvan. vihitapratiṣiddha
vihitasenam. Name of a prince View this entry on the original dictionary page scan.
vihitatvan. the being enjoined or prescribed, prescription, direction View this entry on the original dictionary page scan.
vihitavatmfn. one who has performed or undertaken View this entry on the original dictionary page scan.
vihitavṛttimfn. one who is maintained or nourished by (instrumental case) View this entry on the original dictionary page scan.
vihitayajñamfn. performing sacrifices (varia lectio for vitata-y-) View this entry on the original dictionary page scan.
vihitendriyamfn. possessed of one's senses View this entry on the original dictionary page scan.
vihitif. procedure, way of acting View this entry on the original dictionary page scan.
vihitif. action, performance, accomplishment View this entry on the original dictionary page scan.
vihitrimamfn. done according to rule View this entry on the original dictionary page scan.
viḥkṛndhikāf. a croaking sound, croaking (Scholiast or Commentator) View this entry on the original dictionary page scan.
vihmalCaus. -hmalayati- View this entry on the original dictionary page scan.
vihnuA1. -hnute- Scholiast or Commentator on View this entry on the original dictionary page scan.
vihṛP. -harati- (rarely A1.), to put asunder, keep apart, separate, open ; to distribute and transpose (verses or parts of verses) ; to disperse (clouds, opp. to saṃ-hṛ-) ; (with talāt talam-) to shift, let pass from hand to hand ; to divide (also arithmetically) ; to construct (in geometry) ; to cut off, sever ; to extract from (ablative) ; to carry away, remove ; to tear in pieces, lacerate ; to move on, walk ; to spend or pass (time) etc. ; to roam, wander through (accusative) ; (especially) to walk or roam about for pleasure, divert one's self etc. (with mṛgayām-,"to go about hunting" ) ; to shed (tears) : Desiderative See vi-jihīrṣā-, ṣu- () . View this entry on the original dictionary page scan.
vihradinmfn. (perhaps) making pools View this entry on the original dictionary page scan.
vihṛdaya(v/i--) n. want of courage View this entry on the original dictionary page scan.
vihṛtamfn. set or put asunder, distributed, disposed etc. View this entry on the original dictionary page scan.
vihṛtamfn. transposed, varied (as words or pāda-s) View this entry on the original dictionary page scan.
vihṛtan. a walk View this entry on the original dictionary page scan.
vihṛtan. hesitation, reluctance, bashful silence (one of the 10 hāva-s or feminine modes of indicating love) View this entry on the original dictionary page scan.
vihṛtaṣoḍaśīf. Name of work View this entry on the original dictionary page scan.
vihṛtif. expansion, increase, growth View this entry on the original dictionary page scan.
vihṛtif. sport, pastime, pleasure View this entry on the original dictionary page scan.
vihṛtif. taking away View this entry on the original dictionary page scan.
vihru(see vi-hvṛ-below) P. -hruṇāti-, to cause to deviate, turn aside, frustrate, spoil View this entry on the original dictionary page scan.
vihrutf. a serpent-like animal, worm etc. View this entry on the original dictionary page scan.
vihruta(v/i--) mfn. crooked, dislocated, hurt, injured View this entry on the original dictionary page scan.
vihuṇḍanam. ( huṇḍ-) Name of one of śiva-'s attendants View this entry on the original dictionary page scan.
vihurch(or -hūrch-) P. -hūrchati-, to waddle, toddle, sway from one side to another (applied to a corpulent person's gait) ; to stagger, totter, stumble View this entry on the original dictionary page scan.
vihutmatmfn. presenting no offerings View this entry on the original dictionary page scan.
vihutmatmfn. ("offering, invoking") View this entry on the original dictionary page scan.
vihutmatīf. a special oblation View this entry on the original dictionary page scan.
vihvalP. -hvalati-, to shake or sway to and fro, tremble, be agitated or unsteady, stagger View this entry on the original dictionary page scan.
vihvalamf(ā-)n. agitated, perturbed, distressed, afflicted, annoyed ( vihvalam am- ind.) etc. View this entry on the original dictionary page scan.
vihvalam. myrrh View this entry on the original dictionary page scan.
vihvalacetana() mfn. distressed in mind, low-spirited View this entry on the original dictionary page scan.
vihvalacetas() mfn. distressed in mind, low-spirited View this entry on the original dictionary page scan.
vihvalahṛdayamfn. (equals -cetana-) View this entry on the original dictionary page scan.
vihvalākṣamf(ī-)n. (equals la-locana-) View this entry on the original dictionary page scan.
vihvalalocanamfn. one who has unsteady or rolling eyes View this entry on the original dictionary page scan.
vihvalamind. vihvala
vihvalāṅgamfn. (equals la-tanu-) View this entry on the original dictionary page scan.
vihvalasālasāṅgamf(ī-)n. one whose body is exhausted and languid View this entry on the original dictionary page scan.
vihvalatāf. agitation, perturbation, consternation, anxiety
vihvalatanumfn. one whose body is exhausted by (compound) View this entry on the original dictionary page scan.
vihvalātmanmfn. (equals la-cetana-) View this entry on the original dictionary page scan.
vihvalatvan. agitation, perturbation, consternation, anxiety
vihvalīkṛtamfn. made confused or agitated View this entry on the original dictionary page scan.
vihvalīkṛtamfn. fused, liquid View this entry on the original dictionary page scan.
vihvalitamfn. equals hvala- etc. View this entry on the original dictionary page scan.
vihvalitasarvāṅgamfn. trembling with the whole body View this entry on the original dictionary page scan.
vihvaritaSee vi-hvṛ-. View this entry on the original dictionary page scan.
vihvaritamfn. staggered, fallen (Vedic according to to on ). View this entry on the original dictionary page scan.
vihvārukamfn. tumbling, falling View this entry on the original dictionary page scan.
vihveA1. -hvayate- (see ), to call in different places, call, invoke, vie in calling, contend for anything View this entry on the original dictionary page scan.
vihvṛ(see vi-hru-), to stagger, stumble, fall (see a-vihvarat-): Caus. (only Aorist subjunctive -jihvaraḥ-), to cause to fall, overthrow View this entry on the original dictionary page scan.
vij (confer, compare vic-) cl.6 A1. vij/ate- (mc. also vijati-and vejate-,and according to to also cl.1 P. vinakti-,and cl.3 P. A1. vevekti-, vevikte-; perfect tense vivije-,3. plural jre- ; Aorist vikthās-, vikta- ; avijīt-, avijiṣṭa- grammar; future vijitā- ; vijiṣyati- ; vejiṣyati- ; infinitive mood vijitum- grammar), to move with a quick darting motion, speed, heave (said of waves) ; to start back, recoil, flee from (ablative) : Causal vejayati- (Aorist avīvijat-), to speed, accelerate ; to increase (See vejita-) ; to terrify (See idem or ' cl.10 P. () vicchayati-, to speak or to shine ; vicchāy/ati- (; see ), to go (with ny-ā-,to press or rub one's self against): Causal vicchāy/ayati-, to press, bring into straits (perhaps ) .'): Desiderative vivijiṣati- grammar : Intensive vevijy/ate- (parasmE-pada v/evijāna-), to tremble at (dative case), start or flee from (ablative) [ confer, compare German wi7chen,weichen; Anglo-Saxon wi7kan; English vigorous;weak.] View this entry on the original dictionary page scan.
vijm. or f. (prob.) a stake at play ("a bird") View this entry on the original dictionary page scan.
vijagdhamfn. ( jakṣ-) eaten up, devoured View this entry on the original dictionary page scan.
vijagdhaka gaRa varāhādi-. View this entry on the original dictionary page scan.
vijalamfn. waterless, dry View this entry on the original dictionary page scan.
vijalan. drought View this entry on the original dictionary page scan.
vijalamfn. sauce etc. mixed with rice-water or gruel,
vijalpam. ( jalp-) an unjust reproach View this entry on the original dictionary page scan.
vijalpam. speech, talk View this entry on the original dictionary page scan.
vijalpitamfn. spoken, uttered View this entry on the original dictionary page scan.
vijāmanmfn. related, corresponding. View this entry on the original dictionary page scan.
vijāmanmfn. related id est corresponding to each other, id est,"being in pairs", symmetrical View this entry on the original dictionary page scan.
vijāmātṛ(v/i--) m. (prob.) equals jāmātṛ-, a son-in-law (according to to "a defective son-in-law, one who has not all the necessary qualifications") . View this entry on the original dictionary page scan.
vijāmi(v/i--) mfn. (prob.) equals jāmi-, consanguineous, related (opp. to /a-jāmi-) View this entry on the original dictionary page scan.
vijanA1. -jāyate- (perfect tense parasmE-pada vi-jānivas- genitive case n/uṣas- ; infinitive mood v/i-janitos- ), to be born or produced, originate, arise etc. ; to be transformed, turn into, become (Nominal verb) ; to bear young, generate, bring forth, produce View this entry on the original dictionary page scan.
vijanamfn. free from people, destitute of men, deserted, solitary, lonely etc. View this entry on the original dictionary page scan.
vijanan. a deserted or solitary place, absence of witnesses ( vijane ne- ind.,rarely vijaneṣu neṣu- ind.in private, in a lonely spot where there are no witnesses; naṃ-kṛ-,to remove all witnesses) etc. View this entry on the original dictionary page scan.
vijana vi-janman- etc. See . View this entry on the original dictionary page scan.
vijānam. Name of a man View this entry on the original dictionary page scan.
vijānakamfn. knowing, familiar with (genitive case) View this entry on the original dictionary page scan.
vijananan. the act of generating or bringing forth, birth, delivery View this entry on the original dictionary page scan.
vijānatmfn. understanding, knowing etc. View this entry on the original dictionary page scan.
vijānatm. a wise man, sage View this entry on the original dictionary page scan.
vijanatāf. solitude View this entry on the original dictionary page scan.
vijānatāf. cleverness, shrewdness View this entry on the original dictionary page scan.
vijaneind. vijana
vijaneṣuind. vijana
vijaṅghamfn. having no legs id est wheels (said of a chariot) View this entry on the original dictionary page scan.
vijaṅghākūbaramfn. having no wheels and no pole (varia lectio ghāṅghrivara-). View this entry on the original dictionary page scan.
vijāni(v/i--) mfn. "strange, foreign"or"having no wife" View this entry on the original dictionary page scan.
vijanīkṛto remove all witnesses View this entry on the original dictionary page scan.
vijanīkṛtamfn. separated from a (loved) person View this entry on the original dictionary page scan.
vijanitamfn. born, begotten View this entry on the original dictionary page scan.
vijañjapamfn. (fr. Intensive of jap-) whispering View this entry on the original dictionary page scan.
vijanmann. a separate birth, birth in general View this entry on the original dictionary page scan.
vijanmanm. a bastard, illegitimate child, the son of an out-caste or degraded vaiśya- View this entry on the original dictionary page scan.
vijānun. a particular mode of fighting View this entry on the original dictionary page scan.
vijanyāf. a woman that is about to bring forth a child, pregnant View this entry on the original dictionary page scan.
vijāpayitṛmfn. (fr. Causal) causing or granting victory View this entry on the original dictionary page scan.
vijapilamfn. equals picchila- (varia lectio vi-javala-). View this entry on the original dictionary page scan.
vijapila vi-jayina- See View this entry on the original dictionary page scan.
vijaramfn. not growing old etc. View this entry on the original dictionary page scan.
vijaram. a stalk View this entry on the original dictionary page scan.
vijarāf. Name of a river in brahmā-'s world View this entry on the original dictionary page scan.
vijarjaramfn. (v/i--) decrepit, infirm View this entry on the original dictionary page scan.
vijarjaramfn. rotten (as wood) View this entry on the original dictionary page scan.
vijarjarīkṛto weaken, make old or infirm View this entry on the original dictionary page scan.
vijaṭamfn. unplaited (hair) View this entry on the original dictionary page scan.
vijātamfn. born, transformed etc. View this entry on the original dictionary page scan.
vijātamfn. born separately View this entry on the original dictionary page scan.
vijātamfn. baseborn, of mixed origin View this entry on the original dictionary page scan.
vijātāf. a woman who has borne children, mother, matron View this entry on the original dictionary page scan.
vijātimfn. belonging to another caste or tribe, dissimilar, heterogeneous View this entry on the original dictionary page scan.
vijātim. Name of a prince View this entry on the original dictionary page scan.
vijātif. different origin or caste or tribe View this entry on the original dictionary page scan.
vijaṭīkṛto unplait View this entry on the original dictionary page scan.
vijātīyamfn. equals -jāti- View this entry on the original dictionary page scan.
vijavala(?) mfn. equals picchila- View this entry on the original dictionary page scan.
vijavalaSee . View this entry on the original dictionary page scan.
vijāvanmfn. bodily, own View this entry on the original dictionary page scan.
vijāvatī(v/i--) f. (a woman) that has brought forth a child
vijayam. contest for victory, victory, conquest, triumph, superiority etc. (figuratively applied to"the sword"and to"punishment") View this entry on the original dictionary page scan.
vijayam. the prize of victory, booty View this entry on the original dictionary page scan.
vijayam. Name of a particular hour of the day (especially the 17th, and the hour of kṛṣṇa-'s birth according to to some the 11th muhūrta-) etc. View this entry on the original dictionary page scan.
vijayam. the third month View this entry on the original dictionary page scan.
vijayam. the 27th (or first) year of Jupiter's cycle View this entry on the original dictionary page scan.
vijayam. a kind of military array View this entry on the original dictionary page scan.
vijayam. a province, district View this entry on the original dictionary page scan.
vijayam. (in music) a kind of flute View this entry on the original dictionary page scan.
vijayam. a kind of measure View this entry on the original dictionary page scan.
vijayam. a kind of composition View this entry on the original dictionary page scan.
vijayam. a divine car, chariot of the gods (?) View this entry on the original dictionary page scan.
vijayam. Name of yama- View this entry on the original dictionary page scan.
vijayam. of a son of jayanta- (son of indra-) View this entry on the original dictionary page scan.
vijayam. of a son of vasu-deva- View this entry on the original dictionary page scan.
vijayam. of a son of kṛṣṇa- View this entry on the original dictionary page scan.
vijayam. of an attendant of viṣṇu- View this entry on the original dictionary page scan.
vijayam. of an attendant of padmapāṇi- View this entry on the original dictionary page scan.
vijayam. of a son of sva-rocis- View this entry on the original dictionary page scan.
vijayam. of a muni- View this entry on the original dictionary page scan.
vijayam. of a prince View this entry on the original dictionary page scan.
vijayam. of a son of dhṛtarāṣṭra- (?) View this entry on the original dictionary page scan.
vijayam. of a warrior on the side of the pāṇḍava-s View this entry on the original dictionary page scan.
vijayam. of one of the eight councillors of daśaratha- View this entry on the original dictionary page scan.
vijayam. of arjuna- View this entry on the original dictionary page scan.
vijayam. of a son of jaya- View this entry on the original dictionary page scan.
vijayam. of a son of cañcu- or cuñcu- View this entry on the original dictionary page scan.
vijayam. of a son of saṃjaya- View this entry on the original dictionary page scan.
vijayam. of a son of su-deva- View this entry on the original dictionary page scan.
vijayam. of a son of purūravas- View this entry on the original dictionary page scan.
vijayam. of a son (or grandson) of bṛhan-manas- View this entry on the original dictionary page scan.
vijayam. of a son of yajña-śrī- View this entry on the original dictionary page scan.
vijayam. of the founder of Buddhist civilisation in Ceylon View this entry on the original dictionary page scan.
vijayam. (with jaina-s) Name of one of the 9 white bala-s and of one of the 5 anuttara-s View this entry on the original dictionary page scan.
vijayam. of the 20th arhat- of the future and of the father of the 21st arhat- of the present avasarpiṇī- View this entry on the original dictionary page scan.
vijayam. of the attendant of the 8th arhat- of the same View this entry on the original dictionary page scan.
vijayam. of a son of kalki- View this entry on the original dictionary page scan.
vijayam. of a son of kalpa- View this entry on the original dictionary page scan.
vijayam. of a hare View this entry on the original dictionary page scan.
vijayam. of the lance of rudra- (personified) View this entry on the original dictionary page scan.
vijayam. (plural) of a people View this entry on the original dictionary page scan.
vijayāf. Name of various plants (accord to Terminalia Chebula;Sesbania Aegyptiaca;Vitex Negundo;Rubia Munjista;Premna Spinosa;a kind of hemp;a kind of śamī-; equals vacā-) etc. View this entry on the original dictionary page scan.
vijayāf. of a particular tithi- or lunar day (the 12th day in the light half of śrāvaṇa- id est kṛṣṇa-'s birthday, the 10th in that of āśvina-, being a festival in honour of durgā-, and the 7th in that of bhādrapada-, if it falls on a Sunday;also the 7th night in the karma-māsa-) etc. View this entry on the original dictionary page scan.
vijayāf. of a particular magical formula View this entry on the original dictionary page scan.
vijayāf. Name of durgā- View this entry on the original dictionary page scan.
vijayāf. of a female friend of durgā- View this entry on the original dictionary page scan.
vijayāf. of the wife of yama- View this entry on the original dictionary page scan.
vijayāf. of another goddess View this entry on the original dictionary page scan.
vijayāf. of a yoginī- View this entry on the original dictionary page scan.
vijayāf. of a surāṅganā- View this entry on the original dictionary page scan.
vijayāf. of the mother of the 2nd arhat- of the present avasarpiṇī- View this entry on the original dictionary page scan.
vijayāf. of a daughter of dakṣa- View this entry on the original dictionary page scan.
vijayāf. of the mother of various su-- hotra-s View this entry on the original dictionary page scan.
vijayāf. of kṛṣṇa-'s garland View this entry on the original dictionary page scan.
vijayāf. of a kumārī- (id est small flag-staff) on indra-'s banner View this entry on the original dictionary page scan.
vijayāf. of a particular spear View this entry on the original dictionary page scan.
vijayan. the poisonous root of the plant vijayā- View this entry on the original dictionary page scan.
vijayan. a royal tent View this entry on the original dictionary page scan.
vijayan. a kind of pavilion View this entry on the original dictionary page scan.
vijayan. Name of a sacred district in kaśmīra- (see -kṣetra-) View this entry on the original dictionary page scan.
vijayamfn. leading to victory, proclaiming victory View this entry on the original dictionary page scan.
vijayamfn. victorious, triumphant View this entry on the original dictionary page scan.
vijayabāhum. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
vijayabhāga(vijay/a--) mfn. giving luck (in play) View this entry on the original dictionary page scan.
vijayabhairavan. Name of work View this entry on the original dictionary page scan.
vijayabhaṭṭārikāf. Name of a princess View this entry on the original dictionary page scan.
vijayābhinandanam. Name of a king View this entry on the original dictionary page scan.
vijayābhinandanam. of a great warrior yet to arise and to be the founder of an era View this entry on the original dictionary page scan.
vijayābhyupāyam. means of victory View this entry on the original dictionary page scan.
vijayacandram. "victory-moon", Name of a king
vijayacchandam. a necklace of pearls consisting of 504 rows or strings View this entry on the original dictionary page scan.
vijayadaṇḍam. a triumphal staff View this entry on the original dictionary page scan.
vijayadaṇḍam. a particular detachment of an army View this entry on the original dictionary page scan.
vijayadaśamīf. the 10th day of the light half of the month āśvina-, the day of the daśa-harā- etc. View this entry on the original dictionary page scan.
vijayādaśamīf. the 10th day of the light half of the month āśvina- View this entry on the original dictionary page scan.
vijayadaśamīnirṇayam. Name of work View this entry on the original dictionary page scan.
vijayadattam. Name of two men View this entry on the original dictionary page scan.
vijayadattam. of the hare in the moon View this entry on the original dictionary page scan.
vijayadevīf. Name of a woman View this entry on the original dictionary page scan.
vijayadhvajatīrtham. Name of an author View this entry on the original dictionary page scan.
vijayaḍiṇḍimam. "drum of victory", a large military drum View this entry on the original dictionary page scan.
vijayādityam. Name of various kings View this entry on the original dictionary page scan.
vijayadundubhim. a triumphal drum ( vijayadundubhitā -- f.) View this entry on the original dictionary page scan.
vijayadundubhitāf. vijayadundubhi
vijayadvādaśīf. the 12th day in the light half of the month śrāvaṇa- View this entry on the original dictionary page scan.
vijayadvādaśīvratan. a particular ceremony View this entry on the original dictionary page scan.
vijayadvāran. a gate leading to victory View this entry on the original dictionary page scan.
vijayagaṇim. Name of authors View this entry on the original dictionary page scan.
vijayagovindasiṃham. Name of authors View this entry on the original dictionary page scan.
vijayahaṃsagaṇim. Name of an author View this entry on the original dictionary page scan.
vijayaikādaśīf. the 11th day of the dark half of the month phālguna- View this entry on the original dictionary page scan.
vijayakamfn. equals vijaye kuśalaḥ- gaRa ākarṣādi-. View this entry on the original dictionary page scan.
vijayākalpam. Name of work View this entry on the original dictionary page scan.
vijayakalpalatāf. Name of work View this entry on the original dictionary page scan.
vijayakaṇṭakam. "victory-thorn","fighter for victory", Name of a king View this entry on the original dictionary page scan.
vijayaketum. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vijayakṣetran. Name of a sacred district in kaśmīra- (equals vi-jaya- n.) View this entry on the original dictionary page scan.
vijayakṣetrabhaṭṭāgrahāram. plural View this entry on the original dictionary page scan.
vijayakuñjaram. a royal elephant View this entry on the original dictionary page scan.
vijayalakṣmīf. Name of the mother of veṅkaṭa- View this entry on the original dictionary page scan.
vijayamādhavam. Name of a poet View this entry on the original dictionary page scan.
vijayamahādevīf. Name of a princess View this entry on the original dictionary page scan.
vijayamālikāf. Name of a woman View this entry on the original dictionary page scan.
vijayamālinm. Name of a merchant View this entry on the original dictionary page scan.
vijayamallam. Name of a man View this entry on the original dictionary page scan.
vijayamaṅgaladīpikāf. Name of work View this entry on the original dictionary page scan.
vijayamardalam. equals -ḍiṇḍima- above View this entry on the original dictionary page scan.
vijayamitram. Name of a man View this entry on the original dictionary page scan.
vijayanagaran. Name of a town in karṇāṭa- View this entry on the original dictionary page scan.
vijayānandam. a kind of measure, . View this entry on the original dictionary page scan.
vijayānandam. Name of an author View this entry on the original dictionary page scan.
vijayanandanam. Name of a cakra-vartin- View this entry on the original dictionary page scan.
vijayanandinm. Name of authors View this entry on the original dictionary page scan.
vijayanātham. Name of authors View this entry on the original dictionary page scan.
vijayāṅkāf. Name of a poetess View this entry on the original dictionary page scan.
vijayantam. "victorious", Name of indra- View this entry on the original dictionary page scan.
vijayantīf. Name of a surāṅganā- View this entry on the original dictionary page scan.
vijayantikāf. Name of a yoginī- View this entry on the original dictionary page scan.
vijayapālam. a kind of functionary View this entry on the original dictionary page scan.
vijayapālam. Name of various kings (also -deva-) View this entry on the original dictionary page scan.
vijayapālam. (with prefixed rājānaka-) of a poet View this entry on the original dictionary page scan.
vijayāparājitāstotran. Name of work View this entry on the original dictionary page scan.
vijayapārijātam. Name of a drama. View this entry on the original dictionary page scan.
vijayapatākāf. a triumphal flag View this entry on the original dictionary page scan.
vijayaphalamfn. having victory for a result View this entry on the original dictionary page scan.
vijayaprakoṣṭham. Name of an ancestor of kṣemīśvara- View this entry on the original dictionary page scan.
vijayapraśastif. Name of a kāvya-. View this entry on the original dictionary page scan.
vijayapraśastikāvyan. Name of a kāvya-. View this entry on the original dictionary page scan.
vijayapratyarthinmfn. desirous of victory View this entry on the original dictionary page scan.
vijayapuran. Name of various towns View this entry on the original dictionary page scan.
vijayapurakathāf. Name of work View this entry on the original dictionary page scan.
vijayapūrṇimāf. a particular full-moon night View this entry on the original dictionary page scan.
vijayarāghavam. Name of authors View this entry on the original dictionary page scan.
vijayārahasyan. Name of work View this entry on the original dictionary page scan.
vijayarājam. Name of a king and of various other persons View this entry on the original dictionary page scan.
vijayarakṣitam. Name of authors View this entry on the original dictionary page scan.
vijayarāmam. Name of two authors View this entry on the original dictionary page scan.
vijayārdham. Name of a mountain View this entry on the original dictionary page scan.
vijayārthamind. on account of victory, for victory View this entry on the original dictionary page scan.
vijayārthinmfn. seeking victory, desirous of conquest View this entry on the original dictionary page scan.
vijayasaptamīf. a particular 7th day. View this entry on the original dictionary page scan.
vijayāsaptamīf. the 7th day of the light half of a month falling on a Sunday View this entry on the original dictionary page scan.
vijayasenam. Name of various men View this entry on the original dictionary page scan.
vijayasenāf. Name of a woman View this entry on the original dictionary page scan.
vijayasiddhif. accomplishment of victory, success View this entry on the original dictionary page scan.
vijayasiṃham. Name of various kings View this entry on the original dictionary page scan.
vijayaśrīf. the goddess of victory View this entry on the original dictionary page scan.
vijayaśrīf. Name of a kiṃnara- maiden View this entry on the original dictionary page scan.
vijayaśrīf. of a woman View this entry on the original dictionary page scan.
vijayastotrabaṭukam. Name of work (prob. for baṭuka-vijayastotra-). View this entry on the original dictionary page scan.
vijayatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
vijayavarmanm. Name of a poet View this entry on the original dictionary page scan.
vijayavarmanm. of various other men View this entry on the original dictionary page scan.
vijayavatmfn. possessing victory, triumphant, glorious View this entry on the original dictionary page scan.
vijayavatīf. Name of a daughter of the serpent-demon gandha-mālin- View this entry on the original dictionary page scan.
vijayavegam. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vijayavilāsam. Name of several works. View this entry on the original dictionary page scan.
vijayayantrakalpam. Name of a chapter of the ādi-purāṇa-. View this entry on the original dictionary page scan.
vijayendraparābhavam. Name of work View this entry on the original dictionary page scan.
vijayeśam. "lord of victory", Name of the god śiva- View this entry on the original dictionary page scan.
vijayeśam. of a sacred place View this entry on the original dictionary page scan.
vijayeśasahasranāmann. plural Name of work View this entry on the original dictionary page scan.
vijayeśvaram. Name of a sacred place (see prec.) View this entry on the original dictionary page scan.
vijayeśvaramāhātmyan. Name of work View this entry on the original dictionary page scan.
vijayikṣetran. Name of a sacred district in Orissa View this entry on the original dictionary page scan.
vijayinmfn. victorious, triumphant etc. View this entry on the original dictionary page scan.
vijayinm. (in fine compositi or 'at the end of a compound') a conqueror, subduer View this entry on the original dictionary page scan.
vijayina(?) mfn. equals -jila- View this entry on the original dictionary page scan.
vijayīndram. (with yatīndra-or bhikṣu-) m. Name of an author (also -svāmin-) View this entry on the original dictionary page scan.
vijayiṣṭhamfn. conquering most
vijayollāsam. Name of a kāvya-. View this entry on the original dictionary page scan.
vijayotsavam. "victory festival", Name of a festival in honour of viṣṇu- celebrated on the 10th day of the light half of the month āśvina- View this entry on the original dictionary page scan.
vijeh(only pr. p. -j/ehamāna-), to open the mouth, show the tongue View this entry on the original dictionary page scan.
vijenyamfn. (fr. vi-jana-?) lonely, solitary () View this entry on the original dictionary page scan.
vijeṣakṛtmfn. causing or bestowing victory (said of indra-) View this entry on the original dictionary page scan.
vijetavyamfn. to be subdued or overcome or restrained or controlled View this entry on the original dictionary page scan.
vijetṛm. a vanquisher, conqueror (also in argument) etc. (with purām-,"conqueror of towns", Name of śiva- ) View this entry on the original dictionary page scan.
vijeyamfn. to be vanquished or overcome View this entry on the original dictionary page scan.
vijeyavilāsam. (?) Name of work View this entry on the original dictionary page scan.
vijharjharamfn. discordant, disagreeable View this entry on the original dictionary page scan.
vijiA1. -jayate- (rarely ti-; see ), to conquer, win or acquire by conquest etc. ; to vanquish, defeat, subdue, overpower, master, control etc. ; to be victorious or superior etc. ; (often in respectful salutation exempli gratia, 'for example' vi-jayasva rājan-,"be victorious"or"hail to thee, O king!") to contend victoriously with (instrumental case) ; to excel in (instrumental case) ; to be about to conquer, go to victory : Causal (only Aorist vy-ajījayat-;but see vi-jāpayitṛ-) to conquer : Desiderative -jigīṣate- (rarely ti-), to strive for victory, wish to conquer or vanquish, attack, assail View this entry on the original dictionary page scan.
vijighāṃsumfn. (Desiderative of han-) wishing to slay or to kill or to remove or to destroy View this entry on the original dictionary page scan.
vijighatsamfn. not liable to hunger, not becoming hungry View this entry on the original dictionary page scan.
vijighṛkṣumfn. (fr. Desiderative) wishing to make war or fight View this entry on the original dictionary page scan.
vijigīṣamfn. (fr. Desiderative) desirous of victory, emulous View this entry on the original dictionary page scan.
vijigīṣāf. desire to conquer or overcome or subdue (accusative dative case,or compound) ( vijigīṣāvat ṣā-vat- mfn.[ ]or vijigīṣin ṣin-[ ] mfn.desirous to conquer or overcome; vijigīṣāvivarjita ṣā-vivarjita- mfn.devoid of ambition ; vijigīṣīya ṣīya- mfn. gaRa utkarādi-). View this entry on the original dictionary page scan.
vijigīṣāvatmfn. vijigīṣā
vijigīṣāvivarjitamfn. vijigīṣā
vijigīṣinmfn. vijigīṣā
vijigīṣīyamfn. vijigīṣā
vijigīṣumfn. desirous of victory or conquest, wishing to overcome or surpass (accusative or compound), emulous, ambitious etc. View this entry on the original dictionary page scan.
vijigīṣum. a warrior, invader, antagonist View this entry on the original dictionary page scan.
vijigīṣum. a disputant, opponent View this entry on the original dictionary page scan.
vijigīṣutāf. () desire of conquest, emulation, ambition. View this entry on the original dictionary page scan.
vijigīṣutvan. () desire of conquest, emulation, ambition. View this entry on the original dictionary page scan.
vijigīta() or vi-jigīth/a- (), ( gai-) celebrated, famous. View this entry on the original dictionary page scan.
vijigrāhayiṣumfn. (fr. Desiderative of Causal) to cause to fight or wage war View this entry on the original dictionary page scan.
vijigrāhayiṣu vi-jighṛkṣu- See under vi-grah-, . View this entry on the original dictionary page scan.
vijihīrṣāf. (fr. Desiderative of vihṛ-) wish or intention to roam about or take one's pleasure View this entry on the original dictionary page scan.
vijihīrṣumfn. wishing to walk about View this entry on the original dictionary page scan.
vijihīrṣumfn. wishing to sport or take one's pleasure View this entry on the original dictionary page scan.
vijihmamfn. crooked, curved, bent View this entry on the original dictionary page scan.
vijihmamfn. sidelong (as a glance) View this entry on the original dictionary page scan.
vijihmamfn. dishonest View this entry on the original dictionary page scan.
vijihma vi-jihva- See . View this entry on the original dictionary page scan.
vijihmatāf. crookedness, dishonesty, craftiness View this entry on the original dictionary page scan.
vijihmatvan. crookedness, dishonesty, craftiness View this entry on the original dictionary page scan.
vijihvamfn. deprived or destitute of tongue, tongueless View this entry on the original dictionary page scan.
vijijijñāsitavyamfn. wished or intended to be known or understood View this entry on the original dictionary page scan.
vijijijñāsumfn. desirous of knowing or understanding View this entry on the original dictionary page scan.
vijijijñāsumfn. wishing to learn from (genitive case) View this entry on the original dictionary page scan.
vijijijñāsya(or sy/a-) mfn. = jijñāsitavya- View this entry on the original dictionary page scan.
vijijñāpayiṣāf. (fr. Desiderative of Causal) desire of teaching or instructing View this entry on the original dictionary page scan.
vijijñāsāf. (fr. Desiderative) desire of knowing distinctly, wish to prove or try, inquiry about (compound) View this entry on the original dictionary page scan.
vijilamfn. idem or '(?) mfn. equals picchala- ' View this entry on the original dictionary page scan.
vijilabindum. Name of a town View this entry on the original dictionary page scan.
vijina(?) mfn. equals picchala- View this entry on the original dictionary page scan.
vijina vi-jila- See . View this entry on the original dictionary page scan.
vijipila(?) mfn. equals picchala- View this entry on the original dictionary page scan.
vijitamfn. (for 2.See under vi-ji-) to be apprehended or feared View this entry on the original dictionary page scan.
vijitamfn. (for 1.See under vij-) conquered, subdued, defeated, won, gained etc. View this entry on the original dictionary page scan.
vijitam. or n. a conquered country View this entry on the original dictionary page scan.
vijitam. any country or district View this entry on the original dictionary page scan.
vijitam. conquest, victory View this entry on the original dictionary page scan.
vijitāmitramfn. one who has overcome his enemies View this entry on the original dictionary page scan.
vijitārim. "id.", Name of a rākṣasa- View this entry on the original dictionary page scan.
vijitarūpamfn. (v/ij-) appearing as if conquered or won View this entry on the original dictionary page scan.
vijitāsanamfn. one who has won a seat and is indifferent about sitting on it View this entry on the original dictionary page scan.
vijitāsum. Name of a muni- View this entry on the original dictionary page scan.
vijitāśvam. Name of a son of pṛthu- View this entry on the original dictionary page scan.
vijitātmanm. "self-subdued", Name of śiva- View this entry on the original dictionary page scan.
vijitavatmfn. one who has conquered, victorious View this entry on the original dictionary page scan.
vijitendriyamfn. one who has the organs of sense or passions subdued View this entry on the original dictionary page scan.
vijitif. (v/i--) contest for victory, conquest, triumph View this entry on the original dictionary page scan.
vijitif. (in fine compositi or 'at the end of a compound') gain or acquisition of View this entry on the original dictionary page scan.
vijitif. Name of a goddess View this entry on the original dictionary page scan.
vijitinmfn. victorious, triumphant View this entry on the original dictionary page scan.
vijitṛmfn. who or what separates or divides View this entry on the original dictionary page scan.
vijitṛm. a judge, discriminator, distinguisher View this entry on the original dictionary page scan.
vijitvaramf(ā-)n. idem or 'mfn. victorious, triumphant ' ( vijitvaratva -tva- n.) View this entry on the original dictionary page scan.
vijitvarāf. Name of a goddess View this entry on the original dictionary page scan.
vijitvaratvan. vijitvara
vijīvP. -jīvati-, to revive, return to life View this entry on the original dictionary page scan.
vijivilamfn. equals picchila- View this entry on the original dictionary page scan.
vivitamf(ā-)n. lifeless, dead View this entry on the original dictionary page scan.
vijjam. Name of a man View this entry on the original dictionary page scan.
vijjāf. Name of a woman View this entry on the original dictionary page scan.
vijjaka f. Name of a poetess View this entry on the original dictionary page scan.
vijjākā f. Name of a poetess View this entry on the original dictionary page scan.
vijjalamfn. ( also vijjana-,or vijjila-) slimy, smeary View this entry on the original dictionary page scan.
vijjalam. the root of Bombax Heptaphyllum View this entry on the original dictionary page scan.
vijjalāf. Name of a woman View this entry on the original dictionary page scan.
vijjalan. a kind of arrow View this entry on the original dictionary page scan.
vijjalan. sauce etc. mixed with rice-gruel View this entry on the original dictionary page scan.
vijjalapuran. Name of a town View this entry on the original dictionary page scan.
vijjalaviḍan. idem or 'n. Name of a town ' (see vijila-bindu-). View this entry on the original dictionary page scan.
vijjanāmanm. Name of a vihāra- called after vijjā- View this entry on the original dictionary page scan.
vijjarājam. Name of a man View this entry on the original dictionary page scan.
vijjikāf. Name of a poetess View this entry on the original dictionary page scan.
vijjulam. the bark of the Cassia tree View this entry on the original dictionary page scan.
vijjūlikāf. a species of Oldenlandia (prob. wrong reading for vañjulikā-). View this entry on the original dictionary page scan.
vijñāP. A1. -jānāti-, -jānīte-, to distinguish, discern, observe, investigate, recognize, ascertain, know, understand etc. etc. (with na-and infinitive mood"to know not how to") ; to have right knowledge, ; to become wise or learned ; to hear or learn from (genitive case) ; to recognize in (locative case) ; to look upon or regard or consider as (two accusative) etc. ; to learn or understand that (two accusative or yat-) etc. ; to explain, declare : Passive voice -jñāyate-, to be distinguished or discerned etc. ; (especially 3. sg.,"it is known or understood";"it is recognized or prescribed", scilicet by authorities ;and in gram. mā vi-jñāyi-with preceding Nominal verb,"let this not be considered as") : Causal -jñapayati-, or -jñāpayati- (rarely te-; Aorist vy-ājijñapat-), to make known, declare, report, communicate etc. ; to ask or request anything ; to declare or tell that (two accusative) ; to apprise, teach, instruct, ask, beg (with accusative of Persian;and dative case of thing, or with artham- in fine compositi or 'at the end of a compound',or prati-and accusative) etc. ; to inform of or about (two accusative) : Passive voice (only Conditional vy-ajñāpayiṣyata-,with varia lectio ṣyat-), to become manifest, appear : Desiderative of Causal See vi-jijñāpayiṣā- below (see also vi-jñīpsu-): Desiderative -jijñāsati-, te-, to wish to understand or know etc. View this entry on the original dictionary page scan.
vijñamfn. knowing, intelligent, wise, clever View this entry on the original dictionary page scan.
vijñam. a wise man, sage etc. View this entry on the original dictionary page scan.
vijñābhimāninmfn. thinking one's self clever or wise View this entry on the original dictionary page scan.
vijñabuddhif. Indian spikenard View this entry on the original dictionary page scan.
vijñānan. (in fine compositi or 'at the end of a compound' f(ā-).) the act of distinguishing or discerning, understanding, comprehending, recognizing, intelligence, knowledge etc. View this entry on the original dictionary page scan.
vijñānan. skill, proficiency, art View this entry on the original dictionary page scan.
vijñānan. science, doctrine View this entry on the original dictionary page scan.
vijñānan. worldly or profane knowledge (opp. to jñāna-,"knowledge of the true nature of God") etc. View this entry on the original dictionary page scan.
vijñānan. the faculty of discernment or of right judgement etc. View this entry on the original dictionary page scan.
vijñānan. the organ of knowledge (equals manas-) View this entry on the original dictionary page scan.
vijñānan. (in fine compositi or 'at the end of a compound') the understanding of (a particular meaning), regarding as on View this entry on the original dictionary page scan.
vijñānan. (with Buddhists) consciousness or thought-faculty (one of the 5 constituent elements or skandhas-, also considered as one of the 6 elements or dhātu-s, and as one of the 12 links of the chain of causation) (see ) View this entry on the original dictionary page scan.
vijñānabhairavam. Name of work View this entry on the original dictionary page scan.
vijñānabhairavoddyotasaṃgraham. Name of work View this entry on the original dictionary page scan.
vijñānabhāratam. Name of scholar View this entry on the original dictionary page scan.
vijñānabhaṭṭārakam. Name of scholar View this entry on the original dictionary page scan.
vijñānabhikṣum. Name of scholar View this entry on the original dictionary page scan.
vijñānācāryam. Name of a teacher View this entry on the original dictionary page scan.
vijñānadeśanam. a buddha- View this entry on the original dictionary page scan.
vijñānaghanam. pure knowledge, nothing but intelligence View this entry on the original dictionary page scan.
vijñānāhāram. spiritual food as nourishment View this entry on the original dictionary page scan.
vijñānaikaskandhavādam. equals na-vāda- above View this entry on the original dictionary page scan.
vijñānākalamfn. equals na-kevala- above View this entry on the original dictionary page scan.
vijñānakandam. Name of a man View this entry on the original dictionary page scan.
vijñānakaumudīf. Name of a female Buddhist View this entry on the original dictionary page scan.
vijñānakāyam. Name of a Buddhist work View this entry on the original dictionary page scan.
vijñānakevalamfn. (with śaiva-s) an individual soul to which only mala- adheres View this entry on the original dictionary page scan.
vijñānakṛtsnan. one of the 10 mystical exercises called kṛtsna-s View this entry on the original dictionary page scan.
vijñānalalitan. Name of work View this entry on the original dictionary page scan.
vijñānalalitatantran. Name of work View this entry on the original dictionary page scan.
vijñānalatikāf. Name of work View this entry on the original dictionary page scan.
vijñānamātṛkam. "whose mother is knowledge", a buddha- View this entry on the original dictionary page scan.
vijñānamayamf(ī-)n. consisting of knowledge or intelligence, all knowledge, full of intelligence etc. View this entry on the original dictionary page scan.
vijñānamayakoṣam. the sheath consisting of intelligence, the intelligent sheath (of the soul according to to the vedānta-) or the sheath caused by the understanding being associated with the organs of perception View this entry on the original dictionary page scan.
vijñānāmṛtan. Name of commentator or commentary View this entry on the original dictionary page scan.
vijñānanāf. (perhaps for jānanā-or jānatā-) perceiving, understanding View this entry on the original dictionary page scan.
vijñānanaukāf. Name of several works. View this entry on the original dictionary page scan.
vijñānāntyāyatanan. (with Buddhists) Name of a world View this entry on the original dictionary page scan.
vijñānapādam. Name of vyāsa- View this entry on the original dictionary page scan.
vijñānapatim. a lord of intelligence View this entry on the original dictionary page scan.
vijñānapatim. Name of one who has attained to a particular degree of emancipation View this entry on the original dictionary page scan.
vijñānasaṃjñāprakaraṇan. Name of work View this entry on the original dictionary page scan.
vijñānaśāstran. Name of work View this entry on the original dictionary page scan.
vijñānaśikṣāf. Name of work View this entry on the original dictionary page scan.
vijñānāśramam. equals tman- View this entry on the original dictionary page scan.
vijñānāstitvamātravādinmfn. equals na-vādin- View this entry on the original dictionary page scan.
vijñānatāf. knowledge of (locative case) View this entry on the original dictionary page scan.
vijñānatailagarbham. Alangium Decapetalum View this entry on the original dictionary page scan.
vijñānataraṃgiṇīf. Name of work View this entry on the original dictionary page scan.
vijñānatārāvalīf. Name of work View this entry on the original dictionary page scan.
vijñānātmanm. Name of an author View this entry on the original dictionary page scan.
vijñānavādam. the doctrine (of the yogācāra-s) that only intelligence has reality (not the objects exterior to us) View this entry on the original dictionary page scan.
vijñānavādinmfn. one who affirms that only intelligence has reality View this entry on the original dictionary page scan.
vijñānavādinm. a yogācāra- View this entry on the original dictionary page scan.
vijñānavatmfn. endowed with intelligence View this entry on the original dictionary page scan.
vijñānavilāsam. Name of work View this entry on the original dictionary page scan.
vijñānavinodinīṭīkāf. Name of work View this entry on the original dictionary page scan.
vijñānayatim. equals -bhikṣu- View this entry on the original dictionary page scan.
vijñānayoginm. equals vijñāneśvara- View this entry on the original dictionary page scan.
vijñāneśvaram. Name of an author ( vijñāneśvaratantra -tantra- n. vijñāneśvaravārttika -vārttika-, n.Name of works.) View this entry on the original dictionary page scan.
vijñāneśvaratantran. vijñāneśvara
vijñāneśvaravārttikan. vijñāneśvara
vijñāneśvarīyan. a work of vijñāneśvara- View this entry on the original dictionary page scan.
vijñānikamfn. equals vi-jña- or vaijñānika- View this entry on the original dictionary page scan.
vijñāninmfn. having intelligence or knowledge or science, clever, skilful, a specialist View this entry on the original dictionary page scan.
vijñāninitāf. (in fine compositi or 'at the end of a compound') science or knowledge of, acquaintance with View this entry on the original dictionary page scan.
vijñānīyamfn. (in fine compositi or 'at the end of a compound') treating of the science or doctrine of View this entry on the original dictionary page scan.
vijñāpakamfn. (fr. Causal) who or what makes known View this entry on the original dictionary page scan.
vijñāpakam. an informant, instructor View this entry on the original dictionary page scan.
vijñāpanan. (orf(ā-).) information, communication, address (especially to a superior), request, entreaty View this entry on the original dictionary page scan.
vijñāpanīyamfn. to be made known, to be communicated View this entry on the original dictionary page scan.
vijñāpanīyamfn. to be (respectfully) informed or apprised View this entry on the original dictionary page scan.
vijñāpanīyamfn. fit to be taught or instructed View this entry on the original dictionary page scan.
vijñāpinmfn. announcing, telling View this entry on the original dictionary page scan.
vijñāpitamfn. equals jñapta- View this entry on the original dictionary page scan.
vijñaptamfn. (fr. Causal) made known, reported, informed View this entry on the original dictionary page scan.
vijñaptif. information, report, address (to a superior), request, entreaty of (genitive case) (tiṃ-kṛ-,"to announce anything, scilicet to a superior";with genitive case,"to address a request to") View this entry on the original dictionary page scan.
vijñaptif. imparting, giving View this entry on the original dictionary page scan.
vijñāptif. equals jñapti- View this entry on the original dictionary page scan.
vijñaptikāf. a request, solicitation View this entry on the original dictionary page scan.
vijñapyamfn. to be apprised or informed View this entry on the original dictionary page scan.
vijñāpyamfn. equals jñāpanīya- View this entry on the original dictionary page scan.
vijñarājam. a king or chief among sages View this entry on the original dictionary page scan.
vijñatāf. wisdom, skill, cleverness View this entry on the original dictionary page scan.
vijñātamfn. discerned, understood, known etc. View this entry on the original dictionary page scan.
vijñātamfn. celebrated, famous View this entry on the original dictionary page scan.
vijñātārthamfn. one who is acquainted with any matter on the true state of a case View this entry on the original dictionary page scan.
vijñātasthālīf. (prob.) a vessel prepared in the known or usual manner, View this entry on the original dictionary page scan.
vijñātātmanm. Name of a poet View this entry on the original dictionary page scan.
vijñātavīryamfn. (v/i--) of known strength View this entry on the original dictionary page scan.
vijñātavyamfn. to be recognized or known or understood View this entry on the original dictionary page scan.
vijñātavyamfn. to be found out View this entry on the original dictionary page scan.
vijñātavyamfn. to be regarded or considered as View this entry on the original dictionary page scan.
vijñātavyamfn. to be inferred or conjectured with certainty View this entry on the original dictionary page scan.
vijñātif. (v/i--) knowledge, understanding View this entry on the original dictionary page scan.
vijñātif. Name of the 25th kalpa- (q.v) View this entry on the original dictionary page scan.
vijñātim. Name of a deity View this entry on the original dictionary page scan.
vijñātṛmfn. one who knows, a knower, understander
vijñatvan. wisdom, skill, cleverness View this entry on the original dictionary page scan.
vijñāyamfn. recognizable (See bala-v-). View this entry on the original dictionary page scan.
vijñeyamfn. to be perceived or known, knowable, cognizable etc. View this entry on the original dictionary page scan.
vijñeyamfn. to be understood or heard or learned View this entry on the original dictionary page scan.
vijñeyamfn. to be recognized or considered or regarded as ( vijñeyatva -tva- n.) View this entry on the original dictionary page scan.
vijñeyatvan. vijñeya
vijñīpsumfn. (fr. Desiderative of Causal) wishing to inform, intending to address a request to View this entry on the original dictionary page scan.
vijoṣas(v/i--) mfn. (opp. to sa-j-) deserted, alone ("delighting the gods") . View this entry on the original dictionary page scan.
vijṛmbhA1. -jṛmbhate-, to open the mouth, yawn, gape etc. ; to open (intr.), expand, become expanded or developed or exhibited, spread out, blossom ; to extend, become erect (said of the membrum virile) ; to arise, appear, awake (figuratively) ; to begin to feel well or at ease View this entry on the original dictionary page scan.
vijṛmbham. bending or knitting (the brows) View this entry on the original dictionary page scan.
vijṛmbhāf. yawning View this entry on the original dictionary page scan.
vijṛmbhakam. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vijṛmbhaṇan. yawning View this entry on the original dictionary page scan.
vijṛmbhaṇan. opening, expanding, blossoming, budding View this entry on the original dictionary page scan.
vijṛmbhaṇan. spreading, extension View this entry on the original dictionary page scan.
vijṛmbhaṇan. bending, knitting (the brows) View this entry on the original dictionary page scan.
vijṛmbhikāf. gasping for breath View this entry on the original dictionary page scan.
vijṛmbhikāf. yawning View this entry on the original dictionary page scan.
vijṛmbhinmfn. breaking forth, appearing View this entry on the original dictionary page scan.
vijṛmbhitamfn. yawned, gaped, opened, expanded, blown etc. (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
vijṛmbhitamfn. drawn, bent (said of a bow) View this entry on the original dictionary page scan.
vijṛmbhitamfn. sported, wantoned View this entry on the original dictionary page scan.
vijṛmbhitan. yawning View this entry on the original dictionary page scan.
vijṛmbhitan. coming out, appearance, manifestation, consequences View this entry on the original dictionary page scan.
vijṛmbhitan. exploit
vijum. that part of a bird's body on which the wings grow View this entry on the original dictionary page scan.
vijulam. the root of Bombax Heptaphyllum (prob. wrong reading for vijjala-). View this entry on the original dictionary page scan.
vijvaramf(ā-)n. free from fever or pain View this entry on the original dictionary page scan.
vijvaramf(ā-)n. free from distress or anxiety, cheerful etc. View this entry on the original dictionary page scan.
vijvaramf(ā-)n. exempt from decay View this entry on the original dictionary page scan.
vijya(v/i--) mfn. stringless (as a bow) View this entry on the original dictionary page scan.
vijya vi-jvara- etc. See . View this entry on the original dictionary page scan.
vikam. Name of a man View this entry on the original dictionary page scan.
vikan. the milk of a cow that has just calved View this entry on the original dictionary page scan.
vikan. (with prajā-pateḥ-) Name of a sāman-, View this entry on the original dictionary page scan.
vikacamfn. (for 2.See) hairless, bald View this entry on the original dictionary page scan.
vikacam. a Buddhist mendicant View this entry on the original dictionary page scan.
vikacam. a species of comet (65 enumerated) View this entry on the original dictionary page scan.
vikacam. Name of a dānava- View this entry on the original dictionary page scan.
vikacāf. a kind of shrub View this entry on the original dictionary page scan.
vikacamfn. ( kac-;for 1.See) opened, blown etc. View this entry on the original dictionary page scan.
vikacamfn. shining, resplendent, brilliant, radiant with (compound) etc. View this entry on the original dictionary page scan.
vikacālambāf. Name of durgā- View this entry on the original dictionary page scan.
vikacānanamf(ā-)n. with a radiant face View this entry on the original dictionary page scan.
vikacaśrīmfn. having the beauty of the hair gone View this entry on the original dictionary page scan.
vikacaśrīmfn. having radiant beauty View this entry on the original dictionary page scan.
vikacayaNom. P. yati-, to open, expand (a blossom) View this entry on the original dictionary page scan.
vikacchamfn. having no marshy banks View this entry on the original dictionary page scan.
vikacchapamfn. deprived of tortoises View this entry on the original dictionary page scan.
vikacīkṛP. -karoti-, to open, expand
vikacitamfn. opened, expanded, blown (varia lectio) View this entry on the original dictionary page scan.
vikadrum. Name of a yādava-
vikakara(v/i--) m. a kind of bird (see -kakara-). View this entry on the original dictionary page scan.
vikākudmfn. having a badly formed palate View this entry on the original dictionary page scan.
vikalaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vikālam. twilight, evening, afternoon ( vikālam am- ind.in the evening late) etc. View this entry on the original dictionary page scan.
vikalamf(ā-,or ī-)n. deprived of a part or a limb or a member, mutilated, maimed, crippled, impaired, imperfect, deficient in or destitute of (instrumental case or compound; see ) etc. View this entry on the original dictionary page scan.
vikalamf(ā-,or ī-)n. confused, agitated, exhausted, unwell, depressed, sorrowful View this entry on the original dictionary page scan.
vikalam. Name of a son of śambara- View this entry on the original dictionary page scan.
vikalam. of a son of lambodara- View this entry on the original dictionary page scan.
vikalam. of a son of jīmūta- View this entry on the original dictionary page scan.
vikalam. of another man View this entry on the original dictionary page scan.
vikalaf(ā-or ī-). a woman in whom menstruation has begun View this entry on the original dictionary page scan.
vikalāf. the 60th part of a kalā-, the second of a degree View this entry on the original dictionary page scan.
vikalam. a particular stage in the revolution of the planet Mercury View this entry on the original dictionary page scan.
vikālakam. idem or 'm. twilight, evening, afternoon ( vikālam am- ind.in the evening late) etc.' View this entry on the original dictionary page scan.
vikālamind. vikāla
vikalāṅgamf(ī-)n. having mutilated or imperfect limbs, deformed, crippled, lamed View this entry on the original dictionary page scan.
vikalaṅkamfn. spotless, bright (as the moon) View this entry on the original dictionary page scan.
vikalaṅkatāf. View this entry on the original dictionary page scan.
vikalapāṇikam. one who has a mutilated or withered hand, a cripple View this entry on the original dictionary page scan.
vikalatāf. deficiency, infirmity, imperfection etc. View this entry on the original dictionary page scan.
vikalatvan. deficiency, infirmity, imperfection etc. View this entry on the original dictionary page scan.
vikalavadham. "death of vikala-", Name of a chapter in View this entry on the original dictionary page scan.
vikalayaNom. P. yati-, to afflict, mutilate, injure, ill-treat View this entry on the original dictionary page scan.
vikalendriyamfn. having impaired or defective organs of sense View this entry on the original dictionary page scan.
vikālikāf. a sort of clepsydra or water-clock View this entry on the original dictionary page scan.
vikalīkṛP. -karoti-, to injure, impair, inflict great injury upon, harm, distress, perplex (krita--or -bhūta- mfn.mutilated, injured, harmed)
vikalmaṣamf(ā-)n. spotless, sinless, guiltless View this entry on the original dictionary page scan.
vikalpam. (for 2.See under vi-kḷp-) an intermediate kalpa-, the interval between two kalpa-s. (q.v) View this entry on the original dictionary page scan.
vikalpam. (for 1.See) alternation, alternative, option etc. ( vikalpena pena- ind."optionally") View this entry on the original dictionary page scan.
vikalpam. variation, combination, variety, diversity, manifoldness etc. View this entry on the original dictionary page scan.
vikalpam. contrivance, art View this entry on the original dictionary page scan.
vikalpam. difference of perception, distinction View this entry on the original dictionary page scan.
vikalpam. indecision, irresolution, doubt, hesitation etc. View this entry on the original dictionary page scan.
vikalpam. admission, statement View this entry on the original dictionary page scan.
vikalpam. false notion, fancy, imagination View this entry on the original dictionary page scan.
vikalpam. calculation View this entry on the original dictionary page scan.
vikalpam. mental occupation, thinking View this entry on the original dictionary page scan.
vikalpam. equals kalpa-sthāna- View this entry on the original dictionary page scan.
vikalpam. a god (Scholiast or Commentator) View this entry on the original dictionary page scan.
vikalpam. (in rhetoric) antithesis of opposites View this entry on the original dictionary page scan.
vikalpam. (in gram.) admission of an option or alternative, the allowing a rule to be observed or not at pleasure (veti vikalpaḥ- ) View this entry on the original dictionary page scan.
vikalpam. a collateral form View this entry on the original dictionary page scan.
vikalpam. plural Name of a people (Calcutta edition vikalya-) View this entry on the original dictionary page scan.
vikalpamfn. different View this entry on the original dictionary page scan.
vikalpajālan. a number of possible cases, dilemma View this entry on the original dictionary page scan.
vikalpakam. a distributer, apportioner View this entry on the original dictionary page scan.
vikalpakam. a contriver, composer View this entry on the original dictionary page scan.
vikalpakam. a transformer, changer View this entry on the original dictionary page scan.
vikalpakam. = vi-kalpa-2 View this entry on the original dictionary page scan.
vikalpanam. a contriver, composer View this entry on the original dictionary page scan.
vikalpanan. and f(ā-). allowing an option or alternative on View this entry on the original dictionary page scan.
vikalpanan. the use of a collateral form View this entry on the original dictionary page scan.
vikalpanan. distinction (plural = different opinions) View this entry on the original dictionary page scan.
vikalpanan. false notion or assumption, fancy, imagination View this entry on the original dictionary page scan.
vikalpanan. indecision View this entry on the original dictionary page scan.
vikalpanan. inconsideration View this entry on the original dictionary page scan.
vikalpananīyamfn. to be calculated or ascertained View this entry on the original dictionary page scan.
vikalpānupapattif. untenableness owing to a dilemma View this entry on the original dictionary page scan.
vikalpāsahamfn. not standing (the test of) a dilemma ( vikalpāsahatva -tva- n.) View this entry on the original dictionary page scan.
vikalpāsahatvan. vikalpāsaha
vikalpasamam. a particular sophistical objection View this entry on the original dictionary page scan.
vikalpatvan. manifoldness, variety View this entry on the original dictionary page scan.
vikalpavatmfn. undecided, doubtful View this entry on the original dictionary page scan.
vikalpayitavyamfn. to be put as an alternative View this entry on the original dictionary page scan.
vikalpenaind. vikalpa
vikalpinmfn. possessing doubt or indecision, liable to be mistaken for (compound) View this entry on the original dictionary page scan.
vikalpinmfn. versed in the mīmāṃsā- View this entry on the original dictionary page scan.
vikalpitamfn. prepared, arranged etc. View this entry on the original dictionary page scan.
vikalpitamfn. divided, manifold (with caturdaśa-dhā-= fourteen fold) View this entry on the original dictionary page scan.
vikalpitamfn. doubtful, undecided (see a-vikalpa-) View this entry on the original dictionary page scan.
vikalpitamfn. optional ( vikalpitatva -tva- n.) View this entry on the original dictionary page scan.
vikalpitatvan. vikalpita
vikalpopahāram. an optional offering. View this entry on the original dictionary page scan.
vikalpyamfn. to be distributed View this entry on the original dictionary page scan.
vikalpyamfn. to be calculated or ascertained View this entry on the original dictionary page scan.
vikalpyamfn. to be chosen according to circumstances View this entry on the original dictionary page scan.
vikalyam. plural Name of a people (varia lectio vi-kalpa-). View this entry on the original dictionary page scan.
vikāmamfn. free from desire View this entry on the original dictionary page scan.
vikampcl.1 A1. -kampate-, to tremble greatly, quiver, move about etc. ; to become changed or deformed, change a position or place, shrink from : Causal -kampayati-, to cause to tremble, agitate View this entry on the original dictionary page scan.
vikampamfn. trembling, heaving, unsteady, shrinking from View this entry on the original dictionary page scan.
vikampanan. trembling, motion (of the sun) View this entry on the original dictionary page scan.
vikampanam. Name of a rākṣasa- View this entry on the original dictionary page scan.
vikampinmfn. trembling, shaking View this entry on the original dictionary page scan.
vikampinf. (in music) a particular śruti- View this entry on the original dictionary page scan.
vikampitamfn. trembling, shaking, tremulous, agitated, unsteady View this entry on the original dictionary page scan.
vikampitan. a kind of sinking of the tone of the voice View this entry on the original dictionary page scan.
vikampitan. a particular faulty pronunciation of the vowels View this entry on the original dictionary page scan.
vikaṃsāf. Name of a woman gaRa śubhrādi- (varia lectio) View this entry on the original dictionary page scan.
vikaṅkaṭam. Asteracantha Longifolia View this entry on the original dictionary page scan.
vikaṅkatam. (v/i--) Flacourtia Sapida (from which sacrificial vessels are made) etc. View this entry on the original dictionary page scan.
vikaṅkatāf. Sida Cordifolia and Rhombifolia View this entry on the original dictionary page scan.
vikaṅkaṭikamfn. (fr. prec.) gaRa kumudādi-. View this entry on the original dictionary page scan.
vikaṅkatīmukhamfn. thorny-mouthed View this entry on the original dictionary page scan.
vikāṅkṣP. A1. -kāṅkṣati-, te-, to have anything in view, aim at (accusative) ; to tarry, linger, hesitate View this entry on the original dictionary page scan.
vikāṅkṣa() mfn. free from desire View this entry on the original dictionary page scan.
vikāṅkṣāf. See vi-kāṅkṣ-. View this entry on the original dictionary page scan.
vikāṅkṣāf. (see vi-kāṅkṣa-,) hesitation, irresolution indecision as to (infinitive mood or genitive case) View this entry on the original dictionary page scan.
vikāṅkṣinmfn. () free from desire View this entry on the original dictionary page scan.
vikaṇṭakam. "having no thorns or having spreading thorns", Alhagi Maurorum or Asteracantha Longifolia View this entry on the original dictionary page scan.
vikaṇṭakapuran. Name of a town View this entry on the original dictionary page scan.
vikapālamfn. deprived of skull View this entry on the original dictionary page scan.
vikapitamfn. changed, altered, deformed Va1rtt. 1 View this entry on the original dictionary page scan.
vikaramfn. (for 2.See vi--1. kṛ-) deprived of hands (as a punishment) View this entry on the original dictionary page scan.
vikāram. (for 2.See vi--1. kṛ-) the syllable vi- View this entry on the original dictionary page scan.
vikara vi-karaṇa-. See p.950. View this entry on the original dictionary page scan.
vikāraSee . View this entry on the original dictionary page scan.
vikaram. (for 1.See;for 3.See vi-kṝ-) disease, sickness View this entry on the original dictionary page scan.
vikaram. a particular mode of fighting (varia lectio viṣkara-). View this entry on the original dictionary page scan.
vikāram. (for 1.See) change of form or nature, alteration or deviation from any natural state, transformation, modification, change (especially for the worse) of bodily or mental condition, disease, sickness, hurt, injury, (or) perturbation, emotion, agitation, passion etc.
vikāram. an apparition, spectre View this entry on the original dictionary page scan.
vikāram. extravagance View this entry on the original dictionary page scan.
vikāram. a product View this entry on the original dictionary page scan.
vikāram. (in sāṃkhya-) a production or derivative from prakṛti- (there are 7 vikāra-s, viz. buddhi-,"intellect", ahaṃ-kāra-,"the sense of individuality", and the 5 tan-mātras- q.v;these are also producers, inasmuch as from them come the 16 vikāra-s which are only productions, viz. the 5 mahā-bhūtāni- q.v,and the 11 organs, viz. the 5 buddhīndriyāṇi-or organs of sense, the 5 karmendriyāṇi-or organs of action, and manas-,"the mind") View this entry on the original dictionary page scan.
vikāram. the derivative of a word View this entry on the original dictionary page scan.
vikāram. contortion of the face, grimace View this entry on the original dictionary page scan.
vikāram. change of sentiment, hostility, defection View this entry on the original dictionary page scan.
vikaram. (for 1.See;for 2.) an earth-pit View this entry on the original dictionary page scan.
vikārahetum. "cause of perturbation", temptation, seduction View this entry on the original dictionary page scan.
vikarālamf(ā-)n. very formidable or dreadful etc. View this entry on the original dictionary page scan.
vikarālāf. Name of durgā- View this entry on the original dictionary page scan.
vikarālāf. of a courtezan View this entry on the original dictionary page scan.
vikarālamukham. Name of a makara- View this entry on the original dictionary page scan.
vikarālatāf. formidableness, dreadfulness View this entry on the original dictionary page scan.
vikarālinmfn. hot View this entry on the original dictionary page scan.
vikarālinm. heat View this entry on the original dictionary page scan.
vikāramayamf(ī-)n. consisting of derivatives (from prakṛti-) View this entry on the original dictionary page scan.
vikaraṇamfn. (for 2.See ) deprived of organs of sense ( vikaraṇatva -tva- n.) View this entry on the original dictionary page scan.
vikāraṇamfn. causeless (varia lectio) View this entry on the original dictionary page scan.
vikaraṇam. (for 1.See)"producing a change."(in gram.) a term for the affix or conjugational characteristic which is placed between the root and terminations, the inserted conjugational affix (according to pāṇini- these affixes are śap-, śapo luk-, ślu-, śyan-, śnu-, śa-, śnam-, u-, śnā-, yak-,and cli-[with its substitutes], tāsi-, sya-, sip-,the first nine of which are added in the present tense , imperfect tense , Imperative, and Potential, and before a kṛt- which contains a mute palatal ś-,in the case of Active verbs; yak-is added in the case of the karman- or bhāva- id est Passives or Neuters; cli-is added in the Aorist, tāsi-in the 1st Future, sya-in the 2nd Future and Conditional, and sip-before leṭ-.; lug-vikaraṇa-,"having luk-for its vikaraṇa- "[said of roots of cl. 2.]; ākhyāta-pada-vikaraṇāḥ-,"words which modify the finite verb" id est make it accented) View this entry on the original dictionary page scan.
vikaraṇan. change, modification View this entry on the original dictionary page scan.
vikaraṇan. a disturbing influence View this entry on the original dictionary page scan.
vikaraṇatvan. vikaraṇa
vikaraṇīf. a particular śakti- View this entry on the original dictionary page scan.
vikāratasind. from or through change View this entry on the original dictionary page scan.
vikāratvan. the state of change, transformation View this entry on the original dictionary page scan.
vikāravatmfn. undergoing changes View this entry on the original dictionary page scan.
vikārinmfn. liable to change, changeable, variable View this entry on the original dictionary page scan.
vikārinmfn. undergoing a change, changed into (compound) View this entry on the original dictionary page scan.
vikārinmfn. feeling emotion, falling in love View this entry on the original dictionary page scan.
vikārinmfn. inconstant, disloyal, rebellious (See a-v-) View this entry on the original dictionary page scan.
vikārinmfn. altered or changed for the worse, spoiled, corrupted View this entry on the original dictionary page scan.
vikārinmfn. producing a change for the worse, corrupting (the mind) View this entry on the original dictionary page scan.
vikārinm. n. the 33rd year in Jupiter's cycle of 60 years View this entry on the original dictionary page scan.
vikāritamfn. changed, rendered unfavourable or unfriendly View this entry on the original dictionary page scan.
vikāritāf. () change, alteration. View this entry on the original dictionary page scan.
vikāritvan. () change, alteration. View this entry on the original dictionary page scan.
vikarmakriyāf. an illegal or immoral act, vicious conduct View this entry on the original dictionary page scan.
vikarmakṛtmfn. following unlawful occupation View this entry on the original dictionary page scan.
vikarmakṛtmfn. active or busy in various ways View this entry on the original dictionary page scan.
vikarmann. (for 2.See vi-- kṛ-) prohibited or unlawful act, fraud etc. View this entry on the original dictionary page scan.
vikarmann. various business or duty View this entry on the original dictionary page scan.
vikarmann. (with vāyoḥ-) Name of a sāman- View this entry on the original dictionary page scan.
vikarmanmfn. acting wrongly or unlawfully View this entry on the original dictionary page scan.
vikarmanmfn. not acting, free from action View this entry on the original dictionary page scan.
vikarmaniratamfn. equals ma-kṛt- () View this entry on the original dictionary page scan.
vikarmasthamfn. equals ma-kṛt- () View this entry on the original dictionary page scan.
vikarmikamfn. idem or 'mfn. equals ma-kṛt- ()' View this entry on the original dictionary page scan.
vikarmikam. a clerk or superintendent of markets and fairs View this entry on the original dictionary page scan.
vikarminmfn. acting wrongly or unlawfully View this entry on the original dictionary page scan.
vikarṇamfn. (prob.) having large or divergent ears View this entry on the original dictionary page scan.
vikarṇamfn. having no ears, earless, deaf View this entry on the original dictionary page scan.
vikarṇam. a kind of arrow View this entry on the original dictionary page scan.
vikarṇam. Name of a son of karṇa- View this entry on the original dictionary page scan.
vikarṇam. of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
vikarṇam. (plural) of a people View this entry on the original dictionary page scan.
vikarṇan. Name of a sāman- View this entry on the original dictionary page scan.
vikarṇakam. Name of one of śiva-'s attendants View this entry on the original dictionary page scan.
vikarṇīf. a kind of brick View this entry on the original dictionary page scan.
vikarṇikāf. (See bala-karṇikā-) View this entry on the original dictionary page scan.
vikarṇikam. plural Name of a people View this entry on the original dictionary page scan.
vikarṇinm. a kind of arrow (also ṇi- ) View this entry on the original dictionary page scan.
vikarṣam. the drawing (a bow-string) View this entry on the original dictionary page scan.
vikarṣam. parting or dragging or drawing asunder (as in the separation of semivowel-combinations etc.) View this entry on the original dictionary page scan.
vikarṣam. distance View this entry on the original dictionary page scan.
vikarṣam. an arrow View this entry on the original dictionary page scan.
vikarṣaṇamfn. drawing (a bow-string) View this entry on the original dictionary page scan.
vikarṣaṇamfn. taking away, removing, destroying View this entry on the original dictionary page scan.
vikarṣaṇan. the act of drawing or dragging asunder View this entry on the original dictionary page scan.
vikarṣaṇan. the drawing (a bow-string) View this entry on the original dictionary page scan.
vikarṣaṇan. putting apart, distributing View this entry on the original dictionary page scan.
vikarṣaṇan. putting off eating, abstinence from food View this entry on the original dictionary page scan.
vikarṣaṇan. searching, investigation View this entry on the original dictionary page scan.
vikarṣaṇan. a cross-throw (in wrestling) View this entry on the original dictionary page scan.
vikarṣaṇam. "distractor", one of the five arrows of kāma-deva- View this entry on the original dictionary page scan.
vikarṣinmfn. causing violent and acute pain in the limbs View this entry on the original dictionary page scan.
vikarṣinmfn. ear-distracting, shrill (as a sound) View this entry on the original dictionary page scan.
vikarta kartana- See p.955. View this entry on the original dictionary page scan.
vikartaSee go-vikarta-. View this entry on the original dictionary page scan.
vikartanamfn. cutting asunder, dividing View this entry on the original dictionary page scan.
vikartanam. the sun (prob. as the"divider of clouds") View this entry on the original dictionary page scan.
vikartanam. a son who has usurped his father's kingdom View this entry on the original dictionary page scan.
vikartanan. the act of cutting asunder or dividing View this entry on the original dictionary page scan.
vikartitamfn. (fr. Causal) cut or torn asunder View this entry on the original dictionary page scan.
vikartṛm. a transformer etc. View this entry on the original dictionary page scan.
vikartṛm. an insulter, offender (varia lectio nikartṛ-). View this entry on the original dictionary page scan.
vikarttṛSee go-vikarttṛ-. View this entry on the original dictionary page scan.
vikāryamfn. to be changed, liable to change View this entry on the original dictionary page scan.
vikāryam. Name of ahaṃ-kāra- (the sense of individuality) View this entry on the original dictionary page scan.
vikaryamf(-)n. being in earth-pits View this entry on the original dictionary page scan.
vikas(also incorrectly written vi-kaś-) cl.1 P. -kasati-, to burst, become split or divided or rent asunder (see v/i-kasta-) ; to open, expand, blossom, bloom etc. (see vikasita-) ; to shine, be bright, beam (with joy etc.) ; to spread out, extend, increase : Causal -kāsayati-, to cause to open or blow or expand or shine View this entry on the original dictionary page scan.
vikāś(in derivatives sometimes confounded with vi-kas-) cl.1 A1. -kāśate-, to appear, become visible, shine forth : Causal -kāśayati-, to cause to appear or shine forth, illuminate, make clear, publish : Intensive See vi-cākaśat- below. 2. View this entry on the original dictionary page scan.
vikāśam. (for 2.See vi-kāś-) absence of manifestation or display, loneliness, privacy View this entry on the original dictionary page scan.
vikasam. the moon View this entry on the original dictionary page scan.
vikasāf. Bengal madder (also written vikaṣā-) View this entry on the original dictionary page scan.
vikasaf. equals māṃsa-rohiṇī- View this entry on the original dictionary page scan.
vikāsam. expanding, budding, blowing (of flowers) View this entry on the original dictionary page scan.
vikāsam. opening (of the mouth or eyes) View this entry on the original dictionary page scan.
vikāsam. opening (of the heart), cheerfulness, serenity View this entry on the original dictionary page scan.
vikāsam. expansion, development, growth View this entry on the original dictionary page scan.
vikāśam. (for 1.See) brightness, radiance View this entry on the original dictionary page scan.
vikāśam. appearance, display, manifestation View this entry on the original dictionary page scan.
vikāśam. equals prasāra- and viṣama-gati- (Scholiast or Commentator) View this entry on the original dictionary page scan.
vikāsabhājmfn. expanded, blown View this entry on the original dictionary page scan.
vikāsabhṛtmfn. expanded, blown View this entry on the original dictionary page scan.
vikāsakamfn. opening, expanding (the mind id est making wise) View this entry on the original dictionary page scan.
vikāśakaincorrectly for vi-kāsana- etc. above. View this entry on the original dictionary page scan.
vikasanan. (ne-kṛ-) gaRa sākṣādādi-. View this entry on the original dictionary page scan.
vikāsanamfn. causing to blow or expand View this entry on the original dictionary page scan.
vikāsanan. developing View this entry on the original dictionary page scan.
vikāśanaincorrectly for vi-kāsana- etc. above. View this entry on the original dictionary page scan.
vikasatmfn. opening, blown, expanding, shining, bright View this entry on the original dictionary page scan.
vikāśatāf. appearance, display View this entry on the original dictionary page scan.
vikāśatvan. idem or 'm. (for 2.See vi-kāś-) absence of manifestation or display, loneliness, privacy ' View this entry on the original dictionary page scan.
vikāśatvan. appearance, display View this entry on the original dictionary page scan.
vikāsinmfn. blossoming, blooming View this entry on the original dictionary page scan.
vikāsinmfn. opened, open (as the eyes or nose) View this entry on the original dictionary page scan.
vikāsinmfn. open = candid, sincere View this entry on the original dictionary page scan.
vikāsinmfn. expanding, developing View this entry on the original dictionary page scan.
vikāsinmfn. extensive, great View this entry on the original dictionary page scan.
vikāsinmfn. (in fine compositi or 'at the end of a compound') rich or abounding in View this entry on the original dictionary page scan.
vikāsinmfn. dissolving, relaxing, paralysing View this entry on the original dictionary page scan.
vikāśinmfn. shining, radiant, (in fine compositi or 'at the end of a compound') illumining, illustrating, explaining View this entry on the original dictionary page scan.
vikāṣinfor vi-kāśin- and vikāsin-. View this entry on the original dictionary page scan.
vikāśinīf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
vikāsinīlotpala -si-nīlotpala- Nom. P. lati- to resemble a blossoming blue lotus-flower View this entry on the original dictionary page scan.
vikasitamfn. () opened, open, expanded, budded, blown etc. View this entry on the original dictionary page scan.
vikāsitamfn. caused to expand, expanded, blown View this entry on the original dictionary page scan.
vikāsitāf. expansion, development View this entry on the original dictionary page scan.
vikāśitaincorrectly for vi-kāsana- etc. above. View this entry on the original dictionary page scan.
vikasitakumudendīvarālokinmfn. looking like the expanded white and blue lotus View this entry on the original dictionary page scan.
vikasitanayanavadanakamalamfn. opening (her) lotus-like eyes and mouth View this entry on the original dictionary page scan.
vikasitavadanamfn. with opened mouth View this entry on the original dictionary page scan.
vikasta(v/i--) mfn. () burst, split, rent asunder View this entry on the original dictionary page scan.
vikasti(v/i--) f. the act of bursting View this entry on the original dictionary page scan.
vikasuka(v/i--) m. a particular agni- View this entry on the original dictionary page scan.
vikaśvara vi-kaṣā-, vi-kaṣvara-, incorrect for vi-kasvara- etc. View this entry on the original dictionary page scan.
vikasvaramfn. opened (as eyes) View this entry on the original dictionary page scan.
vikasvaramfn. expanded, blown View this entry on the original dictionary page scan.
vikasvaramfn. clear (as sound) View this entry on the original dictionary page scan.
vikasvaramfn. candid View this entry on the original dictionary page scan.
vikasvarūpa(?) m. Name of a man View this entry on the original dictionary page scan.
vikaśyapamfn. (a sacrifice) performed without the kaśyapa-s View this entry on the original dictionary page scan.
vikaṭamfn. (for 2.See sub voce, i.e. the word in the Sanskrit order) having no mat, without a mat View this entry on the original dictionary page scan.
vikaṭamf(ā-or ī-)n. (prob. Prakrit for vi-kṛta- see ut--, pra-k-etc.;for 1. vi-kaṭa-See) having an unusual size or aspect, horrible, dreadful, monstrous, huge, large, great etc. ( vikaṭam am- ind.terribly) View this entry on the original dictionary page scan.
vikaṭamf(ā-or ī-)n. unusually handsome View this entry on the original dictionary page scan.
vikaṭamf(ā-or ī-)n. large-toothed View this entry on the original dictionary page scan.
vikaṭamf(ā-or ī-)n. knitted (as brows), frowning View this entry on the original dictionary page scan.
vikaṭamf(ā-or ī-)n. obscure, obsolete View this entry on the original dictionary page scan.
vikaṭam. a kind of plant or fruit View this entry on the original dictionary page scan.
vikaṭam. Name of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
vikaṭam. of one of the attendants of skanda- View this entry on the original dictionary page scan.
vikaṭam. of a rākṣasa- View this entry on the original dictionary page scan.
vikaṭam. of a mythical person View this entry on the original dictionary page scan.
vikaṭam. of a goose View this entry on the original dictionary page scan.
vikaṭāf. a bandy-legged girl (unfit for marriage) View this entry on the original dictionary page scan.
vikaṭam. Name of the mother of gautama- buddha- View this entry on the original dictionary page scan.
vikaṭam. of a female divinity peculiar to Buddhists View this entry on the original dictionary page scan.
vikaṭam. of a rākṣasī- View this entry on the original dictionary page scan.
vikaṭan. (only ) white arsenic View this entry on the original dictionary page scan.
vikaṭan. sandal View this entry on the original dictionary page scan.
vikaṭan. a peculiar attitude in sitting, a boil, tumour View this entry on the original dictionary page scan.
vikaṭābham. "of terrible appearance", Name of an asura- View this entry on the original dictionary page scan.
vikaṭagrāmam. Name of a village View this entry on the original dictionary page scan.
vikaṭakamfn. suffering from a particular deformity View this entry on the original dictionary page scan.
vikaṭākṛtimfn. of dreadful appearance View this entry on the original dictionary page scan.
vikaṭākṣamf(ī-)n. having dreadful eyes View this entry on the original dictionary page scan.
vikaṭākṣam. Name of an asura- View this entry on the original dictionary page scan.
vikaṭamind. vikaṭa
vikaṭamūrtimfn. having a hideous or distorted shape, deformed, ugly View this entry on the original dictionary page scan.
vikaṭānanamfn. ugly-faced View this entry on the original dictionary page scan.
vikaṭānanam. Name of a son of dhṛtarāṣṭra- View this entry on the original dictionary page scan.
vikaṭanitambāf. Name of a poetess View this entry on the original dictionary page scan.
vikaṭaśṛṅgam. "large-horned", a stag View this entry on the original dictionary page scan.
vikaṭatvan. (in rhetoric) a sound of words reminding of a dance View this entry on the original dictionary page scan.
vikaṭavadanam. "hideous-faced", Name of an attendant of durgā- View this entry on the original dictionary page scan.
vikaṭavarmanm. Name of a king View this entry on the original dictionary page scan.
vikaṭaviṣāṇam. "large-horned", a stag View this entry on the original dictionary page scan.
vikathāf. ( kath-) useless or irrelevant talk View this entry on the original dictionary page scan.
vikaṭīkṛP. -karoti-, to make wide, extend, View this entry on the original dictionary page scan.
vikatthA1. -katthate- (Epic also P. ti-), to boast, vaunt, brag, boast of or about (instrumental case) ; to praise, extol, commend (also ironically) ; to mock or blame, disparage, humiliate by (instrumental case) : Causal -katthayati-, to humiliate, humble ; to boast View this entry on the original dictionary page scan.
vikatthāf. View this entry on the original dictionary page scan.
vikatthanamfn. boasting, a boaster, braggart etc. View this entry on the original dictionary page scan.
vikatthanamfn. praising ironically View this entry on the original dictionary page scan.
vikatthanan. and f(ā-). the act of boasting or vaunting or praising etc. View this entry on the original dictionary page scan.
vikatthanan. irony View this entry on the original dictionary page scan.
vikatthanatvan. boastfulness View this entry on the original dictionary page scan.
vikatthanīyamfn. to be praised (also ironically) View this entry on the original dictionary page scan.
vikatthinmfn. boasting, vaunting, proclaiming View this entry on the original dictionary page scan.
vikatthitan. boast, vaunt, (ironical) praise View this entry on the original dictionary page scan.
vikautukamfn. showing no curiosity or interest, indifferent View this entry on the original dictionary page scan.
vikavacamfn. armourless View this entry on the original dictionary page scan.
vikeśamf(-)n. having loose or dishevelled hair View this entry on the original dictionary page scan.
vikeśamf(-)n. hairless, bald View this entry on the original dictionary page scan.
vikeśam. Name of a muni- View this entry on the original dictionary page scan.
vikeśam. (with tārakā-) "a hair-like star", comet View this entry on the original dictionary page scan.
vikeśam. lint View this entry on the original dictionary page scan.
vikeśam. a small braid or tress of hair (first tied up separately and then collected into the veṇī- or larger braid) View this entry on the original dictionary page scan.
vikeśam. a woman without hair View this entry on the original dictionary page scan.
vikeśam. Name of the wife of śiva- (manifested in the form of mahī- or"the Earth", one of his eight tanus- or visible forms) View this entry on the original dictionary page scan.
vikeśīf. Name of a class of demoniacal beings View this entry on the original dictionary page scan.
vikeśikāf. a kind of compress, lint View this entry on the original dictionary page scan.
viketumfn. deprived of the flag or banner View this entry on the original dictionary page scan.
viketu vi-keśa- etc. See . View this entry on the original dictionary page scan.
vikhamfn. (prob. vi-kha-,also vikhu-and vikhra-), noseless View this entry on the original dictionary page scan.
vikhādam. ( khād-) devouring, destroying (equals saṃgrāma- ) . View this entry on the original dictionary page scan.
vikhāditakan. a dead body which has been devoured by animals View this entry on the original dictionary page scan.
vikhanP. -khanati-, to dig up View this entry on the original dictionary page scan.
vikhananan. digging up View this entry on the original dictionary page scan.
vikhanasm. Name of brahmā- View this entry on the original dictionary page scan.
vikhanasm. of a muni- (see vi-khānasa-). View this entry on the original dictionary page scan.
vikhānasam. (prob.)"one who digs up (scilicet roots)" , Name of a muni- (see vaikhānasa-). View this entry on the original dictionary page scan.
vikhaṇḍinmfn. breaking, removing, destroying (enmity) View this entry on the original dictionary page scan.
vikhaṇḍitamfn. ( khaṇḍ-) cut into pieces, divided, lacerated View this entry on the original dictionary page scan.
vikhaṇḍitamfn. torn asunder, cleft in two View this entry on the original dictionary page scan.
vikhaṇḍitamfn. disturbed, interrupted View this entry on the original dictionary page scan.
vikhaṇḍitamfn. refuted View this entry on the original dictionary page scan.
vikhāsāf. the tongue View this entry on the original dictionary page scan.
vikhedamfn. free from weariness, fresh, alert View this entry on the original dictionary page scan.
vikhidP. -khidati-, to tear asunder, rend apart View this entry on the original dictionary page scan.
vikhraor vikhru- See vikha- above. View this entry on the original dictionary page scan.
vikhuram. "hoofless", a goblin, demon, rākṣasa- View this entry on the original dictionary page scan.
vikhura vi-kheda- See p.950. View this entry on the original dictionary page scan.
vikhyāP. -khyāti- (Ved. infinitive mood vikhye- ; vi-khy/ai- ), to look about, look at, view, see, behold ; to shine, shine upon, lighten, illumine : Causal -khyāpayati-, to show, make visible ; to make known, announce, proclaim, declare View this entry on the original dictionary page scan.
vikhyāpanan. making known, announcing, publishing View this entry on the original dictionary page scan.
vikhyāpanan. explanation, exposition View this entry on the original dictionary page scan.
vikhyāpanan. avowing, acknowledging, confessing View this entry on the original dictionary page scan.
vikhyātamfn. generally known, notorious, famous, celebrated etc. View this entry on the original dictionary page scan.
vikhyātamfn. known as, called, named View this entry on the original dictionary page scan.
vikhyātamfn. avowed, confessed View this entry on the original dictionary page scan.
vikhyātif. fame, celebrity, renown View this entry on the original dictionary page scan.
vikira vi-kiraṇa-, vi-kīrṇa- etc. See under vi-kṝ-. View this entry on the original dictionary page scan.
vikiram. scattering or anything scattered View this entry on the original dictionary page scan.
vikiram. a scattered portion of rice (offered to conciliate beings hostile to sacrifice) View this entry on the original dictionary page scan.
vikiram. "scatterer", a kind of gallinaceous bird View this entry on the original dictionary page scan.
vikiram. a particular agni- View this entry on the original dictionary page scan.
vikiram. water trickled through (cikira- ) View this entry on the original dictionary page scan.
vikiraṇan. scattering, strewing on View this entry on the original dictionary page scan.
vikiraṇam. a particular samādhi- (varia lectio vikiriṇa-). View this entry on the original dictionary page scan.
vikīraṇam. Calotropis Gigantea View this entry on the original dictionary page scan.
vikiriḍa()mfn. applied to rudra- (according to to Scholiast or Commentator"averting wounds"or"sending off arrows") .
vikirida() mfn. applied to rudra- (according to to Scholiast or Commentator"averting wounds"or"sending off arrows") .
vikiridra() mfn. applied to rudra- (according to to Scholiast or Commentator"averting wounds"or"sending off arrows") .
vikīrṇamfn. scattered, thrown about, dispersed etc. View this entry on the original dictionary page scan.
vikīrṇamfn. dishevelled (as hair) (see compound) View this entry on the original dictionary page scan.
vikīrṇamfn. filled with, full of (compound) View this entry on the original dictionary page scan.
vikīrṇamfn. celebrated, famous View this entry on the original dictionary page scan.
vikīrṇan. a particular fault in the pronunciation of vowels View this entry on the original dictionary page scan.
vikīrṇakeśamfn. having dishevelled hair (see above) View this entry on the original dictionary page scan.
vikīrṇamūrdhajamfn. having dishevelled hair (see above) View this entry on the original dictionary page scan.
vikīrṇaromann. a kind of fragrant plant View this entry on the original dictionary page scan.
vikīrṇasaṃjñan. a kind of fragrant plant View this entry on the original dictionary page scan.
vikiṣkum. a carpenter's measure of 42 inches View this entry on the original dictionary page scan.
vikkam. an elephant twenty years old View this entry on the original dictionary page scan.
viklam(only in perfect tense -caklame-), to become faint or weak, despond, despair View this entry on the original dictionary page scan.
viklāntamfn. dispirited, fatigued, wearied View this entry on the original dictionary page scan.
viklavA1. -klavate-, to become agitated or confused View this entry on the original dictionary page scan.
viklavaSee under vi-klav-. View this entry on the original dictionary page scan.
viklavamf(ā-)n. overcome with fear or agitation, confused, perplexed, bewildered, alarmed, distressed etc. View this entry on the original dictionary page scan.
viklavamf(ā-)n. timid, shy View this entry on the original dictionary page scan.
viklavamf(ā-)n. (in fine compositi or 'at the end of a compound') disgusted with, averse from View this entry on the original dictionary page scan.
viklavamf(ā-)n. faltering (as speech) View this entry on the original dictionary page scan.
viklavamf(ā-)n. unsteady (as gait) View this entry on the original dictionary page scan.
viklavamf(ā-)n. impaired (as senses) View this entry on the original dictionary page scan.
viklavamf(ā-)n. exhausted View this entry on the original dictionary page scan.
viklavan. agitation, bewilderment View this entry on the original dictionary page scan.
viklavānanamfn. one whose face is troubled or sorrowful View this entry on the original dictionary page scan.
viklavatāf. agitation, confusion, alarm, fear, timidity, irresolution etc. View this entry on the original dictionary page scan.
viklavatvan. agitation, confusion, alarm, fear, timidity, irresolution etc. View this entry on the original dictionary page scan.
viklavayaNom. P. yati-, to render despondent, depress View this entry on the original dictionary page scan.
viklavīin compound for viklava- (gaRa ūry-ādi-). View this entry on the original dictionary page scan.
viklavībhūP. -bhavati-, to grow despondent, despair View this entry on the original dictionary page scan.
viklavīkṛP. -karoti-, to depress, trouble View this entry on the original dictionary page scan.
viklavitan. timid or despondent language View this entry on the original dictionary page scan.
vikledam. getting wet View this entry on the original dictionary page scan.
vikledam. wetness, moisture View this entry on the original dictionary page scan.
vikledam. dissolution, decay View this entry on the original dictionary page scan.
vikledanan. the act of softening (by cooking or boiling) View this entry on the original dictionary page scan.
vikledīyas(v/i--) mfn. moistening more View this entry on the original dictionary page scan.
vikleśam. "indistinctness", incorrect pronunciation of the dentals View this entry on the original dictionary page scan.
viklīind. (with kṛ-, bhū-,or as-) View this entry on the original dictionary page scan.
viklidhamfn. moist with perspiration (others"having projecting teeth"or"leprous") (Scholiast or Commentator) View this entry on the original dictionary page scan.
viklindum. a kind of disease View this entry on the original dictionary page scan.
viklinnamfn. softened (by cooking) View this entry on the original dictionary page scan.
viklinnamfn. dissolved, decayed View this entry on the original dictionary page scan.
viklinnahṛdayamfn. soft-hearted, one whose heart is easily moved with pity View this entry on the original dictionary page scan.
vikliṣṭamfn. ( kliś-) hurt, harassed, destroyed View this entry on the original dictionary page scan.
vikliṣṭan. a particular fault in pronunciation (prob. equals next) .
viklittif. ( klid-) becoming soft or moist View this entry on the original dictionary page scan.
vikḷpA1. -kalpate-, to change or alternate, change with (instrumental case) etc. ; to be undecided or questionable or optionable ; to be doubtful or irresolute, waver, hesitate : Causal -kalpayati-, to prepare, arrange, contrive, form, fashion (in various ways) ; to choose one of two alternatives, proceed eclectically ; to call in question, prescribe variously, pronounce optional ; to combine variously, vary ; to state a dilemma ; to consider with distrust (?) ; to suppose, conjecture, imagine, presume ; to reflect upon
vikokam. Name of a son of the asura- vṛka- and younger brother of koka- View this entry on the original dictionary page scan.
vikośamf(ā-)n. uncovered, denuded, unsheathed, drawn (as a sword) etc. View this entry on the original dictionary page scan.
vikośamf(ā-)n. having no prepuce View this entry on the original dictionary page scan.
vikośamf(ā-)n. containing no passage from a dictionary View this entry on the original dictionary page scan.
vikośa vi-kautuka- etc. See View this entry on the original dictionary page scan.
vikṛP. A1. -karoti-, -kurute-, to make different, transform, change the shape (or the mind), cause to alter or change (especially for the worse), deprave, pervert, spoil, impair etc. ; (Passive voice and A1.,rarely P.) to become different, be altered, change one's state or opinions etc. (see ) ; to develop, produce (especially variously) ; to embellish, decorate (in various manners) ; to distribute, divide ; to destroy, annihilate ; to represent, fill the place of (accusative) ; (A1.; see above) to move to and fro, wave, shake (hands or feet) ; to be or become restless (with netrābhyām-,"to roll the eyes") ; to utter (sounds) ; to become unfaithful to (locative case) ; to act in a hostile or unfriendly way towards (genitive case or locative case) etc. ; to contend together ; to act in various ways ; Passive voice -kriyate-, to be changed etc. (see above) : Causal -kārayati-, to cause to change or be changed View this entry on the original dictionary page scan.
vikṝP. -kirati-, to scatter, throw or toss about, disperse etc. ; to dishevel ; to pour out, utter, heave (sighs) ; to tear asunder, cleave, split, rend, burst etc. ; to scatter over, bestrew, cover, fill with (instrumental case) etc. ; to revile (?) View this entry on the original dictionary page scan.
vikramP. A1. -krāmati-, -kramate- (see ), to step beyond or aside, move away, depart from (ablative) ; to move apart or asunder, become divided ; to go or stride through, traverse ; to move on, walk, go, advance etc. ; to rise to (accusative) ; to bestride ; to show valour or prowess, attack, assail, fight etc.: Causal -kramayati-, to cause to step or stride over or through View this entry on the original dictionary page scan.
vikramam. (forSee vi-kram-) the absence of the krama-pāṭha- (q.v) View this entry on the original dictionary page scan.
vikramam. (for 1.See) a step, stride, pace etc. View this entry on the original dictionary page scan.
vikramam. going, proceeding, walking, motion, gait etc. View this entry on the original dictionary page scan.
vikramam. course, way, manner (anukrama-vikrameṇa- equals anukrameṇa-,in regular order) View this entry on the original dictionary page scan.
vikramam. valour, courage, heroism, power, strength etc. (maṃ-kṛ-,to display prowess, use one's strength) View this entry on the original dictionary page scan.
vikramam. force, forcible means ( vikramāt māt- ind.by force; sti vikrameṇa-,it cannot be done by force) View this entry on the original dictionary page scan.
vikramam. intensity, high degree View this entry on the original dictionary page scan.
vikramam. stability, duration (opp. to"cessation") View this entry on the original dictionary page scan.
vikramam. a kind of grave accent View this entry on the original dictionary page scan.
vikramam. non-change of the visarga- into an ūṣman- View this entry on the original dictionary page scan.
vikramam. the 14th year in the 60 years cycle of Jupiter View this entry on the original dictionary page scan.
vikramam. the 3rd astrological house View this entry on the original dictionary page scan.
vikramam. a foot View this entry on the original dictionary page scan.
vikramam. Name of viṣṇu- View this entry on the original dictionary page scan.
vikramam. of the son of vasu- View this entry on the original dictionary page scan.
vikramam. of a son of vatsa-prī- View this entry on the original dictionary page scan.
vikramam. of a son of kanaka- View this entry on the original dictionary page scan.
vikramam. of various authors (also with bhaṭṭa-) View this entry on the original dictionary page scan.
vikramam. equals candragupta- View this entry on the original dictionary page scan.
vikramam. equals vikramāditya- View this entry on the original dictionary page scan.
vikramam. Name of a town View this entry on the original dictionary page scan.
vikrāmam. a step's width
vikramabāhum. Name of various princes View this entry on the original dictionary page scan.
vikramabhāratan. a modern collection of legends about vikramāditya- and of Pauranic stories View this entry on the original dictionary page scan.
vikramacaṇḍam. Name of a king of vārāṇasī- View this entry on the original dictionary page scan.
vikramacandrikāf. Name of a drama View this entry on the original dictionary page scan.
vikramacaritan. Name of 32 stories describing the acts of vikramāditya- (also called siṃhāsana-dvātriṃśat- q.v) View this entry on the original dictionary page scan.
vikramacaritran. Name of 32 stories describing the acts of vikramāditya- (also called siṃhāsana-dvātriṃśat- q.v) View this entry on the original dictionary page scan.
vikramadevam. Name of candra-gupta- View this entry on the original dictionary page scan.
vikramādityam. See below View this entry on the original dictionary page scan.
vikramādityam. "valour-sun", Name of a celebrated Hindu king (of ujjayinī- and supposed founder of the [ mālava--] vikrama- era[ see saṃvat-],which begins 58 B.C. [but subtract 57-56 from anexpiredyear of the vikrama- era to convert it into A.D.];he is said to have driven out the śaka-s and to have reigned over almost the whole of Northern India;he is represented as a great patron of literature;nine celebrated men are said to have flourished at his court [see nava-ratna-],and innumerable legends are related of him all teeming with exaggerations;according to some he fell in a battle with his rival śāli-vāhana-, king of the south country or Deccan, and the legendary date given for his death is kali-yuga- 3044 [which really is the epoch-year of the vikrama- era];there are, however, other kings called vikramāditya-, and the name has been applied to king bhoja- and even to śāli-vāhana-) etc. View this entry on the original dictionary page scan.
vikramādityam. of a poet ( vikramādityakośa -kośa- m.Name of a dictionary; vikramādityacaritra -caritra- n.Name of a poem equals vikrama-c-; vikramādityarāja -rāja- m.Name of a king) View this entry on the original dictionary page scan.
vikramādityacaritran. vikramāditya
vikramādityakośam. vikramāditya
vikramādityarājam. vikramāditya
vikramakam. Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
vikramakarmann. an act of prowess, feat of valour View this entry on the original dictionary page scan.
vikramakesarinm. Name of a king of pāṭali-putra-
vikramakesarinm. of a minister of mṛgāṅka-datta- View this entry on the original dictionary page scan.
vikramalāñchanam. idem or 'm. (for ṛddhi-) (with kavi-) Name of a poet ' View this entry on the original dictionary page scan.
vikramaṇan. striding, a step, pace, stride (especially of viṣṇu-) etc. View this entry on the original dictionary page scan.
vikramaṇan. bold advance, courage, heroism, strength, power View this entry on the original dictionary page scan.
vikramaṇan. (with pāśupata-s) supernatural power ( vikramaṇadharmitva -dharmi-tva- n.the being possessed of the above power) View this entry on the original dictionary page scan.
vikramaṇan. the conforming to the rules of the krama-pāṭha- (q.v) View this entry on the original dictionary page scan.
vikramaṇadharmitvan. vikramaṇa
vikramanareśvaram. equals vikramāditya- View this entry on the original dictionary page scan.
vikramanavaratnan. "the 9 jewels (on the court) of vikramāditya-"Name of work View this entry on the original dictionary page scan.
vikramanidhim. Name of a warrior View this entry on the original dictionary page scan.
vikramāṅkam. (or -deva-) Name of a king of kalyāṇa- (also called tribhuvana-malla-;of the 11th century A.D. and was celebrated by bilhaṇa- in the vikramāṅka-deva-carita-) View this entry on the original dictionary page scan.
vikramapatim. equals vikramāditya- View this entry on the original dictionary page scan.
vikramapaṭṭanan. " vikramāditya-'s town", Name of ujjayinī- View this entry on the original dictionary page scan.
vikramaprabandham. Name of work View this entry on the original dictionary page scan.
vikramapuran. Name of a town (prob. equals -paṭṭana-) () View this entry on the original dictionary page scan.
vikramapurīf. Name of a town (prob. equals -paṭṭana-) () View this entry on the original dictionary page scan.
vikramarājam. Name of a king View this entry on the original dictionary page scan.
vikramarājanm. equals vikramāditya- View this entry on the original dictionary page scan.
vikramarddhim. (for ṛddhi-) (with kavi-) Name of a poet View this entry on the original dictionary page scan.
vikramārjitamfn. acquired by valour View this entry on the original dictionary page scan.
vikramārkam. equals vikramāditya- ( vikramārkacarita -carita- n., vikramārkacaritra -caritra- n. equals vikrama-c-) View this entry on the original dictionary page scan.
vikramārkacaritan. vikramārka
vikramārkacaritran. vikramārka
vikramasabhāf. vikramāditya-'s court View this entry on the original dictionary page scan.
vikramaśaktim. Name of various men of the warrior-caste View this entry on the original dictionary page scan.
vikramasenam. Name of a king of pratiṣṭhāna- ( vikramasenacampū na-campū- f.Name of a poem) View this entry on the original dictionary page scan.
vikramasenacampūf. vikramasena
vikramaśīlam. Name of a king View this entry on the original dictionary page scan.
vikramaśīlam. of a monastery View this entry on the original dictionary page scan.
vikramasiṃham. Name of a king of ujjayinī- View this entry on the original dictionary page scan.
vikramasiṃham. of a king of ujjayinī- View this entry on the original dictionary page scan.
vikramasthānan. a walking-place, promenade, View this entry on the original dictionary page scan.
vikramātind. vikrama
vikramatuṅgam. Name of a prince of pāṭali-putra- View this entry on the original dictionary page scan.
vikramatuṅgam. of a prince of vikrama-pura- View this entry on the original dictionary page scan.
vikrameśam. Name of a Buddhist saint View this entry on the original dictionary page scan.
vikrameśvaram. (with ) Name of one of the 8 vīta-rāga-s View this entry on the original dictionary page scan.
vikrameśvaram. of a temple built by vikramāditya- View this entry on the original dictionary page scan.
vikraminmfn. striding (said of viṣṇu-) View this entry on the original dictionary page scan.
vikraminmfn. displaying valour, courageous, gallant View this entry on the original dictionary page scan.
vikraminm. a lion View this entry on the original dictionary page scan.
vikramīyaName of a commentator or commentary on the anangharāghava-. View this entry on the original dictionary page scan.
vikramodayan. Name of work View this entry on the original dictionary page scan.
vikramopākhyānan. equals vikrama-carita- View this entry on the original dictionary page scan.
vikramorvaśīf. "valour-(won) urvaśī-", Name of a celebrated drama by kālidāsa-. View this entry on the original dictionary page scan.
vikrāntamfn. stepped beyond, taking wide strides etc. View this entry on the original dictionary page scan.
vikrāntamfn. courageous, bold, strong, mighty, victorious (with dhanuṣi-,skilled in archery) View this entry on the original dictionary page scan.
vikrāntam. a warrior View this entry on the original dictionary page scan.
vikrāntam. a lion View this entry on the original dictionary page scan.
vikrāntam. "passed over", Name of a kind of saṃdhi- which leaves visarga- unchanged View this entry on the original dictionary page scan.
vikrāntam. Name of a prajā-pati- View this entry on the original dictionary page scan.
vikrāntam. of a son of kuvalayāśva- and madālasā- View this entry on the original dictionary page scan.
vikrāntāf. Name of various plants (Cocculus Cordifolius, Clitoria Ternatea, Cissus Pedata etc.) View this entry on the original dictionary page scan.
vikrāntan. a step, stride View this entry on the original dictionary page scan.
vikrāntan. manner of walking, gait View this entry on the original dictionary page scan.
vikrāntan. bold advance, courage, might View this entry on the original dictionary page scan.
vikrāntan. a sham diamond View this entry on the original dictionary page scan.
vikrāntan. a kind of intoxicating drink View this entry on the original dictionary page scan.
vikrāntabhīmam. Name of a drama View this entry on the original dictionary page scan.
vikrāntagatim. a man with a portly gait View this entry on the original dictionary page scan.
vikrāntaśūdrakam. Name of a drama View this entry on the original dictionary page scan.
vikrāntayodhinm. an excellent warrior View this entry on the original dictionary page scan.
vikrāntif. stepping or striding through, striding everywhere id est all-pervading power View this entry on the original dictionary page scan.
vikrāntif. a horse's gallop View this entry on the original dictionary page scan.
vikrāntif. heroism, prowess, courage, strength, might View this entry on the original dictionary page scan.
vikrāntivarmanm. (with lubdhaka-) Name of a poet (see viśrānti-v-). View this entry on the original dictionary page scan.
vikrāntṛm. "valiant", a hero View this entry on the original dictionary page scan.
vikrasraSee vikusra-. View this entry on the original dictionary page scan.
vikrayam. sale, selling, vending etc. View this entry on the original dictionary page scan.
vikrayakam. a seller (Bombay edition krayika-). View this entry on the original dictionary page scan.
vikrayaṇan. the act of selling View this entry on the original dictionary page scan.
vikrayānuśayam. rescission of sale View this entry on the original dictionary page scan.
vikrayapattran. a bill of sale View this entry on the original dictionary page scan.
vikrayārthamind. for sale View this entry on the original dictionary page scan.
vikrayikaSee krayaka-. View this entry on the original dictionary page scan.
vikrāyikam. a seller View this entry on the original dictionary page scan.
vikrayinm. a seller, vender View this entry on the original dictionary page scan.
vikrayyamfn. to be sold View this entry on the original dictionary page scan.
vikretavyamfn. to be sold, saleable View this entry on the original dictionary page scan.
vikretṛm. a seller View this entry on the original dictionary page scan.
vikreyamfn. to be sold, vendible etc. View this entry on the original dictionary page scan.
vikreyan. (prob.) selling price View this entry on the original dictionary page scan.
vikrīA1. -krīṇīte- () , to buy and sell, barter, trade ; to sell, vend, sell or exchange for (instrumental case) etc.: Desiderative -cikrīṣate-, to wish to sell, desire to exchange for (instrumental case) View this entry on the original dictionary page scan.
vikrīḍP. -krīḍati-, to play, jest, sport with (saha-) View this entry on the original dictionary page scan.
vikriḍamfn. (applied to rudra-) View this entry on the original dictionary page scan.
vikrīḍam. a play-ground View this entry on the original dictionary page scan.
vikrīḍam. a plaything, toy View this entry on the original dictionary page scan.
vikrīḍāf. play, sport View this entry on the original dictionary page scan.
vikrīḍitamfn. played, played with, made a plaything of View this entry on the original dictionary page scan.
vikrīḍitan. play, sport View this entry on the original dictionary page scan.
vikrīḍitan. a child's play (id est"easy work") View this entry on the original dictionary page scan.
vikrītamfn. sold etc. View this entry on the original dictionary page scan.
vikrītam. Name of a prajā-pati- (varia lectio vi-kṛta-and vi-krānta-) View this entry on the original dictionary page scan.
vikrītan. sale View this entry on the original dictionary page scan.
vikriyāf. transformation, change, modification, altered or unnatural condition View this entry on the original dictionary page scan.
vikriyāf. change for the worse, deterioration, disfigurement, deformity View this entry on the original dictionary page scan.
vikriyāf. ailment, indisposition, affection
vikriyāf. perturbation, agitation, perplexity etc. View this entry on the original dictionary page scan.
vikriyāf. hostile feeling, rebellion, defection, alienation View this entry on the original dictionary page scan.
vikriyāf. injury, harm, failure, misadventure (accusative with -,to suffer injury, undergo failure) View this entry on the original dictionary page scan.
vikriyāf. extinction (of a lamp) View this entry on the original dictionary page scan.
vikriyāf. a strange or unwonted phenomenon View this entry on the original dictionary page scan.
vikriyāf. any product or preparation View this entry on the original dictionary page scan.
vikriyāf. contraction, knitting (of the brows;See bhrū-v-) View this entry on the original dictionary page scan.
vikriyāf. bristling (of the hair;See roma-v-) View this entry on the original dictionary page scan.
vikriyopamāf. a kind of simile (in which the object of comparison is represented as produced from that to which it is compared exempli gratia, 'for example'"thy face, O fair one, seems to be cut out from the disc of the moon") View this entry on the original dictionary page scan.
vikrodhamfn. free from anger or wrath View this entry on the original dictionary page scan.
vikrośam. a cry of alarm or help View this entry on the original dictionary page scan.
vikrośanam. N. a mythical being View this entry on the original dictionary page scan.
vikrośanam. of a king View this entry on the original dictionary page scan.
vikrośanan. the act of calling out View this entry on the original dictionary page scan.
vikrośanan. abasing, reviling View this entry on the original dictionary page scan.
vikrośayitṛm. a word used to explain kuśika- View this entry on the original dictionary page scan.
vikroṣṭṛm. one who calls out or cries for help View this entry on the original dictionary page scan.
vikroṣṭṛm. a reviler View this entry on the original dictionary page scan.
vikṛśCaus. -karśayati- (only past participle -karśita-), to emaciate, distort, deform View this entry on the original dictionary page scan.
vikṛṣP. -karṣati-, -kṛṣati- (te-), to draw apart or asunder, tear to pieces, destroy ; to bend (a bow), draw (a bowstring) ; to widen, extend ; to draw along or after ; to lead (an army) ; to pull out ; to deprive ; to withdraw, keep back ; (-kṛṣati-), to draw a furrow, plough View this entry on the original dictionary page scan.
vikṛṣṭamfn. drawn apart or asunder etc. View this entry on the original dictionary page scan.
vikṛṣṭamfn. separated, isolated (as vowels) (also -kṛṣita-) View this entry on the original dictionary page scan.
vikṛṣṭamfn. extended, protracted, long View this entry on the original dictionary page scan.
vikṛṣṭamfn. robbed plundered View this entry on the original dictionary page scan.
vikṛṣṭamfn. sounded, making a noise View this entry on the original dictionary page scan.
vikṛṣṭāf. a particular method of beating a drum View this entry on the original dictionary page scan.
vikṛṣṭakālam. a long period View this entry on the original dictionary page scan.
vikṛṣṭasīmāntamfn. (a village) having extended boundaries View this entry on the original dictionary page scan.
vikṛtP. -kṛntati-, (rarely -kartati-), to cut into or through, divide by cutting, tear or rend asunder : Causal -kartayati- idem or 'f. a kind of simile (in which the object of comparison is represented as produced from that to which it is compared exempli gratia, 'for example'"thy face, O fair one, seems to be cut out from the disc of the moon") ' (See -kartita-). View this entry on the original dictionary page scan.
vikṛtamfn. transformed, altered, changed etc. View this entry on the original dictionary page scan.
vikṛtamfn. (especially) deformed, disfigured, mutilated, maimed, unnatural, strange, extraordinary etc. View this entry on the original dictionary page scan.
vikṛtamfn. unaccomplished, incomplete View this entry on the original dictionary page scan.
vikṛtamfn. ugly (as a face) View this entry on the original dictionary page scan.
vikṛtamfn. estranged, rebellious, disloyal, hostile View this entry on the original dictionary page scan.
vikṛtamfn. decorated, embellished, set with (compound) View this entry on the original dictionary page scan.
vikṛtam. (with vadha- m.) capital punishment with mutilation View this entry on the original dictionary page scan.
vikṛtamfn. sick, diseased. View this entry on the original dictionary page scan.
vikṛtam. the 24th year in Jupiter's cycle of 60 years View this entry on the original dictionary page scan.
vikṛtam. Name of a prajā-pati- (varia lectio vi-krīta-and vi-krānta-) View this entry on the original dictionary page scan.
vikṛtam. of a demon (the son of pari-varta-) View this entry on the original dictionary page scan.
vikṛtāf. Name of a yoginī- View this entry on the original dictionary page scan.
vikṛtan. change, alteration View this entry on the original dictionary page scan.
vikṛtan. disgust, aversion View this entry on the original dictionary page scan.
vikṛtan. misshaped offspring, abortion View this entry on the original dictionary page scan.
vikṛtan. untimely silence caused by embarrassment (varia lectio vi-hṛta-) View this entry on the original dictionary page scan.
vikṛtabuddhimfn. changed in mind, estranged, made unfriendly or ill-disposed View this entry on the original dictionary page scan.
vikṛtadaṃṣṭram. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
vikṛtadarśanamfn. changed in appearance View this entry on the original dictionary page scan.
vikṛtajananaśāntividhānan. Name of a chapter of the padma-purāṇa- View this entry on the original dictionary page scan.
vikṛtākāramfn. changed in form or appearance, misshaped, distorted in form View this entry on the original dictionary page scan.
vikṛtākṛtimfn. having a deformed shape or aspect View this entry on the original dictionary page scan.
vikṛtākṣamfn. blind Va1rtt. 2 View this entry on the original dictionary page scan.
vikṛtalocanamfn. having troubled eyes View this entry on the original dictionary page scan.
vikṛtamūrdhajamfn. having a disturbed face and dishevelled hair View this entry on the original dictionary page scan.
vikṛtānanamfn. equals ta-vadana- above View this entry on the original dictionary page scan.
vikṛtāṅgamfn. changed in form, having misshaped limbs, deformed View this entry on the original dictionary page scan.
vikṛtaraktamfn. dyed red, red-stained (as a garment) View this entry on the original dictionary page scan.
vikṛtatvan. the state of being changed, transformation View this entry on the original dictionary page scan.
vikṛtavadanamfn. having a distorted face, ugly-faced View this entry on the original dictionary page scan.
vikṛtaveṣinmfn. having an unusual dress View this entry on the original dictionary page scan.
vikṛtif. change, alteration, modification, variation, changed condition (of body or mind; accusative with gam-, -, vraj-,or pra-pad-,to undergo a change, be changed) etc. View this entry on the original dictionary page scan.
vikṛtif. sickness, disease View this entry on the original dictionary page scan.
vikṛtif. perturbation, agitation, emotion etc. View this entry on the original dictionary page scan.
vikṛtif. alienation, hostility, defection View this entry on the original dictionary page scan.
vikṛtif. a verse changed in a particular manner View this entry on the original dictionary page scan.
vikṛtif. an apparition, phantom, spectre View this entry on the original dictionary page scan.
vikṛtif. any production (in fine compositi or 'at the end of a compound' anything made of) View this entry on the original dictionary page scan.
vikṛtif. (in sāṃkhya-) = 2. vi-kāra- View this entry on the original dictionary page scan.
vikṛtif. (in gram.) a derivative View this entry on the original dictionary page scan.
vikṛtif. formation, growth, development View this entry on the original dictionary page scan.
vikṛtif. abortion (varia lectio vaikṛta-) View this entry on the original dictionary page scan.
vikṛtif. equals ḍimba- View this entry on the original dictionary page scan.
vikṛtif. equals pralāpa- View this entry on the original dictionary page scan.
vikṛtif. Name of a class of metres View this entry on the original dictionary page scan.
vikṛtim. Name of a son of jīmūta- View this entry on the original dictionary page scan.
vikṛtihautran. Name of work View this entry on the original dictionary page scan.
vikṛtikaumudīf. Name of work View this entry on the original dictionary page scan.
vikṛtimatmfn. liable to change View this entry on the original dictionary page scan.
vikṛtimatmfn. indisposed, ill View this entry on the original dictionary page scan.
vikṛtipradīpikāf. Name of work View this entry on the original dictionary page scan.
vikṛtodaram. Name of a rākṣasa- View this entry on the original dictionary page scan.
vikṛttikāf. (perhaps wrong reading for kṛntikā-) acute and violent pain in the limbs View this entry on the original dictionary page scan.
vikṛttikṛntam. one who cuts through or rends asunder ( pra-kṛntā-). View this entry on the original dictionary page scan.
vikruśP. -krośati- (Epic also te-), to cry out, exclaim etc. ; to raise or utter (a cry) ; to call to, invoke (accusative) ; to sound ; to revile View this entry on the original dictionary page scan.
vikruṣṭamfn. called out etc. View this entry on the original dictionary page scan.
vikruṣṭamfn. harsh, abusive, cruel (as speech) View this entry on the original dictionary page scan.
vikruṣṭamfn. in fine compositi or 'at the end of a compound' offensive to (exempli gratia, 'for example' loka-v-,offensive to men) View this entry on the original dictionary page scan.
vikruṣṭan. a cry of alarm or help View this entry on the original dictionary page scan.
vikruṣṭan. abasing, reviling View this entry on the original dictionary page scan.
vikṣāf. gaRa chattrādi-. View this entry on the original dictionary page scan.
vikṣālitamfn. (2. kṣal-), washed off, bathed View this entry on the original dictionary page scan.
vikṣāmamfn. ( kṣai-) burnt (as a cake) View this entry on the original dictionary page scan.
vikṣāman. "what has burnt out", a dead coal View this entry on the original dictionary page scan.
vikṣaṇamind. momentarily, for a moment View this entry on the original dictionary page scan.
vikṣaṇamSee . View this entry on the original dictionary page scan.
vikṣarP. -kṣarati-, to flow away or into View this entry on the original dictionary page scan.
vikṣaramf(ā-)n. pouring out View this entry on the original dictionary page scan.
vikṣaram. effluence View this entry on the original dictionary page scan.
vikṣaram. Name of viṣṇu-kṛṣṇa- View this entry on the original dictionary page scan.
vikṣaram. of an asura- View this entry on the original dictionary page scan.
vikṣāram. a lucky hit (Scholiast or Commentator) View this entry on the original dictionary page scan.
vikṣaraṇan. flowing out View this entry on the original dictionary page scan.
vikṣatamfn. ( kṣan-,or kṣaṇ-) hurt severely, wounded View this entry on the original dictionary page scan.
vikṣatan. a wound View this entry on the original dictionary page scan.
vikṣāvam. ( kṣu-) sneezing, cough View this entry on the original dictionary page scan.
vikṣāvam. a sound, cry (plural) View this entry on the original dictionary page scan.
vikṣayaSee under vi-- 4. kṣi-. View this entry on the original dictionary page scan.
vikṣayam. a particular disease of drunkards View this entry on the original dictionary page scan.
vikṣepam. the act of throwing asunder or away or about, scattering, dispersion View this entry on the original dictionary page scan.
vikṣepam. casting, throwing, discharging View this entry on the original dictionary page scan.
vikṣepam. moving about or to and fro, waving, shaking, tossing etc. View this entry on the original dictionary page scan.
vikṣepam. drawing (a bow-string) View this entry on the original dictionary page scan.
vikṣepam. letting loose, indulging (opp. to saṃyama-) View this entry on the original dictionary page scan.
vikṣepam. letting slip, neglecting (time) View this entry on the original dictionary page scan.
vikṣepam. inattention, distraction, confusion, perplexity View this entry on the original dictionary page scan.
vikṣepam. extension, projection (See -śakti-) View this entry on the original dictionary page scan.
vikṣepam. abusing, reviling View this entry on the original dictionary page scan.
vikṣepam. compassion, pity View this entry on the original dictionary page scan.
vikṣepam. celestial or polar latitude View this entry on the original dictionary page scan.
vikṣepam. a kind of weapon () View this entry on the original dictionary page scan.
vikṣepam. a camp, cantonment (?) View this entry on the original dictionary page scan.
vikṣepam. a kind of disease View this entry on the original dictionary page scan.
vikṣepam. sending, dispatching View this entry on the original dictionary page scan.
vikṣepam. refuting an argument View this entry on the original dictionary page scan.
vikṣepādhipatim. the chief of a camp or cantonment (?) View this entry on the original dictionary page scan.
vikṣepadhruvam. (in astronomy) the greatest inclination of a planet's orbit View this entry on the original dictionary page scan.
vikṣepalipim. a kind of writing View this entry on the original dictionary page scan.
vikṣepamind. carrying to and fro, tossing, shaking (accusative or compound) View this entry on the original dictionary page scan.
vikṣepaṇan. the act of throwing asunder or away etc. View this entry on the original dictionary page scan.
vikṣepaṇan. moving to and fro, tossing about View this entry on the original dictionary page scan.
vikṣepaṇan. confusion proceeding from error (varia lectio for vi-kṣepa-). View this entry on the original dictionary page scan.
vikṣepaśaktif. (in philosophy) the projecting power (of māyā- or a-vidyā- id est that power of projection which raises upon the soul enveloped by it the appearance of an external world) ( vikṣepaśaktimat ti-mat- mfn.endowed with the above power ) View this entry on the original dictionary page scan.
vikṣepaśaktimatmfn. vikṣepaśakti
vikṣepavṛttan. equals kṣepa-v- View this entry on the original dictionary page scan.
vikṣeptṛm. a scatter, disperser View this entry on the original dictionary page scan.
vikṣiP. -kṣiṇāti-, (infinitive mood -kṣetas-, ) , to hurt, harm, waste, ruin, destroy : Desiderative -cikṣīṣati-, to wish to hurt etc. View this entry on the original dictionary page scan.
vikṣīṇamfn. diminished, destroyed (/a-v-) View this entry on the original dictionary page scan.
vikṣīṇaka varia lectio for kṣiṇatk/a- View this entry on the original dictionary page scan.
vikṣīṇakam. "destroyer", Name of the chief of a class of demigods attendant on śiva- (described as causing destruction by pestilential diseases etc.) View this entry on the original dictionary page scan.
vikṣīṇakam. a meeting or assembly of the gods View this entry on the original dictionary page scan.
vikṣīṇakam. a place prohibited to eaters of meat View this entry on the original dictionary page scan.
vikṣiṇatkamfn. destroying (evil) () View this entry on the original dictionary page scan.
vikṣipP. A1. -kṣipati-, te-, to throw asunder or away or about, cast hither and thither, scatter, disperse etc. ; to remove, destroy (pain) ; to extend, stretch out ; to bend (a bow), draw (a bow-string) ; to handle, manage on ; to separate ; to cause to deviate in latitude View this entry on the original dictionary page scan.
vikṣiptamfn. thrown asunder or away or about, scattered etc. View this entry on the original dictionary page scan.
vikṣiptamfn. distorted, contracted (See compound) View this entry on the original dictionary page scan.
vikṣiptamfn. agitated, bewildered, distraught View this entry on the original dictionary page scan.
vikṣiptamfn. frustrated (See a-v-) View this entry on the original dictionary page scan.
vikṣiptamfn. sent, dispatched View this entry on the original dictionary page scan.
vikṣiptamfn. refuted, falsified View this entry on the original dictionary page scan.
vikṣiptamfn. projected (See vi-kṣepa-) View this entry on the original dictionary page scan.
vikṣiptan. the being dispersed in different places View this entry on the original dictionary page scan.
vikṣiptabhrūmfn. having contracted eyebrows View this entry on the original dictionary page scan.
vikṣiptacittamfn. distraught in mind View this entry on the original dictionary page scan.
vikṣiptakan. a dead body which has been torn asunder or lacerated View this entry on the original dictionary page scan.
vikṣiptendriyadhīmfn. bewildered in senses and mind View this entry on the original dictionary page scan.
vikṣīram. Calotropis Gigantea View this entry on the original dictionary page scan.
vikṣitamfn. brought down, wretched, miserable View this entry on the original dictionary page scan.
vikṣobham. shaking, agitation, motion View this entry on the original dictionary page scan.
vikṣobham. mental agitation, perturbation, distraction, alarm etc. (see /a-v-) View this entry on the original dictionary page scan.
vikṣobham. tearing open or asunder View this entry on the original dictionary page scan.
vikṣobham. the side of an elephant's breast View this entry on the original dictionary page scan.
vikṣobhaṇam. Name of a dānava- View this entry on the original dictionary page scan.
vikṣobhaṇan. tossing about, violent motion View this entry on the original dictionary page scan.
vikṣobhinmfn. agitating, disturbing (See rakṣo-vikṣobhiṇi-). View this entry on the original dictionary page scan.
vikṣobhitamfn. (fr. Causal) shaken, tossed about, agitated View this entry on the original dictionary page scan.
vikṣubdhamfn. disturbed (See /a-v-). View this entry on the original dictionary page scan.
vikṣubhA1. -kṣobhate- etc. (Ved. infinitive mood vi-kṣobdhos- ), to be shaken about or agitated or disturbed ; to confuse, disturb : Causal -kṣobhayati-, to agitate, disturb, throw into disorder or confusion View this entry on the original dictionary page scan.
vikṣubhāf. Name of chāyā- View this entry on the original dictionary page scan.
vikṣudhP. -kṣudhyati-, to be hungry View this entry on the original dictionary page scan.
vikṣudramfn. comparatively smaller, each smaller than another View this entry on the original dictionary page scan.
vikṣudraSee . View this entry on the original dictionary page scan.
vikṣuṇṇamfn. ( kṣud-) trodden, pounded View this entry on the original dictionary page scan.
vikṣuṇṇamfn. (in fine compositi or 'at the end of a compound') urged on, actuated by
viktaSee under vic-, . View this entry on the original dictionary page scan.
viktamfn. separated etc. (see vi-vikta-) View this entry on the original dictionary page scan.
viktamfn. empty (prob. wrong reading for rikta-) View this entry on the original dictionary page scan.
vikūbaramfn. deprived of the shaft or pole View this entry on the original dictionary page scan.
vikucitan. ( kuc-) a particular mode of fighting View this entry on the original dictionary page scan.
vikughāsa gaRa kṛśāśvādi- (varia lectio vikutyāsa-). View this entry on the original dictionary page scan.
vikūjcl.1 P. -kūjati-, to chirp, sing, hum, warble (as birds) View this entry on the original dictionary page scan.
vikujamfn. without the planet Mars View this entry on the original dictionary page scan.
vikujamfn. (with dina-) any day except Tuesday View this entry on the original dictionary page scan.
vikūjanan. rumbling (See antra-vik-). View this entry on the original dictionary page scan.
vikujaravīndumfn. without Mars and sun and moon View this entry on the original dictionary page scan.
vikūjitan. humming, chirping, singing (of birds) View this entry on the original dictionary page scan.
vikukṣimfn. having a prominent belly ( vikukṣitva -tva- n.) (also kṣika-) View this entry on the original dictionary page scan.
vikukṣim. Name of a son or grandson of ikṣvāku- View this entry on the original dictionary page scan.
vikukṣi vi-kuja- etc. See . View this entry on the original dictionary page scan.
vikukṣitvan. vikukṣi
vikumbhāṇḍam. Name of a dānava- View this entry on the original dictionary page scan.
vikūṇto contract, wrinkle (the face) View this entry on the original dictionary page scan.
vikūṇanan. contraction (mukhav-,wrinkling the face) View this entry on the original dictionary page scan.
vikūṇanan. a side-glance, leer, wink View this entry on the original dictionary page scan.
vikuñcCaus. -kuñcayati-, to contract, draw back (the ears) View this entry on the original dictionary page scan.
vikuñcitamfn. contracted, crisped, curled, knitted (as the brow) View this entry on the original dictionary page scan.
vikuñcitabhrūlatamind. with contracted eyebrows, frowning View this entry on the original dictionary page scan.
vikuñcitalalāṭabhṛtmfn. having a scowling brow View this entry on the original dictionary page scan.
vikuṇḍalamfn. having no earrings View this entry on the original dictionary page scan.
vikuṇḍalam. Name of a man View this entry on the original dictionary page scan.
vikūṇikāf. the nose View this entry on the original dictionary page scan.
vikuñjam. plural Name of a people View this entry on the original dictionary page scan.
vikuṇṭhamfn. sharp, keen, penetrating, irresistible View this entry on the original dictionary page scan.
vikuṇṭhamfn. very blunt (a-v-,sharp etc.) View this entry on the original dictionary page scan.
vikuṇṭham. Name of viṣṇu- View this entry on the original dictionary page scan.
vikuṇṭham. Name of viṣṇu-'s heaven View this entry on the original dictionary page scan.
vikuṇṭhanam. Name of a son of hastin- View this entry on the original dictionary page scan.
vikuṇṭhanāf. inward glance, mental concentration View this entry on the original dictionary page scan.
vikuṇṭhitamfn. See vi-kuṇṭh-. View this entry on the original dictionary page scan.
vikuṇṭhitamfn. ( kuṇṭh-) blunted, obtuse View this entry on the original dictionary page scan.
vikuponly Causal -kopayati-, to disturb View this entry on the original dictionary page scan.
vikurvāf. idem or 'n. and f(ā-). the ability to assume various shapes ' View this entry on the original dictionary page scan.
vikurvaṇa vāṇa- See column 3. View this entry on the original dictionary page scan.
vikurvaṇam. (prob. for vi-kurvāṇa-) Name of śiva- View this entry on the original dictionary page scan.
vikurvaṇan. and f(ā-). the ability to assume various shapes View this entry on the original dictionary page scan.
vikurvāṇamfn. undergoing a change, modifying one's self View this entry on the original dictionary page scan.
vikurvāṇamfn. rejoicing, being glad View this entry on the original dictionary page scan.
vikurvitan. the assuming of various shapes View this entry on the original dictionary page scan.
vikusraor vikrasra- m. the moon (prob. for vi-kasra-). View this entry on the original dictionary page scan.
vikusukam. a particular agni- (see v/i-kasuka-). View this entry on the original dictionary page scan.
vikūṭam. or n. (?) Name of a place (varia lectio tri-k-). View this entry on the original dictionary page scan.
vikutsāf. ( kuts-) violent abuse or reviling View this entry on the original dictionary page scan.
vikuṭyāsaSee vikughāsa-. View this entry on the original dictionary page scan.
vil cl.6 P. vilati-, to cover, conceal, clothe ; cl.10 P. velayati-, to throw, cast, send (see pil-) ; to break or divide (see bil-). View this entry on the original dictionary page scan.
vilabdhamfn. parted asunder, etc. View this entry on the original dictionary page scan.
vilabdhamfn. given, bestowed, consigned View this entry on the original dictionary page scan.
vilabdhif. taking away, removing View this entry on the original dictionary page scan.
vilabhA1. -labhate-, to part asunder, separate ; to take away, remove (dung from a stable) ; to procure, bestow, grant, consign, hand over, deliver up etc. ; to choose, elect : Causal -lambhayati-, to cause to receive or fall to the share of (two accusative) : Desiderative -lipsate-, to desire to divide or distribute
vilābhamfn. View this entry on the original dictionary page scan.
vilābhimanm. gaRa dṛḍhādi- () View this entry on the original dictionary page scan.
vilagP. -lagati-, to hang to, cling to, hold on to (locative case) , View this entry on the original dictionary page scan.
vilagitamfn. attached to etc. View this entry on the original dictionary page scan.
vilagitaor vi-laṅgita- mfn. ( lāṅg-) Va1rtt. 1 (upatāpe-). View this entry on the original dictionary page scan.
vilagnamfn. clung or fastened or attached to, resting or hanging on, connected with (locative case or compound) etc. (tīravilagna-come ashore, landed ) pendulous, flaccid (as breasts) View this entry on the original dictionary page scan.
vilagnamfn. hanging in a cage, caged (as a bird) View this entry on the original dictionary page scan.
vilagnamfn. gone by, passed away View this entry on the original dictionary page scan.
vilagnamfn. thin, slender View this entry on the original dictionary page scan.
vilagnam. or n. the waist, middle (as connecting the upper and lower parts of the body) View this entry on the original dictionary page scan.
vilagnan. the rising of constellations, a horoscope etc. (equals lagna-) View this entry on the original dictionary page scan.
vilagnamadhyāf. a woman with a slender waist. View this entry on the original dictionary page scan.
vilajjA1. -lajjate- (rarely P.), to become ashamed or abashed, blush View this entry on the original dictionary page scan.
vilajjamfn. shameless View this entry on the original dictionary page scan.
vilajjitamfn. ashamed, abashed View this entry on the original dictionary page scan.
vilakṣP. A1. -lakṣayati-, te-, to distinguish, discern, observe, perceive, mark, notice ; to lose sight of ones aim or object, become bewildered or perplexed or embarrassed View this entry on the original dictionary page scan.
vilakṣamf(ā-)n. having no fixed aim (varia lectio) View this entry on the original dictionary page scan.
vilakṣamf(ā-)n. missing its mark (as an arrow) View this entry on the original dictionary page scan.
vilakṣamf(ā-)n. having no characteristic mark or property View this entry on the original dictionary page scan.
vilakṣamf(ā-)n. having a different mark or a character different to what is usual or natural, strange, extraordinary View this entry on the original dictionary page scan.
vilakṣamf(ā-)n. embarrassed, abashed, ashamed, astonished, surprised ( vilakṣatā -- f.) etc. View this entry on the original dictionary page scan.
vilakṣaṇamf(ā-)n. (for 2.See vi-lakṣ-) having different marks, varying in character, different, differing from (ablative or compound; vilakṣaṇatā --, f.; vilakṣaṇatva -tva- n.) etc. View this entry on the original dictionary page scan.
vilakṣaṇamf(ā-)n. various, manifold View this entry on the original dictionary page scan.
vilakṣaṇamf(ā-)n. not admitting of exact definition View this entry on the original dictionary page scan.
vilakṣaṇan. any state or condition which is without distinctive mark or for which no cause can be assigned, vain or causeless state View this entry on the original dictionary page scan.
vilakṣaṇan. (for 1.See) the act of distinguishing, perceiving, seeing, observing View this entry on the original dictionary page scan.
vilakṣaṇacaturdaśakan. Name of work
vilakṣaṇajanmaprakāśikāf. Name of work
vilakṣaṇamokṣādhikāram. Name of work
vilakṣaṇatāf. vilakṣaṇa
vilakṣaṇatvan. vilakṣaṇa
vilakṣatāf. vilakṣa
vilakṣatvan. absence of mark or aim, absence of distinguishing property View this entry on the original dictionary page scan.
vilakṣatvan. the missing of the mark (of an arrow) View this entry on the original dictionary page scan.
vilakṣatvan. confusion, shame View this entry on the original dictionary page scan.
vilakṣīkṛP. -karoti-, to cause to miss the mark, disappoint View this entry on the original dictionary page scan.
vilakṣīkṛto disconcert, abash View this entry on the original dictionary page scan.
vilakṣīkṛtamfn. disconcerted, abashed View this entry on the original dictionary page scan.
vilakṣīkṛtamfn. scoffed at, insulted View this entry on the original dictionary page scan.
vilakṣitamfn. (for 2.See vi-lakṣ-) undistinguished, undiscriminated, unmarked View this entry on the original dictionary page scan.
vilakṣitamfn. (for 1 -see ) distinguished, marked by (instrumental case or compound) View this entry on the original dictionary page scan.
vilakṣitamfn. perceived, observed, noticed View this entry on the original dictionary page scan.
vilakṣitamfn. confused, bewildered View this entry on the original dictionary page scan.
vilakṣitamfn. vexed, annoyed View this entry on the original dictionary page scan.
vilakṣyamfn. having no fixed aim (varia lectio) View this entry on the original dictionary page scan.
vilakṣyamfn. missing its mark (as an arrow) View this entry on the original dictionary page scan.
vilalāf. a sort of plant (equals śvetabala-) View this entry on the original dictionary page scan.
vilālam. (perhaps fr. lal-) equals yantra-, a machine View this entry on the original dictionary page scan.
vilālam. equals bilāla-, a cat View this entry on the original dictionary page scan.
vilambA1. -lambate- (rarely P.), to hang on both sides to (accusative) ; to hang down, hang on, be attached to (locative case) etc. ; to sink, set, decline ; to continue hanging, linger, delay, tarry, hesitate ("with"or"to", prati-) etc.: Causal lambayati-, to hang on (locative case) (read -lambya-with Bombay edition) ; to cause to linger or loiter, detain, delay ; to spend (time) unprofitably, waste, lose ; to put off, procrastinate View this entry on the original dictionary page scan.
vilambamfn. hanging down, pendulous (as arms) View this entry on the original dictionary page scan.
vilambam. hanging or falling down, pendulousness View this entry on the original dictionary page scan.
vilambam. -hanging for support View this entry on the original dictionary page scan.
vilambam. slowness, tardiness, delay, procrastination (āt-,"with delay","late"; ena- idem or 'm. -hanging for support ',"too late"; in the beginning of a compound"slowly") etc. View this entry on the original dictionary page scan.
vilambam. Name of the 32nd year in the 60 years' cycle of Jupiter View this entry on the original dictionary page scan.
vilambakam. Name of a king View this entry on the original dictionary page scan.
vilambanan. hanging down or from, depending View this entry on the original dictionary page scan.
vilambanaf. slowness, delay, procrastination View this entry on the original dictionary page scan.
vilambasauparṇan. Name of various sāman-s View this entry on the original dictionary page scan.
vilambham. gift, donation, liberality View this entry on the original dictionary page scan.
vilambikāf. a particular form of indigestion (with retardation of the feces; according to to some "the last stage of exhaustion in cholera") View this entry on the original dictionary page scan.
vilambinmfn. hanging down, pendulous, hanging to or from, leaning against (locative case or compound) etc. View this entry on the original dictionary page scan.
vilambinmfn. (in fine compositi or 'at the end of a compound') hung with, that from which anything hangs or falls down View this entry on the original dictionary page scan.
vilambinmfn. tarrying, delaying, slow, reluctant (varia lectio) View this entry on the original dictionary page scan.
vilambinm. n. the 32nd year in the 60 years' cycle of Jupiter View this entry on the original dictionary page scan.
vilambitamfn. hanging down, pendulous View this entry on the original dictionary page scan.
vilambitamfn. (in fine compositi or 'at the end of a compound') dependent on, closely connected with View this entry on the original dictionary page scan.
vilambitamfn. delayed, retarded, loitering, tardy, slow, measured (in music opp. to druta- q.v) etc. View this entry on the original dictionary page scan.
vilambitam. a particular class of heavy animals View this entry on the original dictionary page scan.
vilambitan. slowness, delay, procrastination (also impersonal or used impersonally"it has been delayed") etc. View this entry on the original dictionary page scan.
vilambitāf. slowness, measuredness View this entry on the original dictionary page scan.
vilambitagatif. "slow or tardy in motion", Name of a metre View this entry on the original dictionary page scan.
vilambitamind. slowly, tardily View this entry on the original dictionary page scan.
vilambitaphalamfn. having the fruit or fulfilment delayed View this entry on the original dictionary page scan.
vilambyaind. having lingered or loitered, slowly, tardily (a-vilambya-,"without delay") View this entry on the original dictionary page scan.
vilaṅghP. A1. -laṅghati-, te- (Aorist vy-aleghiṣuḥ- ), to leap, jump, rise up to (accusative) : Causal -laṅghayati-, to leap or jump over, cross, pass (time), traverse (a distance), overstep (bounds) etc. ; to transgress, contemn, neglect, violate (commands etc.) ; to rise up, ascend to (accusative) ; to rise beyond, overcome, subdue ; to excel, surpass ; to pass over, set aside, abandon ; to act wrongly towards, offend ; to cause to pass over (the right time for eating), cause to fast , View this entry on the original dictionary page scan.
vilaṅghanan. leaping over, crossing View this entry on the original dictionary page scan.
vilaṅghanan. striking against View this entry on the original dictionary page scan.
vilaṅghanan. offence, injury View this entry on the original dictionary page scan.
vilaṅghanan. (also plural) fasting, abstention from food View this entry on the original dictionary page scan.
vilaṅghanāf. passing beyond, overcoming, surmounting View this entry on the original dictionary page scan.
vilaṅghanīyamfn. to be over stepped or passed over or transgressed View this entry on the original dictionary page scan.
vilaṅghayitvaind. having transgressed or missed (the proper time), having waited View this entry on the original dictionary page scan.
vilaṅghinmfn. passing beyond, overstepping, transgressing View this entry on the original dictionary page scan.
vilaṅghinmfn. ascending to, striking against View this entry on the original dictionary page scan.
vilaṅghitamfn. overleaped, overstepped, etc. View this entry on the original dictionary page scan.
vilaṅghitamfn. baffled, defied (as efforts) View this entry on the original dictionary page scan.
vilaṅghitākāśamfn. passing or rising beyond the sky View this entry on the original dictionary page scan.
vilaṅghitākāśan. fasting, abstention from food View this entry on the original dictionary page scan.
vilaṅghyamfn. to be passed over or crossed (as a river) View this entry on the original dictionary page scan.
vilaṅghyamfn. to be overcome or subdued, tolerable View this entry on the original dictionary page scan.
vilaṅghyamfn. Name of work (see -lakṣaṇa-) View this entry on the original dictionary page scan.
vilaṅghyalakṣaṇan. Name of a treatise on the changes of e- and ai- before a following vowel. View this entry on the original dictionary page scan.
vilaṅghyatāf. tolerableness View this entry on the original dictionary page scan.
vilapP. -lapati- (rarely A1. infinitive mood -lapitum-,or -laptum- pr.p. -lapyat- ), to utter moaning sounds, wail, lament, bewail (accusative with or without prati-) etc. ; to speak variously, talk, chatter : Causal -lāpayati-, te-, to cause to mourn or lament (see , Va1rtt. 3 Sch. ) ; to cause to speak much (A1.) : Intensive (only p. -l/ālapat-), to talk idly View this entry on the original dictionary page scan.
vilāpam. equals prec. n. View this entry on the original dictionary page scan.
vilāpakusumāñjalim. Name of a poem. 1. View this entry on the original dictionary page scan.
vilapanan. wailing, lamenting View this entry on the original dictionary page scan.
vilapanan. talking idly or wildly View this entry on the original dictionary page scan.
vilapanan. the dirt or sediment of any oily substance (as of clarified butter, etc.) View this entry on the original dictionary page scan.
vilāpanamfn. (for 2.See under vi--) causing moaning or lamentation (as a weapon) View this entry on the original dictionary page scan.
vilāpanam. Name of one of śiva-'s attendants View this entry on the original dictionary page scan.
vilāpanan. the act of causing moaning or lamentation (= nāśa- ) View this entry on the original dictionary page scan.
vilāpanan. m. Calcutta edition equals -vi-lapana-, wail, lamentation View this entry on the original dictionary page scan.
vilāpanamf(ī-)n. (fr. Causal;for 1See under vi-lap-) dissolving, destroying, removing View this entry on the original dictionary page scan.
vilāpanamf(ī-)n. melting, liquefying (See ājaya-vil/āpanī-) View this entry on the original dictionary page scan.
vilāpanan. destruction, death View this entry on the original dictionary page scan.
vilāpanan. a means of destruction View this entry on the original dictionary page scan.
vilāpanan. melting or a means of melting View this entry on the original dictionary page scan.
vilāpanan. a particular product of milk (see vi-layana-). View this entry on the original dictionary page scan.
vilapanavinodam. removing grief by weeping View this entry on the original dictionary page scan.
vilāpayitṛm. a dissolver View this entry on the original dictionary page scan.
vilāpinmfn. wailing, lamenting, uttering moaning or inarticulate sounds View this entry on the original dictionary page scan.
vilapitamfn. wailed, lamented, etc. View this entry on the original dictionary page scan.
vilapitan. lamentation, wailing View this entry on the original dictionary page scan.
vilāpitamfn. equals next View this entry on the original dictionary page scan.
vilasP. -lasati-, to gleam, flash, glitter (only pr. p. -lasat- q.v,and perfect tense -lalāsa- ) ; to shine forth, appear, arise, become visible ; to sound forth, echo (See vi-lasan-) ; to play, sport, dally, be amused or delighted ; to vibrate, coruscate (See vi-lasat-): Causal -lācayati-, to cause to dance View this entry on the original dictionary page scan.
vilāsam. (in fine compositi or 'at the end of a compound' f(ā-).) shining forth, appearance, manifestation, View this entry on the original dictionary page scan.
vilāsam. sport, play, pastime, pleasure, diversion (especially with women etc.;but also applied to any playful action or gesture) etc. (sāya-,"for sport") View this entry on the original dictionary page scan.
vilāsam. coquetry, affectation of coyness, wantonness (a form of feminine gesture considered as indicative of amorous sentiments) View this entry on the original dictionary page scan.
vilāsam. liveliness, joviality (considered as a masculine virtue) View this entry on the original dictionary page scan.
vilāsam. wantonness, lust View this entry on the original dictionary page scan.
vilāsam. grace, charm, beauty View this entry on the original dictionary page scan.
vilāsam. Name of a gram. work View this entry on the original dictionary page scan.
vilāsam. (with ācārya-) of a preceptor View this entry on the original dictionary page scan.
vilāsan. (andf(ā-).) Name of a metre View this entry on the original dictionary page scan.
vilāsabāṇam. (equals -kodaṇḍa-) View this entry on the original dictionary page scan.
vilāsabhavanan. (equals -gṛha-) View this entry on the original dictionary page scan.
vilāsabhittif. a wall (only) in appearance View this entry on the original dictionary page scan.
vilāsacāpam. (equals -kodaṇḍa-) View this entry on the original dictionary page scan.
vilāsadhanvanm. (equals -kodaṇḍa-) View this entry on the original dictionary page scan.
vilāsadolāf. a pleasure-swing View this entry on the original dictionary page scan.
vilāsagṛhan. a pleasure-house View this entry on the original dictionary page scan.
vilāsakamf(ikā-)n. moving to and fro, dancing, fluttering View this entry on the original dictionary page scan.
vilāsakānanan. a pleasure-grove
vilāsakodaṇḍam. Name of the god of love View this entry on the original dictionary page scan.
vilāsamandiran. (equals -gṛha-) View this entry on the original dictionary page scan.
vilāsamaṇidarpaṇam. a mirror set with jewels to play with View this entry on the original dictionary page scan.
vilāsamayamf(ī-)n. full of grace, charming View this entry on the original dictionary page scan.
vilāsamekhalāf. a toy-girdle (not a real one) View this entry on the original dictionary page scan.
vilasanin compound for vi-lasat- View this entry on the original dictionary page scan.
vilasanan. gleaming, flashing (of lightning) View this entry on the original dictionary page scan.
vilasanan. play, sport View this entry on the original dictionary page scan.
vilāsanan. (m. Calcutta edition for vi-lasana-) play, sport, dalliance View this entry on the original dictionary page scan.
vilāsanan. fascination View this entry on the original dictionary page scan.
vilāsāndragāminīf. Name of a gandharvī- View this entry on the original dictionary page scan.
vilāsapuran. Name of a town View this entry on the original dictionary page scan.
vilāsaracikāf. Name of a surāṅganā- View this entry on the original dictionary page scan.
vilāsasadmann. equals -gṛha- View this entry on the original dictionary page scan.
vilāsaśayyāf. a pleasure-couch View this entry on the original dictionary page scan.
vilāsaśīlam. Name of a king View this entry on the original dictionary page scan.
vilāsasvāminm. Name of a man View this entry on the original dictionary page scan.
vilasatmf(antī-)n. flashing, shining, glittering etc. View this entry on the original dictionary page scan.
vilasatmarīcimfn. having rays of light gleaming or playing View this entry on the original dictionary page scan.
vilasatmeghaśabdam. the echoing sound of clouds (id est thunder) View this entry on the original dictionary page scan.
vilasatpatākamfn. having a gleaming or waving flag View this entry on the original dictionary page scan.
vilasatsaudāminīf. a flash of lightning View this entry on the original dictionary page scan.
vilāsavasatif. a pleasure resort (varia lectio) View this entry on the original dictionary page scan.
vilāsavatmfn. sportive, playful View this entry on the original dictionary page scan.
vilāsavātāyanan. a pleasure-balcony or terrace View this entry on the original dictionary page scan.
vilāsavatīf. a wanton or coquettish woman View this entry on the original dictionary page scan.
vilāsavatīf. Name of various women View this entry on the original dictionary page scan.
vilāsavatīf. of a drama (quoted in ) View this entry on the original dictionary page scan.
vilāsaveśmann. equals -gṛha- View this entry on the original dictionary page scan.
vilāsavibhavānasamfn. (?) equals lubdha- View this entry on the original dictionary page scan.
vilāsavihāram. a pleasure-walk, promenading (varia lectio) View this entry on the original dictionary page scan.
vilāsavipinan. a pleasure-grove View this entry on the original dictionary page scan.
vilāsikāf. a kind of drama (in one act on any light subject or adventure) View this entry on the original dictionary page scan.
vilāsinmfn. shining, beaming, radiant View this entry on the original dictionary page scan.
vilāsinmfn. moving to and fro, fluttering View this entry on the original dictionary page scan.
vilāsinmfn. wanton, sportive, playful, dallying with or fond of (compound) View this entry on the original dictionary page scan.
vilāsinmfn. coquettish View this entry on the original dictionary page scan.
vilāsinm. "sporter", a lover, husband ( also "a sensualist;a serpent;fire;the moon;Name of kṛṣṇa-, of śiva-, and of kāma-deva-") View this entry on the original dictionary page scan.
vilāsinm. a kind of metre View this entry on the original dictionary page scan.
vilāsinm. Name of a woman View this entry on the original dictionary page scan.
vilāṣinmfn. (fr. laṣ-) View this entry on the original dictionary page scan.
vilāsinīf. a charming or lively or wanton or coquettish woman, wife, mistress (also vilāsinikā nikā-f. ; vilāsinījana -jana- m. ) View this entry on the original dictionary page scan.
vilāsinījanam. vilāsinī
vilāsinikāf. vilāsinī
vilasitamfn. gleaming, glittering, shining forth, appearing View this entry on the original dictionary page scan.
vilasitamfn. played, sported (n. also impersonal or used impersonally) View this entry on the original dictionary page scan.
vilasitamfn. moving to and fro View this entry on the original dictionary page scan.
vilasitan. flashing, quivering (of lightning) View this entry on the original dictionary page scan.
vilasitan. appearing, manifestation (vidyā-, v-manifestation of knowledge) View this entry on the original dictionary page scan.
vilasitan. sport play, pastime, dalliance View this entry on the original dictionary page scan.
vilasitan. any action or gesture View this entry on the original dictionary page scan.
vilāsitāf. wantonness, playfulness, cheerfulness View this entry on the original dictionary page scan.
vilāsitvan. wantonness, playfulness, cheerfulness View this entry on the original dictionary page scan.
vilātamfn. gaRa dṛḍhādi- (varia lectio vilābha-) View this entry on the original dictionary page scan.
vilātāf. a kind of bird View this entry on the original dictionary page scan.
vilātavya vi-lātṛ- etc. See ve--, column 3. View this entry on the original dictionary page scan.
vilātavya mfn. View this entry on the original dictionary page scan.
vilātimanm. (fr. prec.) View this entry on the original dictionary page scan.
vilātṛmfn. View this entry on the original dictionary page scan.
vilayam. dissolution, liquefaction, disappearance, death, destruction (especially destruction of the world) (accusative with gam-, -, vraj-etc. to be dissolved, end;with Causal of gam-,to dissolve, destroy) View this entry on the original dictionary page scan.
vilayanamfn. dissolving, liquefying View this entry on the original dictionary page scan.
vilayanan. dissolution, liquefaction View this entry on the original dictionary page scan.
vilayanan. melting (intrans.) View this entry on the original dictionary page scan.
vilayanan. a particular product of milk View this entry on the original dictionary page scan.
vilayanan. corroding, eating away View this entry on the original dictionary page scan.
vilayanan. removing, taking away View this entry on the original dictionary page scan.
vilayanan. attenuating or, an attenuant, escharotic (in medicine) View this entry on the original dictionary page scan.
vilāyitamfn. dissolved, liquefied View this entry on the original dictionary page scan.
vilekham. scratching, tearing up, wounding View this entry on the original dictionary page scan.
vilekhāf. a scratch, furrow, mark View this entry on the original dictionary page scan.
vilekhāf. a written contract View this entry on the original dictionary page scan.
vilekhanamfn. scratching, lacerating View this entry on the original dictionary page scan.
vilekhanan. the act of making an incision or mark or furrow View this entry on the original dictionary page scan.
vilekhanan. scratching, wounding, lacerating View this entry on the original dictionary page scan.
vilekhanan. the course (of a river) View this entry on the original dictionary page scan.
vilekhanan. dividing, splitting View this entry on the original dictionary page scan.
vilekhanan. digging. delving, rooting up View this entry on the original dictionary page scan.
vilekhinmfn. scratching id est rubbing against, touching, reaching up to (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vilepam. ointment, unguent (especially the fragrant unguent of sandal etc.) View this entry on the original dictionary page scan.
vilepam. anointing, plastering View this entry on the original dictionary page scan.
vilepam. mortar, plaster View this entry on the original dictionary page scan.
vilepanan. smearing, anointing (especially with fragrant oils etc.)
vilepanan. (in fine compositi or 'at the end of a compound' f(ā-).), unguent, ointment, perfume for the person (as saffron, camphor etc.) etc. View this entry on the original dictionary page scan.
vilepanan. a particular mythical weapon View this entry on the original dictionary page scan.
vilepanīf. a woman scented with perfumes etc. View this entry on the original dictionary page scan.
vilepanīf. rice-gruel View this entry on the original dictionary page scan.
vilepaninmfn. smeared, anointed (in a-vil-) View this entry on the original dictionary page scan.
vilepīf. rice-gruel View this entry on the original dictionary page scan.
vilepikāf. a female anointer View this entry on the original dictionary page scan.
vilepikāf. rice-gruel View this entry on the original dictionary page scan.
vilepinmfn. smearing or plastering over, one who anoints etc. View this entry on the original dictionary page scan.
vilepinmfn. viscous, sticky (in a-vil-) View this entry on the original dictionary page scan.
vilepinmfn. (in fine compositi or 'at the end of a compound') stuck or clung to, accompanied by , View this entry on the original dictionary page scan.
vilepyamfn. to be (or being) spread over or plastered, made of mortar or clay View this entry on the original dictionary page scan.
vilepyamfn. rice-gruel View this entry on the original dictionary page scan.
viA1. -līyate- (perfect tense -lilyuh- ; future -letā-,or -lātā-; ind.p. -līya-or -lāya- ), to cling or cleave or adhere to ; to hide or conceal one's self, disappear etc. ; to be dissolved, melt etc. etc.: Causal -lāpayati- or -lāyayati- or -lālayati- or -līnayati- (), to cause to disappear, destroy ; to cause to be dissolved or absorbed in (locative case) ; to make liquid, dissolve, melt View this entry on the original dictionary page scan.
viligīf. a kind of serpent View this entry on the original dictionary page scan.
vilihP. A1. -leḍhi-, -līḍhe-, to lick, lick up, lap : Intensive (only p. -lelihat-and hāna-), to lick continually or repeatedly View this entry on the original dictionary page scan.
vilikhP. -likhati- (Ved. infinitive mood -likhas-; see ), to scratch, scrape, tear up, lacerate etc. ; to rub against, reach to, touch ; to wound (the heart) id est vex, offend ; to scratch in or on, make a furrow or mark, write, delineate, paint etc. ; (in medicine) to tear up id est stir up (phlegm etc.) : Causal -lekhayati-, or -likhāpayati-, to cause to scratch or write, View this entry on the original dictionary page scan.
vilikhaSee a-vilikha-. View this entry on the original dictionary page scan.
vilikhanan. the act of scraping, scratching etc. View this entry on the original dictionary page scan.
vilikhitamfn. scratched, scraped, scarified View this entry on the original dictionary page scan.
vilimpitamfn. (fr. Causal) smeared, anointed View this entry on the original dictionary page scan.
vilīnamfn. clinging or sticking or attached to, fixed on, immersed in (locative case or compound) View this entry on the original dictionary page scan.
vilīnamfn. (in fine compositi or 'at the end of a compound') alighted or perched on (said of birds) View this entry on the original dictionary page scan.
vilīnamfn. sticking (See compound) View this entry on the original dictionary page scan.
vilīnamfn. hidden, disappeared, perished, absorbed in (locative case) etc. View this entry on the original dictionary page scan.
vilīnamfn. dissolved, melted, liquefied View this entry on the original dictionary page scan.
vilīnamfn. contiguous to, united or blended with View this entry on the original dictionary page scan.
vilīnamfn. infused into the mind, imagined View this entry on the original dictionary page scan.
vilīnākṣaramind. so that the sound sticks (in the throat) View this entry on the original dictionary page scan.
vilīnaṣaṭpadamfn. having bees clinging or attached View this entry on the original dictionary page scan.
vilinātham. (with kavi-) Name of a poet (author of the drama madana-mañjarī-) View this entry on the original dictionary page scan.
viliṅgan. absence of marks View this entry on the original dictionary page scan.
viliṅgamfn. of a different gender View this entry on the original dictionary page scan.
viliṅgasthamfn. not to be understood View this entry on the original dictionary page scan.
vilipP. A1. -limpati-, te-, to smear or spread over, anoint (also"to anoint one's self"P.) etc. ; to smear or spread with (instrumental case) : Causal -lepayati-, to smear or anoint with (instrumental case) ; -limpayati- See -limpita-. View this entry on the original dictionary page scan.
viliptā f. a second (= 1/3600 of a degree) View this entry on the original dictionary page scan.
viliptamf(ā-)n. smeared over, anointed etc. View this entry on the original dictionary page scan.
viliptāf. See View this entry on the original dictionary page scan.
viliptīf. a cow in a particular period after calving View this entry on the original dictionary page scan.
viliptikāf. a second (= 1/3600 of a degree) View this entry on the original dictionary page scan.
viliśA1. -liśate-, to become out of joint, be disarranged or disordered, break off, become rent or torn View this entry on the original dictionary page scan.
viliṣṭamfn. (see vi-riṣṭa-) broken off, out of due order View this entry on the original dictionary page scan.
viliṣṭabheṣajan. a remedy for fractures or dislocation View this entry on the original dictionary page scan.
vilisteṅgāf. Name of a dānavī- View this entry on the original dictionary page scan.
vilīyanan. melting (intrans.) View this entry on the original dictionary page scan.
villa vilva- See billa-, bilva-. View this entry on the original dictionary page scan.
vilobham. attraction, delusion, seduction W View this entry on the original dictionary page scan.
vilobhanan. the act of leading astray, perplexing, beguiling, seduction, temptation View this entry on the original dictionary page scan.
vilobhanan. (in dramatic language) flattery, praise, commendation (exempli gratia, 'for example' ,the stanzas containing the king's description of śakuntalā-'s beauty) View this entry on the original dictionary page scan.
vilobhanīyamfn. enticing, alluring View this entry on the original dictionary page scan.
vilobhitamfn. (fr. Causal) allured, beguiled, deceived, flattered, praised View this entry on the original dictionary page scan.
vilocanamfn. (for 2.See vi-loc-) distorting the eyes View this entry on the original dictionary page scan.
vilocanam. Name of a poet View this entry on the original dictionary page scan.
vilocanam. of a mythical person View this entry on the original dictionary page scan.
vilocanam. of an antelope View this entry on the original dictionary page scan.
vilocanamfn. (loc;for 1.See)"causing to see"or"seeing" (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vilocanan. (in fine compositi or 'at the end of a compound' f(ā-).) the eye, sight etc. View this entry on the original dictionary page scan.
vilocanāmbun. "eye-water", tears View this entry on the original dictionary page scan.
vilocanapātam. "eye-fall", a glance, look View this entry on the original dictionary page scan.
vilocanapatham. the range of vision View this entry on the original dictionary page scan.
viloḍam. (prob. equals vi-loṭa- q.v) rolling, wallowing, View this entry on the original dictionary page scan.
viloḍa vi-loḍana- etc. See under vi-luḍ-, . View this entry on the original dictionary page scan.
viloḍakam. a thief (See varṇa-v-). View this entry on the original dictionary page scan.
viloḍanan. stirring up, churning, View this entry on the original dictionary page scan.
viloḍanan. splashing (in water) (varia lectio viloḍanā - f.) View this entry on the original dictionary page scan.
viloḍanan. agitating, alarming View this entry on the original dictionary page scan.
viloḍanāf. viloḍana
viloḍayitṛm. an agitator, disturber (used to explain vi-gāḍhṛ-) View this entry on the original dictionary page scan.
viloditamfn. agitated, churned etc. View this entry on the original dictionary page scan.
viloditan. equals takra- or dadhi-
vilohitam. a kind of disease, (perhaps) bleeding of the nose View this entry on the original dictionary page scan.
vilohitamfn. (v/i--) deep-red etc. View this entry on the original dictionary page scan.
vilohitam. Name of śiva- View this entry on the original dictionary page scan.
vilohitam. of rudra- and Fire (is identified with rudra-) View this entry on the original dictionary page scan.
vilohitam. a kind of onion View this entry on the original dictionary page scan.
vilohitam. Name of a hell View this entry on the original dictionary page scan.
vilohitāf. Name of one of the 7 tongues of fire (varia lectio su-lohitā-) View this entry on the original dictionary page scan.
vilohitakan. a dead body that has become red View this entry on the original dictionary page scan.
vilok(only infinitive mood -lokitum-and ind.p. -lokya-), to look at or upon, regard, examine, test, study etc.: Causal -lokayati-, to look at, consider, observe, regard, examine, try, inspect etc. ; to be able to see, possess the faculty of seeing (varia lectio) ; to have regard to (accusative) ; to look over or beyond (accusative) : Passive voice -lokyate- (Aorist vy-aloki-), to be seen, be visible
vilokan. (prob.) (for 2.See vi-lok-) absence of man ( vilokastha -stha- mfn.living apart from the world) View this entry on the original dictionary page scan.
vilokamfn. apart from the world, solitary View this entry on the original dictionary page scan.
vilokam. (for 1 -see) a glance, view View this entry on the original dictionary page scan.
vilokanan. the act of looking or seeing View this entry on the original dictionary page scan.
vilokanan. looking at, regarding, observing, contemplating View this entry on the original dictionary page scan.
vilokanan. looking for, finding out View this entry on the original dictionary page scan.
vilokanan. (in fine compositi or 'at the end of a compound') perceiving, noticing, becoming aware of View this entry on the original dictionary page scan.
vilokanan. paying attention to, studying (also plural,with genitive case) View this entry on the original dictionary page scan.
vilokanīyamfn. to be looked at or perceived or noticed or learnt (n. also impersonal or used impersonally) View this entry on the original dictionary page scan.
vilokanīyamfn. worthy to be looked at, lovely, beautiful ( vilokanīyatā -- f. vilokanīyatva -tva- n.) View this entry on the original dictionary page scan.
vilokanīyatāf. vilokanīya
vilokanīyatvan. vilokanīya
vilokasthamfn. viloka
vilokinmfn. looking at, looking, seeing, beholding, perceiving, noticing, becoming aware of (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vilokitamfn. looked at, seen, beheld etc. View this entry on the original dictionary page scan.
vilokitam. (in music) a kind of measure View this entry on the original dictionary page scan.
vilokitan. a look, glance View this entry on the original dictionary page scan.
vilokitan. observation, examination View this entry on the original dictionary page scan.
vilokyamfn. to be (or being) looked at, visible View this entry on the original dictionary page scan.
vilolamf(ā-)n. moving to and fro or from side to side, rolling, waving, tremulous, unsteady etc. View this entry on the original dictionary page scan.
vilolamf(ā-)n. unsteadier than (ablative) View this entry on the original dictionary page scan.
vilola vi-lolana-, vi-lolita-. See column 1. View this entry on the original dictionary page scan.
vilolahāramfn. having necklaces tossed about View this entry on the original dictionary page scan.
vilolalocanamfn. having eyes swelling (with tears) View this entry on the original dictionary page scan.
vilolatāf. tremulousness, unsteadiness, rolling (of the eyes) View this entry on the original dictionary page scan.
vilolatārakamfn. (a face) with rolling (pupils of the) eyes View this entry on the original dictionary page scan.
vilolatvan. tremulousness, unsteadiness, rolling (of the eyes) View this entry on the original dictionary page scan.
vilololanan. the act of shaking, stirring, agitating View this entry on the original dictionary page scan.
vilololitamfn. (fr. Causal) moved hither and thither, shaken, agitated, tossed about View this entry on the original dictionary page scan.
vilololitadṛśmfn. rolling the eyes, having tremulous eyes View this entry on the original dictionary page scan.
vilolupamf(ā-)n. free from all desires (varia lectio; a-vil-with the same meaning ) 1. View this entry on the original dictionary page scan.
vilolupa1. 2. vi-lohita- See . View this entry on the original dictionary page scan.
vilomaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vilomamf(ā-)n. (fr. 3. vi-+ loman-) against the hair or grain, turned the wrong way, inverted, contrary to the usual or proper course, opposed (pavana-vil-,"turned against the wind"; vilomam am- ind.,"backwards") View this entry on the original dictionary page scan.
vilomamf(ā-)n. produced in reverse order View this entry on the original dictionary page scan.
vilomamf(ā-)n. refractory View this entry on the original dictionary page scan.
vilomamf(ā-)n. hairless (See -below) View this entry on the original dictionary page scan.
vilomam. reverse order, opposite course, reverse View this entry on the original dictionary page scan.
vilomam. a snake View this entry on the original dictionary page scan.
vilomam. a dog View this entry on the original dictionary page scan.
vilomam. Name of varuṇa- View this entry on the original dictionary page scan.
viloman. a water-wheel or machine for raising water from a well View this entry on the original dictionary page scan.
vilomajamfn. () "born in reverse order", born of a mother belonging to a higher caste than the father View this entry on the original dictionary page scan.
vilomajātamfn. () "born in reverse order", born of a mother belonging to a higher caste than the father View this entry on the original dictionary page scan.
vilomajihvam. an elephant View this entry on the original dictionary page scan.
vilomakamfn. inverted, reversed View this entry on the original dictionary page scan.
vilomakāvyan. equals vilomākṣara-k- below View this entry on the original dictionary page scan.
vilomakriyāf. reverse action, doing anything in reverse order or backwards View this entry on the original dictionary page scan.
vilomakriyāf. (in arithmetic) rule of inversion View this entry on the original dictionary page scan.
vilomākṣarakāvyan. Name of a poem which may be read syllable by syllable either backwards or forwards equals rāma-kṛṣṇa-kāvya- q.v View this entry on the original dictionary page scan.
vilomamind. viloma
vilomanmfn. against the hair or grain, turned in the opposite direction, inverted View this entry on the original dictionary page scan.
vilomanmfn. hairless View this entry on the original dictionary page scan.
vilomanm. Name of a king View this entry on the original dictionary page scan.
vilomapāṭham. recitation in reverse order (id est from the end to the beginning) View this entry on the original dictionary page scan.
vilomarasanam. an elephant View this entry on the original dictionary page scan.
vilomatāf. the being hairless, (and) perverseness View this entry on the original dictionary page scan.
vilomatrairāśikan. rule of three inverse View this entry on the original dictionary page scan.
vilomavarṇamfn. equals viloma-ja- above View this entry on the original dictionary page scan.
vilomavarṇam. a man of mixed or inferior birth View this entry on the original dictionary page scan.
vilomavidhim. an inverted rite, reversed ceremony View this entry on the original dictionary page scan.
vilomavidhim. (in arithmetic) rule of inversion View this entry on the original dictionary page scan.
vilomīf. Emblic Myrobalan View this entry on the original dictionary page scan.
vilomitamfn. reversed, inverted View this entry on the original dictionary page scan.
vilomotpannamfn. equals viloma-ja- above View this entry on the original dictionary page scan.
vilopam. carrying off, taking away View this entry on the original dictionary page scan.
vilopam. a break, interruption, disturbance, injury etc. (see a-vil-) View this entry on the original dictionary page scan.
vilopam. ruin, loss View this entry on the original dictionary page scan.
vilopakamfn. (and m.) equals -lumpaka- View this entry on the original dictionary page scan.
vilopanan. the act of tearing or breaking to pieces, destroying, destruction View this entry on the original dictionary page scan.
vilopanan. cutting or plucking off View this entry on the original dictionary page scan.
vilopanan. leaving out, omission View this entry on the original dictionary page scan.
vilopanan. robbing, stealing View this entry on the original dictionary page scan.
vilopinmfn. breaking, destroying View this entry on the original dictionary page scan.
vilopitamfn. (fr. Causal) broken, destroyed, extinguished View this entry on the original dictionary page scan.
viloptṛm. a robber, thief View this entry on the original dictionary page scan.
vilopyamfn. to be broken or destroyed View this entry on the original dictionary page scan.
viloṭam. (used to explain2 -luṭ-; see vi-loḍa-), rolling, wallowing View this entry on the original dictionary page scan.
viloṭakam. a sort of fish, Clupea Cultrata View this entry on the original dictionary page scan.
viloṭanan. equals loṭa- View this entry on the original dictionary page scan.
viloṭhinmfn. moving to and fro, dangling, View this entry on the original dictionary page scan.
vi(only ind.p. -lūya-), to cut off View this entry on the original dictionary page scan.
vilubhCaus. -lobhayati-, to lead astray, perplex, confuse ; to allure, entice, tempt etc. ; to divert, amuse, delight (varia lectio) View this entry on the original dictionary page scan.
vilubhitamfn. disordered, disarranged, agitated View this entry on the original dictionary page scan.
vilubhitaplavamfn. going in an agitated manner View this entry on the original dictionary page scan.
viluḍ(see prec. and vi-lulita-), Caus. -loḍayati-, to stir about, stir up, mingle ; to move to and fro, toss about, upset, disorder, confuse ; to betake one's self into (accusative) View this entry on the original dictionary page scan.
vilulitamfn. ( lul-; see vi-luḍ-) moved hither and thither View this entry on the original dictionary page scan.
vilulitamfn. shaken down, falling down, shed View this entry on the original dictionary page scan.
vilulitamfn. shaken, agitated, disordered, disarranged etc. View this entry on the original dictionary page scan.
vilulitālakamfn. having dishevelled hair View this entry on the original dictionary page scan.
vilumpakamf(ikā-)n. one who breaks or tears off etc. View this entry on the original dictionary page scan.
vilumpakam. a robber, ravisher View this entry on the original dictionary page scan.
vilumpakam. a destroyer View this entry on the original dictionary page scan.
vilūnamfn. cut off, severed View this entry on the original dictionary page scan.
viluñcP. -luñcati-, to tear or pull out (hair) View this entry on the original dictionary page scan.
viluñcanan. the act of tearing off View this entry on the original dictionary page scan.
viluṇṭ(only ind.p. -luṇṭya-), to unhusk (varia lectio for luñcitvā-). View this entry on the original dictionary page scan.
viluṇṭh(see vi-luṭh-) P. -luṇṭhati- (future luṇṭhiṣyati- infinitive mood -luṇṭhitum-; Passive voice -luṇṭhyate-), to carry off, plunder, steal, ravage View this entry on the original dictionary page scan.
viluṇṭhaka(f. ikā-) See mukha-viluṇṭhikā-. View this entry on the original dictionary page scan.
viluṇṭhanan. the act of plundering or robing or stealing View this entry on the original dictionary page scan.
viluṇṭhanan. hanging down, dangling (varia lectio) View this entry on the original dictionary page scan.
viluṇṭhitamfn. robbed, plundered etc. View this entry on the original dictionary page scan.
viluṇṭhitamfn. equals vi-luṭhita-, rolling, wallowing View this entry on the original dictionary page scan.
vilupP. -lumpati- (rarely A1.), to tear or break off or to pieces, wound, lacerate pull out or up etc. ; to tear away, carry off, ravish, seize, rob, plunder etc. ; to destroy, confound, ruin etc. ; (A1.) to fall to pieces, be ruined, disappear : Passive voice -lupyate-, to be torn away or carried off, be impaired or destroyed, perish, be lost, disappear, fail etc. etc.: Causal -lopayati- (te-), to tear or carry away, withhold, keep back, suppress, extinguish, destroy View this entry on the original dictionary page scan.
viluptamfn. torn or broken off, carried away etc. View this entry on the original dictionary page scan.
viluptamfn. impaired, destroyed, ruined, lost etc. View this entry on the original dictionary page scan.
viluptapūrvamfn. torn off or carried away before View this entry on the original dictionary page scan.
viluptasāvitrīkamfn. deprived of the sāvitrī- (see patita-s-) View this entry on the original dictionary page scan.
viluptavittamfn. one whose goods are robbed or plundered View this entry on the original dictionary page scan.
viluptīf. miscarrying (conjectural for vi-- liptī-), . View this entry on the original dictionary page scan.
vilupyamfn. destructible, perishable (in a-vil-) View this entry on the original dictionary page scan.
viluṭh(see vi-luḍ-below) P. -luṭhati-, to roll, move to and fro, quiver, flicker View this entry on the original dictionary page scan.
viluṭhitamfn. agitated, excited View this entry on the original dictionary page scan.
viluṭhitan. rolling, wallowing View this entry on the original dictionary page scan.
viP. A1. -māti-, -mimīte-, to measure, mete out, pass over, traverse ; to enumerate ; to ordain, fix, set right, arrange, make ready, prepare View this entry on the original dictionary page scan.
vimabhūpāla(?) m. Name of a Scholiast View this entry on the original dictionary page scan.
vimadP. -mādyati- (Ved. also -madati-), to be joyful or merry (only p. -m/adat-) ; to become perplexed or discomposed ; to confound, embarrass, disturb : Caus, (only Aorist vy-amīmadam-), to confuse, perplex, be. wilder View this entry on the original dictionary page scan.
vimadf. plural Name of particular verses or formulas View this entry on the original dictionary page scan.
vimadamfn. free from intoxication, grown sober View this entry on the original dictionary page scan.
vimadamfn. free from rut View this entry on the original dictionary page scan.
vimadamfn. free from pride or arrogance etc. View this entry on the original dictionary page scan.
vimadamfn. joyless View this entry on the original dictionary page scan.
vimadam. Name of a man protected by indra- (he gained his wife with the assistance of the aśvin-s) View this entry on the original dictionary page scan.
vimadam. (with aindra- or prājāpatya-) of the author of View this entry on the original dictionary page scan.
vimadhyan. (v/i--) the midst, middle View this entry on the original dictionary page scan.
vimadhya vi-madhyama- See . View this entry on the original dictionary page scan.
vimadhyabhāvam. mediocrity View this entry on the original dictionary page scan.
vimadhyamamfn. middling, indifferent View this entry on the original dictionary page scan.
vimadīkṛP. -karoti-, to free an elephant from rut View this entry on the original dictionary page scan.
vimaditamfn. (fr. Causal) discomposed, bewildered, confused View this entry on the original dictionary page scan.
vimadyamfn. one who has abstained from intoxicating drinks for a time View this entry on the original dictionary page scan.
vimahas(v/i--) mfn. merry, joyous (said of the marut-s) View this entry on the original dictionary page scan.
vimahatmfn. very great, immense View this entry on the original dictionary page scan.
vimahī(v/i--) mfn. (prob.) exhilarating, inspiring (plur. = spirituous liquors) ( and others, "very great") . View this entry on the original dictionary page scan.
vimajjP. -majjati-, to plunge or dive into, enter into (perhaps wrong reading for mi-majj-): Causal majjayati-, to submerge, cause to plunge, lead into (locative case) View this entry on the original dictionary page scan.
vimajjāntramfn. deprived of marrow and intestines (said of the body) View this entry on the original dictionary page scan.
vimajjitamfn. (fr. Causal) submerged, drowned View this entry on the original dictionary page scan.
vimalaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vimalamf(ā-)n. stainless, spotless, clean, bright, pure (literally and figuratively) etc. ( vimale le- ind.at daybreak ) View this entry on the original dictionary page scan.
vimalamf(ā-)n. clear, transparent View this entry on the original dictionary page scan.
vimalamf(ā-)n. white (See lebha-) View this entry on the original dictionary page scan.
vimalam. a magical formula recited over weapons View this entry on the original dictionary page scan.
vimalam. a particular samādhi- View this entry on the original dictionary page scan.
vimalam. a particular world View this entry on the original dictionary page scan.
vimalam. a lunar year View this entry on the original dictionary page scan.
vimalam. Name of an asura- View this entry on the original dictionary page scan.
vimalam. of a deva-putra- and bodhimaṇḍa-pratipāla- View this entry on the original dictionary page scan.
vimalam. of a bhikṣu- View this entry on the original dictionary page scan.
vimalam. of a brother of yaśas- View this entry on the original dictionary page scan.
vimalam. (with jaina-s) Name of the 5th arhat- in the past utsarpiṇī- and of the 13th in the present avasarpiṇī- View this entry on the original dictionary page scan.
vimalam. of a son of su-dyumna- View this entry on the original dictionary page scan.
vimalam. of the father of padma-- pāda- View this entry on the original dictionary page scan.
vimalam. of various authors (also with saracvatī-) View this entry on the original dictionary page scan.
vimalāf. a species of Opuntia View this entry on the original dictionary page scan.
vimalam. a particular śakti- View this entry on the original dictionary page scan.
vimalam. Name of dākṣāyaṇī- in puruṣottama- View this entry on the original dictionary page scan.
vimalam. of a yoginī- View this entry on the original dictionary page scan.
vimalam. of a daughter of gandharvī- View this entry on the original dictionary page scan.
vimalam. (with Buddhists) Name of one of the 10 bhūmi-s or stages of perfection View this entry on the original dictionary page scan.
vimalan. silver gilt View this entry on the original dictionary page scan.
vimalan. Name of a town (See -pura-) View this entry on the original dictionary page scan.
vimalan. of a tantra- View this entry on the original dictionary page scan.
vimalabhadram. Name of a man View this entry on the original dictionary page scan.
vimalabhāsam. a particular samādhi- View this entry on the original dictionary page scan.
vimalabhūdharam. Name of a Commentator View this entry on the original dictionary page scan.
vimalabodham. Name of a Commentator View this entry on the original dictionary page scan.
vimalabrahmavaryam. Name of an author View this entry on the original dictionary page scan.
vimalabuddhim. Name of a man View this entry on the original dictionary page scan.
vimalacandram. Name of a king View this entry on the original dictionary page scan.
vimaladānan. a gift or offering to a deity View this entry on the original dictionary page scan.
vimaladattam. a particular samādhi- View this entry on the original dictionary page scan.
vimaladattam. Name of a prince View this entry on the original dictionary page scan.
vimaladattāf. Name of a princess View this entry on the original dictionary page scan.
vimalādityam. a particular form of the sun View this entry on the original dictionary page scan.
vimalādrim. Name of the mountain vimala- or Girnar in Gujarat (celebrated for its inscriptions;it is also called śatruṃjaya-) View this entry on the original dictionary page scan.
vimalagarbham. a particular samādhi- View this entry on the original dictionary page scan.
vimalagarbham. of a bodhi-sattva- and a prince View this entry on the original dictionary page scan.
vimalāgranetram. Name of a future buddha- View this entry on the original dictionary page scan.
vimalākaram. Name of a prince View this entry on the original dictionary page scan.
vimalakirīṭahāravatmfn. having a bright crest and pearl-necklace View this entry on the original dictionary page scan.
vimalakīrtim. "of spotless fame", Name of a Buddhist scholar View this entry on the original dictionary page scan.
vimalamaṇim. crystal View this entry on the original dictionary page scan.
vimalamaṇikaram. (Name of a Buddhist deity ) View this entry on the original dictionary page scan.
vimalamatimfn. pure-minded, pure in heart View this entry on the original dictionary page scan.
vimalamitram. Name of a scholar View this entry on the original dictionary page scan.
vimalānanamfn. bright-faced View this entry on the original dictionary page scan.
vimalānandam. (with yogīndra-) Name of a teacher ( vimalānandanātha da-nātha- m.Name of an author; vimalānandabhāṣya da-bhāṣya- n.Name of work) View this entry on the original dictionary page scan.
vimalānandabhāṣyan. vimalānanda
vimalānandanātham. vimalānanda
vimalanāthapurāṇan. Name of a jaina- work View this entry on the original dictionary page scan.
vimalanetram. Name of a buddha- View this entry on the original dictionary page scan.
vimalanetram. of a prince View this entry on the original dictionary page scan.
vimalanirbhāsam. a particular samādhi- View this entry on the original dictionary page scan.
vimalanirdeśam. Name of a mahāyāna-sūtra- View this entry on the original dictionary page scan.
vimalāpamfn. having pure water View this entry on the original dictionary page scan.
vimalapiṇḍakam. Name of a serpent-demon View this entry on the original dictionary page scan.
vimalaprabham. a particular samādhi- (alsof(ā-). ) View this entry on the original dictionary page scan.
vimalaprabham. Name of a buddha- View this entry on the original dictionary page scan.
vimalaprabham. of a devaputra- (varia lectio a-vimala-p-) View this entry on the original dictionary page scan.
vimalaprabhāf. Name of a princess View this entry on the original dictionary page scan.
vimalaprabhāsaśrītejorājagarbham. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
vimalapradīpam. a particular samādhi- View this entry on the original dictionary page scan.
vimalapraśnottaramālāf. Name of work View this entry on the original dictionary page scan.
vimalapuran. Name of a city
vimalārthakamfn. (said to be) equals vimalātmaka- View this entry on the original dictionary page scan.
vimalasambhavam. Name of a mountain View this entry on the original dictionary page scan.
vimalāśokamn. (?) Name of a place of pilgrimage View this entry on the original dictionary page scan.
vimalaśrīgarbham. Name of a bodhisattva- View this entry on the original dictionary page scan.
vimalāśvāf. Name of a village View this entry on the original dictionary page scan.
vimalasvabhāvam. Name of a mountain View this entry on the original dictionary page scan.
vimalatāf. stainlessness, cleanliness, brightness, clearness, purity etc. View this entry on the original dictionary page scan.
vimalātmakamfn. pure-minded, clean, pure View this entry on the original dictionary page scan.
vimalātmanmfn. idem or 'mfn. pure-minded, clean, pure ' View this entry on the original dictionary page scan.
vimalatvan. stainlessness, cleanliness, brightness, clearness, purity etc. View this entry on the original dictionary page scan.
vimalavāhanam. Name of two princes View this entry on the original dictionary page scan.
vimalavegaśrīm. Name of a prince of the gandharva-s View this entry on the original dictionary page scan.
vimalavyūham. Name of a garden View this entry on the original dictionary page scan.
vimalayaNom. P. yati-, to make clear or pure View this entry on the original dictionary page scan.
vimaleind. vimala
vimaleśvarapuṣkariṇīsaṃgamatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
vimaleśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
vimalikaraṇan. the act of clearing, purification View this entry on the original dictionary page scan.
vimalimanm. clearness, purity View this entry on the original dictionary page scan.
vimalitamfn. clear, pure View this entry on the original dictionary page scan.
vimalodāf. Name of a river View this entry on the original dictionary page scan.
vimalodakāf. Name of a river View this entry on the original dictionary page scan.
vimalogyan. (?) Name of a tantra-. View this entry on the original dictionary page scan.
vimalorjan. Name of a tantra-. View this entry on the original dictionary page scan.
vimaṃhA1. -maṃhate-, to distribute, bestow View this entry on the original dictionary page scan.
vimāṃsan. unclean meat (exempli gratia, 'for example' the flesh of dogs etc.) View this entry on the original dictionary page scan.
vimāṃsan. "without meat"in -kṛ-, -karoti-, to deprive of meat View this entry on the original dictionary page scan.
vimāṃsa vi-mātṛ- etc. See p.951. View this entry on the original dictionary page scan.
viman(only r. plural proper A1. -manmahe-), to distinguish : Causal -mānayati- to dishonour, slight, treat with disrespect, View this entry on the original dictionary page scan.
vimanamfn. (mc.) equals vi-manas-, dejected, downcast View this entry on the original dictionary page scan.
vimānamfn. (for 2.See vi-man-) devoid of honour, disgraced View this entry on the original dictionary page scan.
vimānam. (for 1.See;for 3. under vi--) disrespect, dishonour (See a-vi mana-). View this entry on the original dictionary page scan.
vimānamf(ī-)n. (for 1.See;for 2, under vi-man-) measuring out, traversing View this entry on the original dictionary page scan.
vimānam. n. a car or chariot of the gods, any mythical self-moving aerial car (sometimes serving as a seat or throne, sometimes self-moving and carrying its occupant through the air;other descriptions make the vimāna- more like a house or palace, and one kind is said to be 7 stories high;that of rāvaṇa- was called puṣpaka- q.v;the nau-v-[ ] is thought to resemble a ship) etc. View this entry on the original dictionary page scan.
vimānam. any car or vehicle (especially a bier) View this entry on the original dictionary page scan.
vimānam. the palace of an emperor or supreme monarch (especially one with 7 stories) etc. View this entry on the original dictionary page scan.
vimānam. a temple or shrine of a particular form View this entry on the original dictionary page scan.
vimānam. a kind of tower (?) View this entry on the original dictionary page scan.
vimānam. a grove View this entry on the original dictionary page scan.
vimānam. a ship, boat View this entry on the original dictionary page scan.
vimānam. a horse View this entry on the original dictionary page scan.
vimānan. measure View this entry on the original dictionary page scan.
vimānan. extension View this entry on the original dictionary page scan.
vimānan. (in med.) the science of (right) measure or proportion (exempli gratia, 'for example' of the right relation between the humours of the body, of medicines and remedies etc.) View this entry on the original dictionary page scan.
vimānacārinmfn. travelling in a celestial car View this entry on the original dictionary page scan.
vimānacyutamfn. fallen from a celestial car View this entry on the original dictionary page scan.
vimānagamanan. "going in a car", Name of a chapter of the View this entry on the original dictionary page scan.
vimānakam. (in fine compositi or 'at the end of a compound') equals vi-māna-, a celestial car View this entry on the original dictionary page scan.
vimānakam. a seven-storied palace or tower View this entry on the original dictionary page scan.
vimānalakṣaṇan. Name of work on architecture View this entry on the original dictionary page scan.
vimānamāhātmyan. Name of a chapter of the View this entry on the original dictionary page scan.
vimānanan. (andf(ā-).) disrespect, contempt, slight, humiliation etc. View this entry on the original dictionary page scan.
vimānanan. refusal, denial View this entry on the original dictionary page scan.
vimānanirvyūham. a particular samādhi- View this entry on the original dictionary page scan.
vimānapālam. the guardian of a celestial car View this entry on the original dictionary page scan.
vimānaprabhutāf. the ownership of a celestial car View this entry on the original dictionary page scan.
vimānapratimamfn. resembling a celestial car View this entry on the original dictionary page scan.
vimānarājam. the driver of a celestial car View this entry on the original dictionary page scan.
vimanas(v/i--) mfn. having a keen or penetrating mind or understanding, sagacious View this entry on the original dictionary page scan.
vimanasmfn. destitute of mind, foolish, silly View this entry on the original dictionary page scan.
vimanasmfn. out of one's mind or senses, discomposed, perplexed, dejected, downcast, heart-broken etc. View this entry on the original dictionary page scan.
vimanasmfn. changed in mind or feeling, averse, hostile View this entry on the original dictionary page scan.
vimanasm. Name of the author of a hymn (varia lectio for viśva-manas- q.v) View this entry on the original dictionary page scan.
vimanas1. 2. vi-manas-, vi-manthara-, vimanyu- etc. See . View this entry on the original dictionary page scan.
vimanaskamfn. perplexed in mind, distressed, disconsolate View this entry on the original dictionary page scan.
vimānasthamfn. standing on a celestial car View this entry on the original dictionary page scan.
vimānasthānan. Name of a work on medicine. View this entry on the original dictionary page scan.
vimānasuddhipūjāf. Name of work View this entry on the original dictionary page scan.
vimānatāf. the state or condition of a celestial car View this entry on the original dictionary page scan.
vimānatvan. the state or condition of a celestial car View this entry on the original dictionary page scan.
vimānavatind. like a self-moving car View this entry on the original dictionary page scan.
vimānavidyāf. Name of work View this entry on the original dictionary page scan.
vimanāyaNom. A1. yate-, to be out of one's mind, be disconsolate or downcast View this entry on the original dictionary page scan.
vimānayānamf(ā-)n. going or driving in a celestial car View this entry on the original dictionary page scan.
vimaṇḍalan. the orbit of the planets and of the moon View this entry on the original dictionary page scan.
vimāṇḍavyamfn. Name of a people View this entry on the original dictionary page scan.
vimanībhūtamfn. changed or depressed in mind View this entry on the original dictionary page scan.
vimānīkṛP. -karoti-, to turn into a celestial car View this entry on the original dictionary page scan.
vimanīkṛtamfn. offended, angry View this entry on the original dictionary page scan.
vimanimanm. depression of mind, dejectedness gaRa dṛḍhādi-. View this entry on the original dictionary page scan.
vimānitamfn. (fr. Causal) dishonoured, slighted, treated with disrespect View this entry on the original dictionary page scan.
vimanthanan. churning View this entry on the original dictionary page scan.
vimantharamfn. rather slow or dull View this entry on the original dictionary page scan.
vimānuṣamfn. without or except men View this entry on the original dictionary page scan.
vimānyamfn. to be dishonoured or offended View this entry on the original dictionary page scan.
vimanyu(v/i--) m. longing, desire View this entry on the original dictionary page scan.
vimanyumfn. free from anger or fury View this entry on the original dictionary page scan.
vimanyuka(v/i--) mfn. not angry, allaying anger or wrath View this entry on the original dictionary page scan.
vimarda vi-marśa- See under vimṛd-and vi-mṛś-, . View this entry on the original dictionary page scan.
vimardam. crushing, bruising, grinding, pounding, rubbing, friction etc. View this entry on the original dictionary page scan.
vimardam. trampling View this entry on the original dictionary page scan.
vimardam. hostile encounter, conflict, scuffle, fight, war, tumult etc. View this entry on the original dictionary page scan.
vimardam. laying waste, devastation, destruction View this entry on the original dictionary page scan.
vimardam. interruption, disturbance View this entry on the original dictionary page scan.
vimardam. touch, contact View this entry on the original dictionary page scan.
vimardam. refusal, rejection View this entry on the original dictionary page scan.
vimardam. complete obscuration, total eclipse View this entry on the original dictionary page scan.
vimardam. weariness, tediousness View this entry on the original dictionary page scan.
vimardam. the trituration of perfumes View this entry on the original dictionary page scan.
vimardam. Cassia Sophora View this entry on the original dictionary page scan.
vimardam. Name of a prince View this entry on the original dictionary page scan.
vimardakamfn. crushing, pounding, destroying View this entry on the original dictionary page scan.
vimardakam. the act of pounding, grinding, destroying, View this entry on the original dictionary page scan.
vimardakam. rolling View this entry on the original dictionary page scan.
vimardakam. the trituration of perfumes View this entry on the original dictionary page scan.
vimardakam. the conjunction of the sun and moon, eclipse View this entry on the original dictionary page scan.
vimardakam. Cassia Tora View this entry on the original dictionary page scan.
vimardakam. Name of a man View this entry on the original dictionary page scan.
vimardakṣamamfn. patient of being trampled on (in wars or tumults, said of the earth) View this entry on the original dictionary page scan.
vimardanamfn. pressing, squeezing View this entry on the original dictionary page scan.
vimardanamfn. crushing, destroying etc. View this entry on the original dictionary page scan.
vimardanam. fragrance, perfume View this entry on the original dictionary page scan.
vimardanam. Name of a rākṣasa- View this entry on the original dictionary page scan.
vimardanam. of a prince of the vidyādhara-s View this entry on the original dictionary page scan.
vimardanan. (andf(ā-).) the act of rubbing or grinding, or pounding or crushing View this entry on the original dictionary page scan.
vimardanan. hostile encounter, fight, battle, war View this entry on the original dictionary page scan.
vimardanan. devastation, destruction View this entry on the original dictionary page scan.
vimardanan. the trituration of perfumes View this entry on the original dictionary page scan.
vimardanan. an eclipse View this entry on the original dictionary page scan.
vimardārdhan. the time from the apparent conjunction to the end of an eclipse View this entry on the original dictionary page scan.
vimardinmfn. crushing to pieces, destroying, removing View this entry on the original dictionary page scan.
vimarditamfn. (fr. Causal) crushed, bruised, etc. View this entry on the original dictionary page scan.
vimarditamfn. rubbed, anointed View this entry on the original dictionary page scan.
vimardottham. fragrance arising from the trituration of perfumes View this entry on the original dictionary page scan.
vimārgam. (for 2.See vi--1. mṛj-) a wrong road, evil course etc. View this entry on the original dictionary page scan.
vimārgamfn. being on a wrong road View this entry on the original dictionary page scan.
vimārgaSee under vi-mṛj-.
vimārgam. (for 1.See) wiping off View this entry on the original dictionary page scan.
vimārgam. a broom, brush View this entry on the original dictionary page scan.
vimārgadṛṣṭimfn. looking in a wrong direction View this entry on the original dictionary page scan.
vimārgagamfn. going on a wrong road () View this entry on the original dictionary page scan.
vimārgagāminmfn. going on a wrong road () View this entry on the original dictionary page scan.
vimārgaṇan. ( mārg-) the act of seeking for (genitive case) View this entry on the original dictionary page scan.
vimārgaprasthitamfn. following a wrong road. () View this entry on the original dictionary page scan.
vimārgasthamfn. following a wrong road. () View this entry on the original dictionary page scan.
vimārjanan. wiping off, cleansing, purifying View this entry on the original dictionary page scan.
vimarṣa ṣaṇa-, ṣin-, w.r. for vi-marśa- etc. View this entry on the original dictionary page scan.
vimarśam. consideration, deliberation, trial, critical test, examination etc. View this entry on the original dictionary page scan.
vimarśam. reasoning. discussion View this entry on the original dictionary page scan.
vimarśam. knowledge, intelligence View this entry on the original dictionary page scan.
vimarśam. Name of śiva- View this entry on the original dictionary page scan.
vimarśam. (in dramatic language) critical juncture or crisis (one of the 5 saṃdhi-s or junctures of the plot, intervening between the garbha-or germ and the nirvahana-or catastrophe exempli gratia, 'for example' in the śakuntalā- the removal of her veil in the 5th act) etc. View this entry on the original dictionary page scan.
vimarṣam. irritation, impatience, displeasure View this entry on the original dictionary page scan.
vimarśanam. (written marṣaṇa-) Name of a king of the kirāta-s View this entry on the original dictionary page scan.
vimarśanan. discussing, investigation View this entry on the original dictionary page scan.
vimarśāṅgan. a division of the dramatic vimarśa- (of which there are said to be 13) View this entry on the original dictionary page scan.
vimarśavādinmfn. uttering discussions, one who reasons, a reasoner View this entry on the original dictionary page scan.
vimarśavatmfn. reflecting, meditative, doubtful View this entry on the original dictionary page scan.
vimarśinmfn. considering, trying, examining View this entry on the original dictionary page scan.
vimarṣinmfn. impatient, intolerant, averse, disliking View this entry on the original dictionary page scan.
vimarśitamfn. (fr. Causal) reflected on, considered View this entry on the original dictionary page scan.
vimastakitamfn. beheaded, decapitated View this entry on the original dictionary page scan.
vimastakitavi-mahat etc. See . View this entry on the original dictionary page scan.
vimataSee under vi-man-, column 3. View this entry on the original dictionary page scan.
vimatamfn. disagreed, at variance, of a different mind or disposition, hostile View this entry on the original dictionary page scan.
vimatamfn. slighted, offended View this entry on the original dictionary page scan.
vimatamfn. any that may please (="every") View this entry on the original dictionary page scan.
vimatam. an enemy View this entry on the original dictionary page scan.
vimatam. orn. (?) Name of a place on the river go-matī- View this entry on the original dictionary page scan.
vimātavyaSee under vi-me-. View this entry on the original dictionary page scan.
vimātavyamfn. to be bartered with (instrumental case) View this entry on the original dictionary page scan.
vimath(or manth-) P. A1. -mathati-, te-, -mathnāti-, nīte- etc. (in veda- generally A1.; infinitive mood -mathitos- ; tum- ), to tear off, snatch away ; to tear or break in pieces, rend asunder, bruise ; to cut in pieces, disperse, scatter ; to confuse, perplex, bewilder View this entry on the original dictionary page scan.
vimātham. the act of crushing or destroying utterly View this entry on the original dictionary page scan.
vimāthinmfn. crushing down, destroying View this entry on the original dictionary page scan.
vimathitamfn. crushed or dashed to pieces, scattered, dispersed, destroyed
vimathitṛm. a crusher, destroyer View this entry on the original dictionary page scan.
vimatimfn. (for 2.See viman-) of different opinion ( vimatiman -man- m.difference of opinion, disagreement) gaRa dṛḍhādi- View this entry on the original dictionary page scan.
vimatimfn. stupid, silly ( vimatitā -- f.stupidity, silliness) View this entry on the original dictionary page scan.
vimati vi-matsara- etc. See . For vi-mati-2 See column 3. View this entry on the original dictionary page scan.
vimatimfn. of different opinion gaRa dṛḍhādi- View this entry on the original dictionary page scan.
vimatif. difference of opinion. dissent, disagreement about (locative case) View this entry on the original dictionary page scan.
vimatif. dislike, aversion View this entry on the original dictionary page scan.
vimatif. doubt, uncertainty, error View this entry on the original dictionary page scan.
vimatimanm. (gaRa dṛḍhādi-) difference of opinion View this entry on the original dictionary page scan.
vimatimanm. vimati
vimatisamudghātinm. Name of a prince View this entry on the original dictionary page scan.
vimatitāf. () difference of opinion View this entry on the original dictionary page scan.
vimatitāf. vimati
vimativikīraṇam. a particular samādhi- View this entry on the original dictionary page scan.
vimātṛf. a stepmother (gaRa śubhrādi-) View this entry on the original dictionary page scan.
vimātramfn. unequal in measure ( vimātratā -- f.) View this entry on the original dictionary page scan.
vimātratāf. vimātra
vimātṛjam. a stepmother's son on View this entry on the original dictionary page scan.
vimatsaramfn. free from envy or jealousy, unenvious, unselfish etc. View this entry on the original dictionary page scan.
vimatsarinmfn. idem or 'mfn. free from envy or jealousy, unenvious, unselfish etc.' View this entry on the original dictionary page scan.
vimattamfn. discomposed, perplexed View this entry on the original dictionary page scan.
vimattamfn. being in rut, ruttish View this entry on the original dictionary page scan.
vimattamfn. intoxicated View this entry on the original dictionary page scan.
vimaulimfn. having no crest or diadem View this entry on the original dictionary page scan.
vimaunamfn. breaking silence = View this entry on the original dictionary page scan.
vimāya(v/i--) mfn. devoid of magic, free from illusion View this entry on the original dictionary page scan.
vimayaSee under vi-me-, p.981. View this entry on the original dictionary page scan.
vimayam. exchange, barter View this entry on the original dictionary page scan.
vimeA1. -mayate-, to change places, alternate (?) View this entry on the original dictionary page scan.
vimeghamfn. cloudless View this entry on the original dictionary page scan.
vimegha vi-mogha-, etc. See p.952. View this entry on the original dictionary page scan.
vimiP. -minoti-, -minute-, to fix, build, erect View this entry on the original dictionary page scan.
vimiśrP. -miśrayati-, to mix or mingle together View this entry on the original dictionary page scan.
vimiśraSee under vi-miśr-. View this entry on the original dictionary page scan.
vimiśramf(ā-)n. mixed, mingled, miscellaneous View this entry on the original dictionary page scan.
vimiśramf(ā-)n. mixed or mingled with, attended or accompanied by (instrumental case or compound) etc. View this entry on the original dictionary page scan.
vimiśramf(ā-)n. applied to one of the 7 divisions into which the course of Mercury, according to to parāśara-, is divided View this entry on the original dictionary page scan.
vimiśran. capital and interest etc., View this entry on the original dictionary page scan.
vimiśrakamfn. mixed, miscellaneous View this entry on the original dictionary page scan.
vimiśrakan. a kind of salt View this entry on the original dictionary page scan.
vimiśritamfn. mixed, mingled (with lipi- f.a particular mode of writing) View this entry on the original dictionary page scan.
vimitamfn. fixed, built etc. View this entry on the original dictionary page scan.
vimitan. a square shed or large building resting on four posts (in fine compositi or 'at the end of a compound' any hall or building) View this entry on the original dictionary page scan.
vimithunamfn. excluding the sign Gemini View this entry on the original dictionary page scan.
vimlaiP. A1. -mlāyati-, te-, to wither away, languish, become weak or weary : Causal -mlāpayati-, to cause to wither or languish, weary, enfeeble View this entry on the original dictionary page scan.
vimlānamfn. (for 2.See vi-mlai-) unfaded View this entry on the original dictionary page scan.
vimlānamfn. (for 1.See) faded or withered away, bereft of lustre or beauty, fresh, pure View this entry on the original dictionary page scan.
vimlāpanan. causing to wither or languish, softening View this entry on the original dictionary page scan.
vimocakamfn. releasing, delivering from (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vimocaka cana- etc. See p.980. View this entry on the original dictionary page scan.
vimocanamf(ī-)n. unyoking, loosening View this entry on the original dictionary page scan.
vimocanamf(ī-)n. etc. View this entry on the original dictionary page scan.
vimocanam. Name of śiva- View this entry on the original dictionary page scan.
vimocanan. unharnessing, alighting, stopping for rest, relief. View this entry on the original dictionary page scan.
vimocanan. deliverance, liberation (especially from sin) View this entry on the original dictionary page scan.
vimocanan. giving up, abandoning View this entry on the original dictionary page scan.
vimocanan. Name of a place of pilgrimage View this entry on the original dictionary page scan.
vimocanīf. Name of a river View this entry on the original dictionary page scan.
vimocanīyamfn. (in fine compositi or 'at the end of a compound') relating to the unharnessing of (see dundubhi--and ratha-v-). View this entry on the original dictionary page scan.
vimocitamfn. (fr. Causal) loosened, liberated View this entry on the original dictionary page scan.
vimocitam. Name of śiva- View this entry on the original dictionary page scan.
vimocyamfn. to be released or delivered View this entry on the original dictionary page scan.
vimoghamfn. quite fruitless, idle, vain View this entry on the original dictionary page scan.
vimoham. confusion of the mind, perplexity (also mati-v-) View this entry on the original dictionary page scan.
vimoham. a kind of hell View this entry on the original dictionary page scan.
vimohadamfn. causing perplexity, bewildering View this entry on the original dictionary page scan.
vimohakamf(ikā-)n. bewildering the mind, bewitching View this entry on the original dictionary page scan.
vimohanamfn. idem or 'mf(ikā-)n. bewildering the mind, bewitching ' View this entry on the original dictionary page scan.
vimohanam. a kind of hell (see naraka-) View this entry on the original dictionary page scan.
vimohanan. confusion, perplexity View this entry on the original dictionary page scan.
vimohanan. the art of confusing or bewildering (equals ākuli-karaṇa-) View this entry on the original dictionary page scan.
vimohinmfn. perplexing, bewildering View this entry on the original dictionary page scan.
vimohitamfn. confused, infatuated, bewitched, beguiled View this entry on the original dictionary page scan.
vimokam. unyoking, unbending, cessation, termination View this entry on the original dictionary page scan.
vimokam. letting go, abandoning, giving up View this entry on the original dictionary page scan.
vimokam. deliverance from (ablative or compound) View this entry on the original dictionary page scan.
vimokam. liberation from sensuality or worldly objects View this entry on the original dictionary page scan.
vimokamind. so that the horses are unharnessed or changed View this entry on the original dictionary page scan.
vimokṣP. -mokṣayati-, to set free, let loose, liberate View this entry on the original dictionary page scan.
vimokṣam. the being loosened or undone
vimokṣam. release, deliverance from (ablative or compound) etc. View this entry on the original dictionary page scan.
vimokṣam. liberation of the soul id est final emancipation (sometimes 8, sometimes 3 kinds are enumerated see and 73) etc. View this entry on the original dictionary page scan.
vimokṣam. letting loose, setting at liberty (a thief) View this entry on the original dictionary page scan.
vimokṣam. giving up, abandoning View this entry on the original dictionary page scan.
vimokṣam. letting flow, shedding (of tears) View this entry on the original dictionary page scan.
vimokṣam. gift, bestowal (of wealth) View this entry on the original dictionary page scan.
vimokṣam. discharge (of arrows) View this entry on the original dictionary page scan.
vimokṣakamfn. one who releases from (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vimokṣakarāf. Name of a kiṃ-narī- View this entry on the original dictionary page scan.
vimokṣaṇamfn. liberating from (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vimokṣaṇan. untying, loosening View this entry on the original dictionary page scan.
vimokṣaṇan. liberation, deliverance from (ablative or compound) etc. (also"from an embryo"; aṇḍ/a'a-v-,"laying eggs" ; asṛg-v-,"letting blood" ) View this entry on the original dictionary page scan.
vimokṣaṇan. taking off, casting away, View this entry on the original dictionary page scan.
vimokṣaṇan. giving up (the ghost) View this entry on the original dictionary page scan.
vimokṣaṇan. discharging (arrows) View this entry on the original dictionary page scan.
vimokṣinmfn. one who has attained to final emancipation View this entry on the original dictionary page scan.
vimoktavyamfn. to be let loose or set at liberty View this entry on the original dictionary page scan.
vimoktavyamfn. to be given up or abandoned View this entry on the original dictionary page scan.
vimoktavyamfn. to be discharged or hurled or cast at (dative case or locative case) View this entry on the original dictionary page scan.
vimoktṛmf(tr/ī-)n. one who unyokes or unharnesses View this entry on the original dictionary page scan.
vimokyaSee a-vimoky/a-. View this entry on the original dictionary page scan.
vimrad(only imperative -mradā-), to make soft or tender, soften View this entry on the original dictionary page scan.
vimṛdP. -mṛdnāti-, -mardati-, to crush or press to pieces, bruise, pound, grind down, lay waste, destroy etc. ; to rub together : Causal -mardayati-, to crush to pieces, bruise ; to rub
vimṛdhm. ( mṛdh-) a despiser, foe, enemy View this entry on the original dictionary page scan.
vimṛdhm. "averter of enemies", Name of indra- View this entry on the original dictionary page scan.
vimṛdhamf(ā-)n. warding off an enemy View this entry on the original dictionary page scan.
vimṛditamfn. bruised, pounded, broken, rubbed View this entry on the original dictionary page scan.
vimṛditadhvajamfn. having a crushed or broken banner View this entry on the original dictionary page scan.
vimṛdvatmf(atī-)n. belonging to indra- View this entry on the original dictionary page scan.
vimṛgamfn. containing no deer (as a forest) View this entry on the original dictionary page scan.
vimṛgvanmf(arī-)n. pure, View this entry on the original dictionary page scan.
vimritP. -mrityati-, to fall to pieces, crumble away, decay View this entry on the original dictionary page scan.
vimṛjP. A1. -mārṣṭi-, -mṛṣṭe- (perfect tense Potential -māmṛjīta- ), to rub off or out, purify, cleanse ; to rub dry ; to rub on or in, anoint, smear with (instrumental case) ; to wipe off ; to rub, stroke, caress etc. ; A1. (with tanv/am-), to adorn or arm one's self View this entry on the original dictionary page scan.
vimṛś(often confounded with vi-mṛṣ-) P. -mṛśati-, to touch (with the hands), stroke, feel ; to touch (mentally), be sensible or aware of, perceive, consider, reflect on, deliberate about etc. ; to investigate, examine, try, test etc. ; (with infinitive mood) to hesitate about doing anything : Causal -marśayati-, to ponder, reflect on, consider View this entry on the original dictionary page scan.
vimṛṣP. A1. -mṛṣyati-, te-, or -marṣati-, te- (see vi-mṛś-), to be distressed, bear hardly View this entry on the original dictionary page scan.
vimṛśam. reflection, consideration, deliberation View this entry on the original dictionary page scan.
vimṛśitamfn. reflected on, considered View this entry on the original dictionary page scan.
vimṛṣṭamfn. (for 2.See under vi-mṛś-) rubbed off etc. View this entry on the original dictionary page scan.
vimṛṣṭamfn. depressed (See below) View this entry on the original dictionary page scan.
vimṛṣṭamfn. (for 1.See under vi-mṛj-) reflected on, considered, weighed View this entry on the original dictionary page scan.
vimṛṣṭāntarāṃsamfn. having the space between the shoulders a little depressed (nyūna- Scholiast or Commentator) View this entry on the original dictionary page scan.
vimṛṣṭarāgamfn. having the colour refined or purified View this entry on the original dictionary page scan.
vimṛśyamfn. to be tried or examined View this entry on the original dictionary page scan.
vimṛśyaind. having deliberated or considered ( vimṛśyakārin -kārin- mfn.acting after due deliberation) View this entry on the original dictionary page scan.
vimṛśyakārinmfn. vimṛśya
vimṛtyumfn. not liable to death, immortal View this entry on the original dictionary page scan.
viṃśa(for 2.See below) . See paḍviṃśa-. View this entry on the original dictionary page scan.
viṃśamf(ī-)n. twentieth View this entry on the original dictionary page scan.
viṃśamf(ī-)n. accompanied or increased by 20 (with śata- n.120 ) View this entry on the original dictionary page scan.
viṃśamf(ī-)n. consisting of 20 parts etc. View this entry on the original dictionary page scan.
viṃśamf(ī-)n. (in fine compositi or 'at the end of a compound') equals viṃśati-, 20 View this entry on the original dictionary page scan.
viṃśam. (with or without aṃśa-or bhāga-) the 20th part View this entry on the original dictionary page scan.
viṃśam. Name of a king View this entry on the original dictionary page scan.
viṃśan. a decade, 20 View this entry on the original dictionary page scan.
viṃśacchlokīf. (fr. viṃśat-+ śl-) Name of work View this entry on the original dictionary page scan.
viṃśadbāhum. (fr. viṃśat-+ b-) "twenty-armed", Name of rāvaṇa- View this entry on the original dictionary page scan.
viṃśajam. Name of a king View this entry on the original dictionary page scan.
viṃśakamfn. accompanied or increased by twenty View this entry on the original dictionary page scan.
viṃśakamfn. consisting of 20 parts View this entry on the original dictionary page scan.
viṃśakan. a decade, 20 View this entry on the original dictionary page scan.
viṃśakan. (with śata-) 20 per cent. View this entry on the original dictionary page scan.
viṃśāṃśam. the 20th part View this entry on the original dictionary page scan.
viṃśatin some compound equals viṃśati- (See eka--and pari-viṃśat-; viṃśac-chlokī-and viṃśad-bāhu-). View this entry on the original dictionary page scan.
viṃśatif. (prob. for dvi-daśati-,"two decades") twenty, a score (with a noun either in genitive or in apposition, exempli gratia, 'for example' viṃśatir ghaṭānām-,"20 jars"; viṃśaty/ā h/aribhiḥ-,"with 20 horses") etc. View this entry on the original dictionary page scan.
viṃśatif. a particular form of military array (equals vyūha-) () View this entry on the original dictionary page scan.
viṃśatim. Name of a son of ikṣvāku- [ confer, compare Greek , ; Latin viginti.] View this entry on the original dictionary page scan.
viṃśatibāhum. "20-armed", Name of rāvaṇa- View this entry on the original dictionary page scan.
viṃśatibhāgam. the twentieth part View this entry on the original dictionary page scan.
viṃśatibhujam. equals -bāhu- View this entry on the original dictionary page scan.
viṃśatidvijamfn. (a festival) to which 20 Brahmans are invited View this entry on the original dictionary page scan.
viṃśatikīnaSee adhyardha-- and dvi-v-. View this entry on the original dictionary page scan.
viṃśatimamfn. equals viṃśati-tama-, twentieth (with bhāga- m.1/20) View this entry on the original dictionary page scan.
viṃśatipam. the chief of 20 (villages) View this entry on the original dictionary page scan.
viṃśatīśa m. equals viṃśati-pa- View this entry on the original dictionary page scan.
viṃśatisāhasramf(ā-)n. 20, 000 View this entry on the original dictionary page scan.
viṃśatiśata(viṃsat/i--) n. 120 View this entry on the original dictionary page scan.
viṃśatīśinm. equals viṃśati-pa- View this entry on the original dictionary page scan.
viṃśatismṛtif. Name of work View this entry on the original dictionary page scan.
viṃśatistotran. Name of work View this entry on the original dictionary page scan.
viṃśatitamamf(ī-)n. twentieth (with bhāga- m.1/20 ) View this entry on the original dictionary page scan.
viṃśatitaulikamfn. containing 20 tulā-s View this entry on the original dictionary page scan.
viṃśativarṣadeśīyamfn. about 20 years old View this entry on the original dictionary page scan.
viṃśativārṣikamf(ī-)n. lasting 20 years View this entry on the original dictionary page scan.
viṃśativārṣikamf(ī-)n. occurring after 20 years View this entry on the original dictionary page scan.
viṃśatividhamfn. of 20 kinds View this entry on the original dictionary page scan.
viṃśatyin compound for viṃśati-. View this entry on the original dictionary page scan.
viṃśatyadhipatim. equals viṃśati-pa- View this entry on the original dictionary page scan.
viṃśatyakṣaramfn. twenty-syllabled View this entry on the original dictionary page scan.
viṃśatyaṅgulimfn. twenty-fingered View this entry on the original dictionary page scan.
viṃśinmfn. consisting of twenty (see on ) View this entry on the original dictionary page scan.
viṃśinmfn. equals viṃśati-pa- View this entry on the original dictionary page scan.
viṃśinmfn. equals viṃśati-, twenty View this entry on the original dictionary page scan.
vimucP. A1. -muñcati-, te- (imperative -mumoktu- ), to unloose, unharness (A1."one's own horses") , unyoke (id est"make to halt, cause to stop or rest") etc. ; to take off (clothes, ornaments etc.) etc. ; to release, set free, liberate ; to leave, abandon, quit, desert, give up, relinquish ; to shun, avoid etc. ; to lose (consciousness) ; to pardon, forgive ; to emit, discharge, shed, pour or send forth (with grastam-,to set free a seized planet id est"free it from eclipse") ; to throw, hurl, cast (with ātmānam-and locative case,"to cast one's self into" ) etc. ; to utter (a sound) ; to assume (a shape) ; to lay (eggs) ; Passive voice -mucyate-, to be unloosed or detached etc. ; to be slackened (as reins) ; to drop or be expelled (prematurely, as a fetus) ; to be freed or delivered or released (especially from the bonds of existence), get rid of, escape from (ablative adverb in -tas- genitive case,or instrumental case) etc. ; to be deprived of (instrumental case) : Causal -mocayati-, to loosen, detach ; to unyoke ; to set free, deliver from (ablative) etc. ; to keep off, avoid : Desiderative -mumukṣati-, te-, to wish to liberate (A1."one's self") View this entry on the original dictionary page scan.
vimucf. unyoking, alighting, stopping, putting up (vimuco napāt-,"son of unyoking", Name of pūṣan- as"conductor on the way to the next world") View this entry on the original dictionary page scan.
vimucam. Name of a ṛṣi- View this entry on the original dictionary page scan.
vimudam. or n. (?) a particular high number View this entry on the original dictionary page scan.
vimūḍhamfn. (for 2.See vi-muh-) not foolish View this entry on the original dictionary page scan.
vimūḍham. a kind of divine being View this entry on the original dictionary page scan.
vimūḍhamfn. idem or 'mfn. confused, bewildered, infatuated ' etc. View this entry on the original dictionary page scan.
vimūḍhamfn. (in fine compositi or 'at the end of a compound') perplexed as to, uncertain about View this entry on the original dictionary page scan.
vimūḍhamfn. foolish, stupid View this entry on the original dictionary page scan.
vimūḍhabhāvam. bewildered state, confusion View this entry on the original dictionary page scan.
vimūḍhacetas mfn. () foolish-minded, simple View this entry on the original dictionary page scan.
vimūḍhadhī() foolish-minded, simple View this entry on the original dictionary page scan.
vimūḍhakan. a kind of farce (perhaps wrong reading for dvi-gūḍhaka-). View this entry on the original dictionary page scan.
vimūḍhasaṃjñamfn. bewildered in mind, senseless, unconscious View this entry on the original dictionary page scan.
vimūḍhātmanmfn. foolish-minded, perplexed in mind, senseless View this entry on the original dictionary page scan.
vimudramfn. "unsealed", opened, blown View this entry on the original dictionary page scan.
vimudramfn. abundant View this entry on the original dictionary page scan.
vimudraṇan. causing to blow
vimugdhaSee under vi-muh-. View this entry on the original dictionary page scan.
vimugdhamfn. confused, bewildered, infatuated View this entry on the original dictionary page scan.
vimuhP. A1. ; -muhyati-, te-, to be confused, become bewildered or stupefied, faint away etc. : Causal -mohayati-, to confuse, bewilder, infatuate etc. ; to confound, efface View this entry on the original dictionary page scan.
vimukhaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vimukhamf(ā-)n. having the face averted, turned backwards (accusative with kṛ-,"to cause to fly","putto flight") etc. View this entry on the original dictionary page scan.
vimukhamf(ā-)n. turning away from (genitive case), disappointed, downcast View this entry on the original dictionary page scan.
vimukhamf(ā-)n. averse or opposed to, abstaining or desisting from (locative case ablative, genitive case with upari-,or compound) etc. View this entry on the original dictionary page scan.
vimukhamf(ā-)n. (in fine compositi or 'at the end of a compound') indifferent to View this entry on the original dictionary page scan.
vimukhamf(ā-)n. adverse, hostile (as fate), View this entry on the original dictionary page scan.
vimukhamf(ā-)n. (in fine compositi or 'at the end of a compound') wanting, lacking, View this entry on the original dictionary page scan.
vimukhamf(ā-)n. (vi- privative) without the mouth or opening View this entry on the original dictionary page scan.
vimukhamf(ā-)n. deprived of the face or head View this entry on the original dictionary page scan.
vimukham. Name of a text (;xxxix, 7) View this entry on the original dictionary page scan.
vimukham. of a muni- (varia lectio vimuca-) View this entry on the original dictionary page scan.
vimukhatāf. aversion, disinclination to (locative case accusative with prati-,or compound) View this entry on the original dictionary page scan.
vimukhatvan. aversion, disinclination to (locative case accusative with prati-,or compound) View this entry on the original dictionary page scan.
vimukhayaNom. P. yati-, to render averse View this entry on the original dictionary page scan.
vimukhīin compound for vimukha-karaṇa- n. (in fine compositi or 'at the end of a compound') the rendering averse to, , View this entry on the original dictionary page scan.
vimukhībhāvam. aversion View this entry on the original dictionary page scan.
vimukhībhūP. -bhavati-, to turn the back, flee ; to turn away from (ablative) View this entry on the original dictionary page scan.
vimukhīkṛP. -karoti-, to put to flight ; to render averse or indifferent to (ablative or compound) View this entry on the original dictionary page scan.
vimukhīkṛtamfn. turned away, averse, indifferent View this entry on the original dictionary page scan.
vimukhīkṛtamfn. frustrated View this entry on the original dictionary page scan.
vimukhinmfn. having the face averted, averse from, hostile View this entry on the original dictionary page scan.
vimukhitamfn. averse, hostile View this entry on the original dictionary page scan.
vimukhitāf. (or vimukhitātva -tva- n.) turning away, aversion, enmity View this entry on the original dictionary page scan.
vimukhitātvan. vimukhitā
vimuktaSee under I. vi-muc-. View this entry on the original dictionary page scan.
vimuktamfn. unloosed, unharnessed etc. View this entry on the original dictionary page scan.
vimuktamfn. set free, liberated (especially from mundane existence), freed or delivered or escaped from (ablative instrumental case,or in fine compositi or 'at the end of a compound';rarely in the beginning of a compound; see -śāpa-) etc. View this entry on the original dictionary page scan.
vimuktamfn. deprived of(instrumental case) View this entry on the original dictionary page scan.
vimuktamfn. launched (as a ship) View this entry on the original dictionary page scan.
vimuktamfn. given up, abandoned, relinquished, deserted View this entry on the original dictionary page scan.
vimuktamfn. hurled, thrown View this entry on the original dictionary page scan.
vimuktamfn. emitted or discharged by, flowing from (compound) View this entry on the original dictionary page scan.
vimuktamfn. shed or bestowed on (locative case) View this entry on the original dictionary page scan.
vimuktamfn. (a snake) which has recently cast its skin View this entry on the original dictionary page scan.
vimuktamfn. dispassionate View this entry on the original dictionary page scan.
vimuktācāryam. Name of an author View this entry on the original dictionary page scan.
vimuktakaṇṭhamfn. having the throat or voice unloosed, raising a loud cry ( vimuktakaṇṭham am- ind.aloud, at the top of one's voice) View this entry on the original dictionary page scan.
vimuktakaṇṭhamind. vimuktakaṇṭha
vimuktakeśamfn. having flowing or dishevelled hair View this entry on the original dictionary page scan.
vimuktamaunamind. breaking silence
vimuktapragrahamfn. with slackened reins View this entry on the original dictionary page scan.
vimuktaśāpamfn. released from the (consequences) of a curse View this entry on the original dictionary page scan.
vimuktasenam. Name of a teacher View this entry on the original dictionary page scan.
vimuktatāf. loss of (genitive case) View this entry on the original dictionary page scan.
vimuktif. disjunction (opp. to yukti-) View this entry on the original dictionary page scan.
vimuktif. (in fine compositi or 'at the end of a compound') giving up View this entry on the original dictionary page scan.
vimuktif. release, deliverance, liberation View this entry on the original dictionary page scan.
vimuktif. release from the bonds of existence, final emancipation View this entry on the original dictionary page scan.
vimukticandram. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
vimuktimahimanm. Name of work View this entry on the original dictionary page scan.
vimuktipatham. the way of final emancipation View this entry on the original dictionary page scan.
vimūlamfn. uprooted (literally and figuratively) View this entry on the original dictionary page scan.
vimūlanan. the act of uprooting View this entry on the original dictionary page scan.
vimuñja(v/i--) mf(ā-)n. without a sheath View this entry on the original dictionary page scan.
vimūrchanan. equals mūrchana-, modulation, melody, etc. View this entry on the original dictionary page scan.
vimūrchitamfn. ( murch-) thickened, coagulated, become solid View this entry on the original dictionary page scan.
vimūrchitamfn. (in fine compositi or 'at the end of a compound') full of, mixed with, View this entry on the original dictionary page scan.
vimūrchitamfn. resounding with View this entry on the original dictionary page scan.
vimūrchitan. "becoming stiff", fainting, a swoon View this entry on the original dictionary page scan.
vimūrdhajamfn. hairless (on the head) View this entry on the original dictionary page scan.
vimūrtamfn. coagulated, become hard or solid, View this entry on the original dictionary page scan.
viin compound for 3. viṣ-. View this entry on the original dictionary page scan.
vior vin/ā- ind. (prob. a kind of instrumental case of 3. vi-) without, except, short or exclusive of (preceded or followed by an accusative instrumental case,rarely ablative; see ;exceptionally in fine compositi or 'at the end of a compound', gaRa exempli gratia, 'for example' gaRa śuci-vinā-,without honesty, satya-v-,without faith ) (not in manuscript) etc. (sometimes vinā-is used pleonastically, exempli gratia, 'for example' natad asti vinā deva yat te virahitaṃ hare-,"there is nothing, O god hari-, that is without thee" ). View this entry on the original dictionary page scan.
vinābhavam. the being separated, separation from (ablative) View this entry on the original dictionary page scan.
vinābhāvam. idem or 'm. the being separated, separation from (ablative) ' View this entry on the original dictionary page scan.
vinābhāvamind. ( bhū-) separately View this entry on the original dictionary page scan.
vinābhāvinSee a-vinābh-. View this entry on the original dictionary page scan.
vinābhāvyamfn. separable (in a-vinābh-) View this entry on the original dictionary page scan.
vinābhūtamfn. separated from, bereaved of (instrumental case) View this entry on the original dictionary page scan.
vinābhūtvāind. equals -bhāvam- View this entry on the original dictionary page scan.
vinābhūya ind. equals -bhāvam- View this entry on the original dictionary page scan.
vinadP. -nadati-, to sound forth, cry out, roar, bellow, thunder etc. (with ravam mahā-svanam-,to roar aloud) ; to roar or scream at or about (accusative) ; to fill with cries : Causal -nādayati- (Passive voice -nādyate-), to cause to sound or resound, fill with noise or cries etc. ; to sound aloud View this entry on the original dictionary page scan.
vināḍam. (prob.) a leather bag View this entry on the original dictionary page scan.
vinadam. sound, noise View this entry on the original dictionary page scan.
vinadam. Alstonia Scholaris View this entry on the original dictionary page scan.
vinadāf. a particular śakti- View this entry on the original dictionary page scan.
vinaddhamfn. ( nah-) untied, unfastened, set free View this entry on the original dictionary page scan.
vinadīf. Name of a river (varia lectio vainadī-). View this entry on the original dictionary page scan.
vināḍīf. a period of 24 seconds (the 60th part of a nāḍī- or Indian hour) View this entry on the original dictionary page scan.
vinadīf. Name of a river (varia lectio vainadī-). View this entry on the original dictionary page scan.
vināḍikā f. a period of 24 seconds (the 60th part of a nāḍī- or Indian hour) View this entry on the original dictionary page scan.
vinadinmfn. roaring, thundering, grumbling View this entry on the original dictionary page scan.
vinādinmfn. sounding forth, crying out View this entry on the original dictionary page scan.
vināditamfn. (fr. Causal) made to resound, caused to sound aloud View this entry on the original dictionary page scan.
vinagnamfn. quite naked View this entry on the original dictionary page scan.
vināham. a top or cover for the mouth of a well (see -nāha-). View this entry on the original dictionary page scan.
vinākṛtamfn. "made without", deprived or bereft of, separated from, left or relinquished by, lacking, destitute of, free from (instrumental case ablative,or compound) etc. View this entry on the original dictionary page scan.
vinākṛtamfn. standing alone, solitary. View this entry on the original dictionary page scan.
vinākṛtyaind. setting aside, without (instrumental case) View this entry on the original dictionary page scan.
vinālamfn. without a stalk View this entry on the original dictionary page scan.
vināla vi-nāsa- etc. See . View this entry on the original dictionary page scan.
vinamP. A1. -namati-, te-, to bend down, bow down, stoop etc.: Causal -nāmayati-, or -namayati- (ind.p. -nāmya-and -namayya-), to bend down, incline, bend (a bow) ; (in gram.) to cerebralize or change into a cerebral letter (see -nāmita-).
vināmam. crookedness (of the body, caused by pain) (also vināmaka maka- m. vināmikā mikā- f.) View this entry on the original dictionary page scan.
vināmam. conversion into a cerebral letter, the substitution of - for s- and - for n- View this entry on the original dictionary page scan.
vināmakam. vināma
vinamanan. the act of bending down (opp. to un-n-) View this entry on the original dictionary page scan.
vinamanamitamfn. (fr. Causal) bent or turned towards (abhimukham-) View this entry on the original dictionary page scan.
vinamanamraSee . View this entry on the original dictionary page scan.
vināmikāf. vināma
vināmitamfn. (fr. Causal) bent down, inclined View this entry on the original dictionary page scan.
vinamramf(ā-)n. bent down, stooping, submissive, humble, modest View this entry on the original dictionary page scan.
vinamrakan. the flower of Tabernaemontana Coronaria View this entry on the original dictionary page scan.
vinamrakaṃdharamfn. having the neck bent View this entry on the original dictionary page scan.
vinaṃśinmfn. disappearing, vanishing View this entry on the original dictionary page scan.
vinandP. A1. -nandati-, te-, to rejoice, be glad or joyful View this entry on the original dictionary page scan.
vinaṅgṛsam. (of unknown origin and meaning) (kamanīyaṃ stotraṃ gṛhṇātiyaḥ- ; dual number"the two arms") . View this entry on the original dictionary page scan.
vinānyonyam(n-) ind. (perhaps two separate words) without each other, one without the other View this entry on the original dictionary page scan.
vinārāśaṃsamf(ā-)n. without the formulas called nārāśaṃsa- View this entry on the original dictionary page scan.
vinardP. A1. -nardati-, te-, to cry out, roar, thunder View this entry on the original dictionary page scan.
vinardinmfn. roaring (applied to a particular method of chanting the sāma-veda-) View this entry on the original dictionary page scan.
vināruhāf. a kind of plant View this entry on the original dictionary page scan.
vinaśP. -naśati-, to reach, attain View this entry on the original dictionary page scan.
vinaśP. -naśati-, or -naśyati- (future -naśiṣyati-or -naṅkṣyati-; infinitive mood -naśitum-or -naṃṣṭum-), to be utterly lost, perish, disappear, vanish etc. ; to come to nothing, be frustrated or foiled ; to be deprived of (ablative) ; to destroy, annihilate : Causal -nāśayati- (Aorist vy-anīnaśat-), to cause to be utterly lost or ruined or to disappear or vanish etc. etc. (once in with genitive case for accusative) ; to frustrate, disappoint, render ineffective (a weapon) ; to suffer to be lost or ruined ; (Aorist) to be lost, perish View this entry on the original dictionary page scan.
vinasamf(ā-)n. without a nose, noseless View this entry on the original dictionary page scan.
vināsamf(ā-)n. noseless, View this entry on the original dictionary page scan.
vināśam. utter loss, annihilation, perdition, destruction, decay, death, removal etc. View this entry on the original dictionary page scan.
vināsadaśanamfn. bereft of nose and teeth (Bombay edition vi-nemi-d-). View this entry on the original dictionary page scan.
vināśadharmanmfn. subject to the law of decay (varia lectio min-;but see ) View this entry on the original dictionary page scan.
vināśahetumfn. being the cause of death View this entry on the original dictionary page scan.
vināsaka mfn. equals -nāsa- View this entry on the original dictionary page scan.
vināśakamfn. (fr. Causal) annihilating, destroying a destroyer View this entry on the original dictionary page scan.
vināśakṛtmfn. (in fine compositi or 'at the end of a compound') causing destruction of, destroying View this entry on the original dictionary page scan.
vinaśanan. utter loss, perishing, disappearance (with sarasvatyāḥ-Name of a district north-west of Delhi [said to be the same as kuru-kṣetra- and adjacent to the modern Paniput] where the river sarasvatī- is lost, in the sand;also sarasvatī-vin-) View this entry on the original dictionary page scan.
vināśanamf(ī-)n. (fr. idem or 'mfn. (fr. Causal) annihilating, destroying a destroyer ') idem or 'mfn. (fr. Causal) annihilating, destroying a destroyer ' etc. View this entry on the original dictionary page scan.
vināśanam. Name of an asura- (son of kalā-) View this entry on the original dictionary page scan.
vināśanan. causing to disappear, removal, destruction, annihilation View this entry on the original dictionary page scan.
vinaśanakṣetran. the district of vinaśana- View this entry on the original dictionary page scan.
vinaśanaśvaramf(ī-)n. liable to be destroyed or lost, perishable etc. View this entry on the original dictionary page scan.
vinaśanaśvaratāf. perishableness, transitoriness View this entry on the original dictionary page scan.
vinaśanaśvaratvan. perishableness, transitoriness View this entry on the original dictionary page scan.
vināśāntam. "end (caused by) destruction", death View this entry on the original dictionary page scan.
vināśāntamfn. ending in death View this entry on the original dictionary page scan.
vināśasambhavam. a source of destruction, cause of the subsequent non-existence of a composite body (avayavin-) View this entry on the original dictionary page scan.
vināśayitṛmfn. (fr. idem or 'n. causing to disappear, removal, destruction, annihilation ') one who destroys, a destroyer View this entry on the original dictionary page scan.
vināsikāf. a particular venomous insect View this entry on the original dictionary page scan.
vināsikamfn. equals -nāsa- View this entry on the original dictionary page scan.
vināsikāf. a particular venomous insect View this entry on the original dictionary page scan.
vināśinmfn. perishing, perishable ( vināśitva śi-tva- n.) etc. View this entry on the original dictionary page scan.
vināśinmfn. under. going transformation View this entry on the original dictionary page scan.
vināśinmfn. (mostly in fine compositi or 'at the end of a compound') destructive, destroying etc. View this entry on the original dictionary page scan.
vināśinmfn. (a tale) treating of the destruction of (genitive case) View this entry on the original dictionary page scan.
vināśitamfn. (fr. idem or 'mfn. (fr. idem or 'n. causing to disappear, removal, destruction, annihilation ') one who destroys, a destroyer ') utterly destroyed, ruined View this entry on the original dictionary page scan.
vināśitvan. vināśin
vināśonmukhamfn. ready to perish, fully ripe or mature View this entry on the original dictionary page scan.
vinaṣṭamfn. utterly lost or ruined, destroyed, perished, disappeared etc. View this entry on the original dictionary page scan.
vinaṣṭamfn. spoilt, corrupted View this entry on the original dictionary page scan.
vinaṣṭan. (prob.) a dead carcass, carrion (See below) View this entry on the original dictionary page scan.
vinaṣṭacakṣusmfn. one who has lost his eyes View this entry on the original dictionary page scan.
vinaṣṭadharmamfn. (a country) whose laws are corrupted View this entry on the original dictionary page scan.
vinaṣṭadṛṣṭimfn. one who has lost his sight View this entry on the original dictionary page scan.
vinaṣṭakaSee bāla-viṇaṣṭaka-. View this entry on the original dictionary page scan.
vinaṣṭatejasmfn. (v/i-n-) one whose energy is lost, weak, feeble View this entry on the original dictionary page scan.
vinaṣṭi(v/i--) f. loss, ruin, destruction View this entry on the original dictionary page scan.
vinaṣṭopajīvinmfn. living on dead carcasses or carrion
vināśyamfn. to be destroyed or annihilated ( vināśyatva -tva- n.) View this entry on the original dictionary page scan.
vināśyatvan. vināśya
vinatamfn. bent, curved, bent down, bowed, stooping, inclined, sunk down, depressed, deepened ( vinatam am- ind.) View this entry on the original dictionary page scan.
vinatamfn. bowing to (genitive case) View this entry on the original dictionary page scan.
vinatamfn. humble, modest View this entry on the original dictionary page scan.
vinatamfn. dejected, dispirited View this entry on the original dictionary page scan.
vinatamfn. (in gram.) changed into a cerebral letter (see -nāma-) View this entry on the original dictionary page scan.
vinatamfn. accentuated in a particular manner, View this entry on the original dictionary page scan.
vinatam. a kind of ant View this entry on the original dictionary page scan.
vinatam. Name of a son of su-dyumna- View this entry on the original dictionary page scan.
vinatam. of a monkey View this entry on the original dictionary page scan.
vinata(perhaps) n. Name of a place situated on the go-mati- View this entry on the original dictionary page scan.
vinatāf. See below View this entry on the original dictionary page scan.
vinatāf. a girl with bandy legs or a hunch back View this entry on the original dictionary page scan.
vinatāf. an abscess on the back or abdomen accompanying diabetes View this entry on the original dictionary page scan.
vinatāf. a sort of basket View this entry on the original dictionary page scan.
vinatāf. Name of one of kaśyapa-'s wives (and mother of suparṇa-, aruṇa- and garuḍa- etc.;in , vinatā- is enumerated among the thirteen daughters of dakṣa-;the bhāgavata-purāṇa- makes her the wife of tārkṣa-;the vāyu- describes the metres of the veda- as her daughters, while the padma- gives her only one daughter, saudāminī-) etc. View this entry on the original dictionary page scan.
vinatāf. Name of a female demon of illness View this entry on the original dictionary page scan.
vinatāf. of a rākṣasī- View this entry on the original dictionary page scan.
vināṭam. (see nāḍa-) a leather-bag View this entry on the original dictionary page scan.
vinatakam. Name of a mountain View this entry on the original dictionary page scan.
vinatakāyamfn. one who has the body bent, stooping View this entry on the original dictionary page scan.
vinatamind. vinata
vinaṭanan. ( naṭ-) moving to and fro, going hither and thither View this entry on the original dictionary page scan.
vinatānanamfn. one who has his face bent or cast down, dejected, dispirited View this entry on the original dictionary page scan.
vinatānandam. Name of a drama by go-vinda- View this entry on the original dictionary page scan.
vinatāsūnum. "son of veda-", Name of aruṇa-, garuḍa- etc. () View this entry on the original dictionary page scan.
vinatāsutam. "son of veda-", Name of aruṇa-, garuḍa- etc. () View this entry on the original dictionary page scan.
vinatāśvam. Name of a son of su-dyumna- View this entry on the original dictionary page scan.
vinatatāf. inclination View this entry on the original dictionary page scan.
vinatātanayāf. "daughter of veda-", metr. of su-mati- View this entry on the original dictionary page scan.
vināthamf(ā-)n. having no lord or master, unprotected, deserted View this entry on the original dictionary page scan.
vinatif. bowing, obeisance to (locative case) View this entry on the original dictionary page scan.
vinatif. humility, modesty View this entry on the original dictionary page scan.
vinatodaramfn. with bending waist, bending at the waist View this entry on the original dictionary page scan.
vināvāsam. abiding separate from a beloved person View this entry on the original dictionary page scan.
vinaya (said to be artificially formed fr. vi-+ nṛ-;for 2.See under vi--) Nom. P. yati- (with prefix 3. vi-; ind.p. vi-vinayya-) Va1rtt. 7 View this entry on the original dictionary page scan.
vinayamfn. (for 1.See p.969) leading away or asunder, separating View this entry on the original dictionary page scan.
vinayamfn. cast, thrown View this entry on the original dictionary page scan.
vinayamfn. secret View this entry on the original dictionary page scan.
vinayam. taking away, removal, withdrawal View this entry on the original dictionary page scan.
vinayam. leading, guidance, training (especially moral training), education, discipline, control etc. View this entry on the original dictionary page scan.
vinayam. (with Buddhists) the rules of discipline for monks View this entry on the original dictionary page scan.
vinayam. good breeding, propriety of conduct, decency, modesty, mildness (in the purāṇa-s sometimes personified as son of kriyā- or of lajjā-) View this entry on the original dictionary page scan.
vinayam. an office, business View this entry on the original dictionary page scan.
vinayam. Name of a son of sudyumna- View this entry on the original dictionary page scan.
vinayam. a man of subdued senses View this entry on the original dictionary page scan.
vinayam. a merchant, trader View this entry on the original dictionary page scan.
vinayāf. Sida Cordifolia View this entry on the original dictionary page scan.
vinayabhājmfn. possessing propriety or modesty View this entry on the original dictionary page scan.
vinayadattam. Name of a man View this entry on the original dictionary page scan.
vinayadevam. Name of a teacher View this entry on the original dictionary page scan.
vinayadevam. Name of a poet View this entry on the original dictionary page scan.
vinayādidharam.(id est vinaya-dh-) Name of a man View this entry on the original dictionary page scan.
vinayādityam. Name of jayāpīḍa-, View this entry on the original dictionary page scan.
vinayādityam. Name of a king of the race of the cālukya-s View this entry on the original dictionary page scan.
vinayādityapuran.Name of a town built by jayāpīḍa- View this entry on the original dictionary page scan.
vinayagrāhinmfn. conforming to rules of discipline, compliant, tractable View this entry on the original dictionary page scan.
vinayagrāhinm. an elephant which obeys orders View this entry on the original dictionary page scan.
vinayajyotism. (?) Name of a muni- View this entry on the original dictionary page scan.
vināyakamf(ikā-)n. taking away, removing View this entry on the original dictionary page scan.
vināyakam. "Remover (of obstacles)", Name of gaṇeśa- etc. View this entry on the original dictionary page scan.
vināyakam. a leader, guide View this entry on the original dictionary page scan.
vināyakam. a Guru or spiritual preceptor View this entry on the original dictionary page scan.
vināyakam. a buddha- View this entry on the original dictionary page scan.
vināyakam. Name of garuḍa- View this entry on the original dictionary page scan.
vināyakam. an obstacle, impediment View this entry on the original dictionary page scan.
vināyakam. equals anātha- (?) View this entry on the original dictionary page scan.
vināyakam. Name of various authors etc. View this entry on the original dictionary page scan.
vināyakam. plural a particular class of demons etc. View this entry on the original dictionary page scan.
vināyakam. plural Name of particular formulas recited over weapons View this entry on the original dictionary page scan.
vināyakam. equals nanda-paṇḍ- View this entry on the original dictionary page scan.
vināyakabhaṭṭam. Name of various authors View this entry on the original dictionary page scan.
vināyakabhojanavarṇanāf. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakacaritan. Name of the 73rd chapter of the krīḍā-khaṇḍa- or 2nd part of the gaṇeśa-- purāṇa-. View this entry on the original dictionary page scan.
vināyakacaturthīf. the fourth day of the festival in honour of gaṇeśa- View this entry on the original dictionary page scan.
vināyakacaturthīvratan.Name of work View this entry on the original dictionary page scan.
vināyakadvādaśanāmastotran. Name of work View this entry on the original dictionary page scan.
vināyakamāhātmyan. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakapaṇḍitam. Name of a poet View this entry on the original dictionary page scan.
vināyakapūjāvidhim. Name of work View this entry on the original dictionary page scan.
vināyakapurāṇan. Name of work View this entry on the original dictionary page scan.
vinayakarmann. instruction View this entry on the original dictionary page scan.
vināyakasahasranāmann. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakasaṃhitāf. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakaśāntif. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakaśāntipaddhatif. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakaśāntiprayogam. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakaśāntisaṃgraham. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakasnapanacaturthīf. the fourth day of the gaṇeśa- festival (when his image is bathed) View this entry on the original dictionary page scan.
vināyakastavarājam. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakāvatāravarṇanan. Name of part of work View this entry on the original dictionary page scan.
vināyakāvirbhāvam. Name of part of work View this entry on the original dictionary page scan.
vināyakavratakalpam. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakavratapūjāf. Name of work or chapter from work View this entry on the original dictionary page scan.
vināyakotpattif. Name of part of work View this entry on the original dictionary page scan.
vinayakṣudrakan. Name of a Buddhist work View this entry on the original dictionary page scan.
vinayakṣudrakavastun. Name of a Buddhist work View this entry on the original dictionary page scan.
vinayamayamf(ī-)n. consisting of propriety View this entry on the original dictionary page scan.
vinayaṃdharam. Name of a chamberlain View this entry on the original dictionary page scan.
vinayanamfn. taking away, removing View this entry on the original dictionary page scan.
vinayanan. the act of taming or training, education, instruction View this entry on the original dictionary page scan.
vinayanandinm. Name of the leader of a jaina- sect View this entry on the original dictionary page scan.
vinayānvitamfn. endowed with modesty, humble View this entry on the original dictionary page scan.
vinayapattran. equals -sūtra- (below) View this entry on the original dictionary page scan.
vinayapiṭakam. "basket of discipline", (with Buddhists) the collection of treatises on discipline (see above) View this entry on the original dictionary page scan.
vinayapradhānamfn. having humility pre-eminent, of which modesty is chief. View this entry on the original dictionary page scan.
vinayapramāthinmfn. violating propriety, behaving ill or improperly View this entry on the original dictionary page scan.
vinayarāmam. equals -sundara- View this entry on the original dictionary page scan.
vinayasāgaram. Name of author View this entry on the original dictionary page scan.
vinayaśrīf. Name of a woman View this entry on the original dictionary page scan.
vinayasthamfn. conforming to discipline, compliant, tractable View this entry on the original dictionary page scan.
vinayasundaram. Name of author View this entry on the original dictionary page scan.
vinayasūtran. (with Buddhists) the sūtra- treating of discipline (see above) View this entry on the original dictionary page scan.
vinayasvāminīf. Name of a woman View this entry on the original dictionary page scan.
vinayatāf. good behaviour View this entry on the original dictionary page scan.
vinayatāf. modesty View this entry on the original dictionary page scan.
vinayavācmfn. speaking modestly View this entry on the original dictionary page scan.
vinayavācf. modest speech View this entry on the original dictionary page scan.
vinayavallīf. Name of work View this entry on the original dictionary page scan.
vinayāvanatamfn. bending down modestly, bowing low with modesty View this entry on the original dictionary page scan.
vinayavastun. (with Buddhists) Name of a section of the works which treat of vinaya- (q.v)
vinayavatmfn. well-behaved (in a-vin-) View this entry on the original dictionary page scan.
vinayavatīf. Name of a woman View this entry on the original dictionary page scan.
vinayavibhaṅgam. Name of work View this entry on the original dictionary page scan.
vinayavibhāṣāśāstran. Name of a Buddhist work View this entry on the original dictionary page scan.
vinayavijayam. Name of an author View this entry on the original dictionary page scan.
vinayayoginmfn. possessing humility View this entry on the original dictionary page scan.
vināyikāf. the wife of gaṇeśa- or garuḍa- View this entry on the original dictionary page scan.
vinayoktif. plural modest speech View this entry on the original dictionary page scan.
vind P. vindati- See 3. vid-. View this entry on the original dictionary page scan.
vindamfn. finding, getting, gaining (in fine compositi or 'at the end of a compound';See go--, cāru-v-etc.) View this entry on the original dictionary page scan.
vindam. a particular hour of the day View this entry on the original dictionary page scan.
vindam. Name of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
vindam. of a king of avanti- View this entry on the original dictionary page scan.
vindakam. Name of a man View this entry on the original dictionary page scan.
vindatvatmfn. containing a form of 3. vid- View this entry on the original dictionary page scan.
vindatvatīf. a verse of this kind View this entry on the original dictionary page scan.
vindh A1. vindhate- See 2. vidh-. View this entry on the original dictionary page scan.
vindha vindha-culaka- wrong reading for vindhya-, vindhya-culika-. View this entry on the original dictionary page scan.
vindhapattram. (orf(ī-).) a plant (commonly called Bel Sunth) View this entry on the original dictionary page scan.
vindhasa(?) m. the moon View this entry on the original dictionary page scan.
vindhyam. (of doubtful derivation) Name of a low range of hills connecting the Northern extremities of the Western and Eastern Ghauts, and separating Hindustan proper from the Dekhan (the vindhya- range is reckoned among the seven principal ranges of bhārata-varṣa- [see kulagiri-,] , and according to , forms the Southern limit of madhya-deśa- or the middle region;according to a legend related in ,the personified vindhya-, jealous of himālaya-, demanded that the sun should revolve round him in the same way as about meru-, which the sun declining to do, the vindhya- then began to elevate himself that he might bar the progress of both sun and moon;the gods alarmed, asked the aid of the saint agastya-, who approached the vindhya- and requested that by bending down he would afford him an easy passage to the South country, begging at the same time that he would retain a low position till his return;this he promised to do, but agastya- never returned, and the vindhya- range consequently never attained the elevation of the himālaya-) etc. View this entry on the original dictionary page scan.
vindhyam. Name of a prince View this entry on the original dictionary page scan.
vindhyam. a hunter View this entry on the original dictionary page scan.
vindhyāf. Averrhoa Acida View this entry on the original dictionary page scan.
vindhyāf. small cardamoms View this entry on the original dictionary page scan.
vindhyācalam. equals ya-giri- View this entry on the original dictionary page scan.
vindhyācalavāsinīf. a form of durgā- View this entry on the original dictionary page scan.
vindhyaculikam. plural Name of a people (varia lectio -pulika-). View this entry on the original dictionary page scan.
vindhyādhivāsinīf. a form of durgā- View this entry on the original dictionary page scan.
vindhyādrim. equals ya-giri- etc. View this entry on the original dictionary page scan.
vindhyādrivāsinīf. equals vindhya-vās-? View this entry on the original dictionary page scan.
vindhyagirim. the vindhya- range of hills View this entry on the original dictionary page scan.
vindhyakam. plural Name of a dynasty View this entry on the original dictionary page scan.
vindhyakailāsavāsinīf. a form of durgā- View this entry on the original dictionary page scan.
vindhyakandaran. Name of a place View this entry on the original dictionary page scan.
vindhyaketum. Name of a king of the pulinda-s View this entry on the original dictionary page scan.
vindhyakūṭam. Name of the saint agastya- View this entry on the original dictionary page scan.
vindhyakūṭaka m. Name of the saint agastya- View this entry on the original dictionary page scan.
vindhyakūṭanam. Name of the saint agastya- View this entry on the original dictionary page scan.
vindhyamauleya() m. plural idem or '() () m. plural idem or 'm. plural idem or 'm. plural Name of a people ' (see -culika-).' ' View this entry on the original dictionary page scan.
vindhyamūlika() () m. plural idem or 'm. plural idem or 'm. plural Name of a people ' (see -culika-).' View this entry on the original dictionary page scan.
vindhyanilayāf. a form of durgā- View this entry on the original dictionary page scan.
vindhyanivāsinm. Name of vyāḍi- (see -vāsin-). View this entry on the original dictionary page scan.
vindhyāntavāsinm. plural the inhabitants of the inner vindhya- View this entry on the original dictionary page scan.
vindhyapālakam. plural Name of a people View this entry on the original dictionary page scan.
vindhyaparam. Name of a king of the vidyādhara-s View this entry on the original dictionary page scan.
vindhyaparvatam. equals -giri- View this entry on the original dictionary page scan.
vindhyapulikam. plural idem or 'm. plural Name of a people ' (see -culika-). View this entry on the original dictionary page scan.
vindhyārim. Name of agastya- View this entry on the original dictionary page scan.
vindhyaśailam. the vindhya- hills View this entry on the original dictionary page scan.
vindhyaśaktim. of a king View this entry on the original dictionary page scan.
vindhyasenam. Name of a king (varia lectio bimbisāra-). View this entry on the original dictionary page scan.
vindhyasthamfn. residing in the vindhya- View this entry on the original dictionary page scan.
vindhyastham. Name of vyāḍi- View this entry on the original dictionary page scan.
vindhyāṭavīf. a forest in the vindhya- View this entry on the original dictionary page scan.
vindhyāvali f. Name of the wife of the asura- bali- and mother of bāṇa- View this entry on the original dictionary page scan.
vindhyāvalīf. Name of the wife of the asura- bali- and mother of bāṇa- View this entry on the original dictionary page scan.
vindhyāvalīputram. Name of the asura- bāṇa-. (Calcutta edition) View this entry on the original dictionary page scan.
vindhyāvalisutam. () Name of the asura- bāṇa-. View this entry on the original dictionary page scan.
vindhyāvalīsutam. Name of the asura- bāṇa-. () View this entry on the original dictionary page scan.
vindhyavanan. a forest in the vindhya- View this entry on the original dictionary page scan.
vindhyavarmanm. Name of a king View this entry on the original dictionary page scan.
vindhyavāsakam. Name (also title or epithet) of a sāṃkhya- teacher. View this entry on the original dictionary page scan.
vindhyavāsinmfn. dwelling in the vindhya- View this entry on the original dictionary page scan.
vindhyavāsinm. Name of vyāḍi-
vindhyavāsinm. of a medical writer View this entry on the original dictionary page scan.
vindhyavāsinm. Name of a place View this entry on the original dictionary page scan.
vindhyavāsin m. Name (also title or epithet) of a sāṃkhya- teacher. View this entry on the original dictionary page scan.
vindhyavāsinīf. (with or without devī-) a form of durgā- View this entry on the original dictionary page scan.
vindhyavāsinīdaśakan. Name of work View this entry on the original dictionary page scan.
vindhyavatm. Name of a man View this entry on the original dictionary page scan.
vindhyāyaNom. A1. yate-, to represent or act the part of the vindhya- mountains View this entry on the original dictionary page scan.
vindhyeśvarīprasādam. Name of an author View this entry on the original dictionary page scan.
vindumfn. finding, getting, acquiring, procuring (see go--, loka-v-). View this entry on the original dictionary page scan.
vindumfn. (fr.1. vid-) knowing, acquainted or familiar with (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vindumfn. equals veditavya- View this entry on the original dictionary page scan.
vindu duka-, dula-. See bindu-. View this entry on the original dictionary page scan.
vinemidaśanaSee vi-nāsa-d-. View this entry on the original dictionary page scan.
vinetṛm. a leader, guide, instructor, teacher etc. View this entry on the original dictionary page scan.
vinetṛm. a chastiser, punisher View this entry on the original dictionary page scan.
vinetṛm. a tamer, trainer on View this entry on the original dictionary page scan.
vinetṛm. a prince, king View this entry on the original dictionary page scan.
vinetramfn. (for 2.See under vi--) eyeless, blind View this entry on the original dictionary page scan.
vinetramfn. red-eyed View this entry on the original dictionary page scan.
vinetram. (for 1.See) a teacher, preceptor View this entry on the original dictionary page scan.
vineyamfn. to be taken away or removed View this entry on the original dictionary page scan.
vineyamfn. to be trained or educated or instructed View this entry on the original dictionary page scan.
vineyamfn. to be chastised View this entry on the original dictionary page scan.
vineyam. a pupil, disciple View this entry on the original dictionary page scan.
viP. A1. -nayati-, te-, to lead or take away, remove, avert ; to throw off, drive away, dispel, expel (a disease) ; (A1.) to elicit, draw from (ablative) ; to stir up (the soma-) ; to part (the hair) ; to stretch, extend ; to train, tame, guide (horses) etc. ; to educate, instruct, direct etc. ; to chastise, punish ; to induce, lead or cause to (infinitive mood) ; to spend, pass (time) ; to perform, accomplish ; (A1.) to pay off, restore (a debt) ; to expand (especially for religious purposes) ; to get rid of. give up, cease from (anger) : Desiderative -ninīṣate-, to wish to get rid of or give up (egoism) View this entry on the original dictionary page scan.
vinibandham. ( bandh-) the being attached or attachment to anything View this entry on the original dictionary page scan.
vinibarhaṇamfn. (1. bṛh-) throwing down, crushing View this entry on the original dictionary page scan.
vinibarhinmfn. idem or 'mfn. (1. bṛh-) throwing down, crushing ' View this entry on the original dictionary page scan.
vinidhāP. A1. -dadhāti-, -dhatte-, to put or place or lay down in different places, distribute ; to put off, lay down or aside ; to put by, store up ; to put or place on, fix upon, direct (mind, eyes etc.) ; (with hṛdi-) to fix in the heart, bear in mind View this entry on the original dictionary page scan.
vinidhṛP. -dhārayati-, to fix (the eyes) upon, View this entry on the original dictionary page scan.
vinidhvaṃs(or dhvas-) P. A1. -dhvaṃsati-, te-, to fall to pieces, disappear, vanish (2. sg. imperative -dhvaṃsa-,begone, take thyself off) View this entry on the original dictionary page scan.
vinidhvastamfn. destroyed, ruined, struck down View this entry on the original dictionary page scan.
vinidramf(ā-)n. sleepless, awake etc. (also -ka- ) View this entry on the original dictionary page scan.
vinidramf(ā-)n. occurring in the waking condition View this entry on the original dictionary page scan.
vinidramf(ā-)n. passed sleeplessly View this entry on the original dictionary page scan.
vinidramf(ā-)n. expanded, blown View this entry on the original dictionary page scan.
vinidramf(ā-)n. opened (as the eyes) View this entry on the original dictionary page scan.
vinidram. a particular formula recited over weapons View this entry on the original dictionary page scan.
vinidratāf. () sleeplessness, wakefulness, vigilance. View this entry on the original dictionary page scan.
vinidratvan. () sleeplessness, wakefulness, vigilance. View this entry on the original dictionary page scan.
vinigadP. -gadati-, to speak to, address : Passive voice -gadyate-, to be called or named View this entry on the original dictionary page scan.
vinigaḍamfn. free from foot-fetters (ḍī-kṛ-,to unfetter) View this entry on the original dictionary page scan.
vinigamakamfn. ( gam-) deciding between two alternatives View this entry on the original dictionary page scan.
vinigamanāf. decision between two alternatives View this entry on the original dictionary page scan.
vinighnaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vinighnamfn. ( han-) multiplied (see ni-ghna-). View this entry on the original dictionary page scan.
vinighnatSee under vi-ni-han-. View this entry on the original dictionary page scan.
vinighnatmfn. striking down, destroying View this entry on the original dictionary page scan.
vinighūrṇitamfn. ( ghūrṇ-) moving to and fro, agitated (wrong reading vi-nicūrṇita-). View this entry on the original dictionary page scan.
vinigrah(only ind.p. -gṛhya-), to lay hold of, seize, keep back, restrain, impede View this entry on the original dictionary page scan.
vinigraham. separation, division View this entry on the original dictionary page scan.
vinigraham. restraining, checking, stopping, subduing, controlling etc. View this entry on the original dictionary page scan.
vinigraham. restriction, limitation View this entry on the original dictionary page scan.
vinigraham. disjunction, mutual opposition, an antithesis which implies that when two propositions are antithetically stated peculiar stress is laid on one of them View this entry on the original dictionary page scan.
vinigrahārtham. the sense of the above antithesis View this entry on the original dictionary page scan.
vinigrahārthīyamfn. standing in the sense of the above antithesis View this entry on the original dictionary page scan.
vinigrāhyamfn. to be stopped or restrained View this entry on the original dictionary page scan.
viniguhP. -gūhati-, to cover over, conceal, hide View this entry on the original dictionary page scan.
vinigūhitamfn. (fr. Causal) covered, concealed, hidden View this entry on the original dictionary page scan.
vinigūhitṛm. one who conceals, keeper (of a secret) View this entry on the original dictionary page scan.
vinihanP. -hanti-, to strike down, slay, slaughter, kill, destroy View this entry on the original dictionary page scan.
vinihatamfn. struck down etc. View this entry on the original dictionary page scan.
vinihatamfn. dispelled (as darkness) View this entry on the original dictionary page scan.
vinihatamfn. disregarded (as a command) View this entry on the original dictionary page scan.
vinihatamfn. afflicted, distressed (as the mind) View this entry on the original dictionary page scan.
vinihatam. a great or unavoidable calamity, infliction caused by fate or heaven View this entry on the original dictionary page scan.
vinihatam. a portent, comet, meteor View this entry on the original dictionary page scan.
vinihitamfn. put or laid down, placed or fixed upon, directed towards (locative case or compound) View this entry on the original dictionary page scan.
vinihitamfn. appointed to (locative case). View this entry on the original dictionary page scan.
vinihitamfn. separated, turned off (See tman-) View this entry on the original dictionary page scan.
vinihitadṛṣṭimfn. one who has the eyes fixed upon, eagerly looking at View this entry on the original dictionary page scan.
vinihitamanasmfn. one who has the mind fixed upon, intent upon, devoted to View this entry on the original dictionary page scan.
vinihitātmanmfn. disagreeing (in mind), not assenting View this entry on the original dictionary page scan.
viniḥkampaSee niṣk-. View this entry on the original dictionary page scan.
vinihnuP. -hnauti-, to deny, disown (wrong reading hnoti-). View this entry on the original dictionary page scan.
vinihnutamfn. denied, disowned, hidden, concealed View this entry on the original dictionary page scan.
viniḥsaraṇan. the act of going forth or out, issuing forth View this entry on the original dictionary page scan.
viniḥsṛP. A1. -sarati-, te-, to go forth, issue out, spring from (ablative) View this entry on the original dictionary page scan.
viniḥsṛptāhutif. ( sṛp-) a kind of sacrifice View this entry on the original dictionary page scan.
viniḥsṛṣṭamfn. ( sṛj-) discharged, shot off, thrown, hurled View this entry on the original dictionary page scan.
viniḥsṛtamfn. (often vi-nisṛta-) gone forth or out, issued forth, sprung from (compound) etc. View this entry on the original dictionary page scan.
viniḥsṛtamfn. escaped View this entry on the original dictionary page scan.
viniḥsṛtif. escaping, flight View this entry on the original dictionary page scan.
viniḥśvas(see vi-ni-śvas-) P. -śvasiti-, to breathe hard, heave a deep sigh ; to hiss (as a serpent) ; to snort (as an elephant) View this entry on the original dictionary page scan.
vinij(only Aorist vy-/anijam-), to wipe off View this entry on the original dictionary page scan.
vinikāram. offence, injury View this entry on the original dictionary page scan.
vinikarttavyamfn. to be cut down View this entry on the original dictionary page scan.
vinikaṣaṇan. ( kaṣ-) scratching, scraping View this entry on the original dictionary page scan.
viniketamfn. having no fixed abode View this entry on the original dictionary page scan.
vinikīrṇamfn. thrown asunder, scattered, dispersed, broken View this entry on the original dictionary page scan.
vinikīrṇamfn. covered, filled, crowded with (instrumental case or compound) View this entry on the original dictionary page scan.
vinikocanan. ( kuc-) contraction (of the brows) View this entry on the original dictionary page scan.
vinikṛP. A1. -karoti-, -kurute-, to act badly towards, ill-treat, offend View this entry on the original dictionary page scan.
vinikṝ(only ind.p. -kīrya-), to cast off, abandon View this entry on the original dictionary page scan.
vinikṛntanamfn. cutting in pieces, hewing down View this entry on the original dictionary page scan.
vinikṛtP. -kṛntati-, to cut or hew in pieces, cut away, tear off, destroy
vinikṛtamfn. ill-treated, injured, damaged View this entry on the original dictionary page scan.
vinikṛttamfn. cut away, torn off View this entry on the original dictionary page scan.
vinikṣP. -nikṣati- (Ved. infinitive mood -n/ikṣe-), to pierce, penetrate View this entry on the original dictionary page scan.
vinikṣaṇan. the act of piercing View this entry on the original dictionary page scan.
vinikṣepam. tossing, throwing, sending View this entry on the original dictionary page scan.
vinikṣepam. separation, isolation (guṇa-vinikṣepa-tas-,with regard to the qualities singly or separately) View this entry on the original dictionary page scan.
vinikṣepyamfn. to be thrown into (locative case) View this entry on the original dictionary page scan.
vinikṣipP. A1. -kṣipati-, te-, to throw or put down, infix, insert, fasten ; (with manas-) to fix the mind upon (locative case) ; to deposit, entrust with ; to charge with, appoint to (locative case) View this entry on the original dictionary page scan.
vinikṣiptamfn. thrown or put down etc. View this entry on the original dictionary page scan.
vinikṣiptamfn. (in fine compositi or 'at the end of a compound') placed in or under View this entry on the original dictionary page scan.
vinīlamfn. dark-blue, blue View this entry on the original dictionary page scan.
vinīla vi-nīvi- etc. See . View this entry on the original dictionary page scan.
vinīlabandhanamfn. having dark-blue stalks View this entry on the original dictionary page scan.
vinīlakan. a corpse that has become blue View this entry on the original dictionary page scan.
viñilavinduName of a town
vinimagnamfn. ( majj-) dived under, bathed or immersed in (locative case) View this entry on the original dictionary page scan.
vinimayam. ( me-) exchange, barter (ena-,alternately) etc. View this entry on the original dictionary page scan.
vinimayam. mutual engagement, reciprocity (See kārya-vin-) View this entry on the original dictionary page scan.
vinimayam. a pledge, deposit, security View this entry on the original dictionary page scan.
vinimayam. transmutation (of letters) View this entry on the original dictionary page scan.
vinimeṣam. ( miṣ-) winking or twinkling of the eyes, a wink, sign View this entry on the original dictionary page scan.
vinimeṣaṇan. idem or 'm. ( miṣ-) winking or twinkling of the eyes, a wink, sign ' View this entry on the original dictionary page scan.
vinimīlanan. ( mīl-) shutting, closure (of a flower, of the eyes etc.), View this entry on the original dictionary page scan.
vinimīlitamfn. closed, shut View this entry on the original dictionary page scan.
vinimīlitekṣaṇamfn. having the eyes closed View this entry on the original dictionary page scan.
vinimittamfn. having no real cause, not caused by anything View this entry on the original dictionary page scan.
vinind(or nid-) P. -nindati-, to reproach, revile, abuse
vinindamfn. mocking (= surpassing, exceeding) View this entry on the original dictionary page scan.
vinindāf. reproach, abuse View this entry on the original dictionary page scan.
vinindakamfn. blaming, censuring View this entry on the original dictionary page scan.
vinindakamfn. scoffing, deriding View this entry on the original dictionary page scan.
vinindakamfn. mocking id est surpassing View this entry on the original dictionary page scan.
vinipaṭ(only ind.p. -pāṭya-), to split open, cleave, sever View this entry on the original dictionary page scan.
vinipatP. -patati-, to fall down, fall in or into (locative case) ; to flow down, alight upon (locative case) ; to fall upon, attack, assail : Causal -pātayati- (Passive voice -pātyate-), to cause to fall down, strike off (a man's head) ; to throw down, kill, destroy, annihilate View this entry on the original dictionary page scan.
vinipātam. falling down, falling View this entry on the original dictionary page scan.
vinipātam. a great fall, ruin, loss, calamity etc. View this entry on the original dictionary page scan.
vinipātam. death View this entry on the original dictionary page scan.
vinipātam. frustration View this entry on the original dictionary page scan.
vinipātam. failure (See a-vin-) View this entry on the original dictionary page scan.
vinipātagatamfn. fallen into misfortune View this entry on the original dictionary page scan.
vinipātakamfn. throwing down, causing to fall, destroying View this entry on the original dictionary page scan.
vinipātanan. causing miscarriage View this entry on the original dictionary page scan.
vinipātapratīkāram. () a remedy against misfortune View this entry on the original dictionary page scan.
vinipātapratikriyāf. () a remedy against misfortune View this entry on the original dictionary page scan.
vinipātaśaṃsinmfn. announcing misfortune or destruction, portentous View this entry on the original dictionary page scan.
vinipātinSee a-vin-. View this entry on the original dictionary page scan.
vinipatitamfn. fallen or flown down etc. View this entry on the original dictionary page scan.
vinipātitamfn. thrown down, killed, destroyed View this entry on the original dictionary page scan.
vinipīḍCaus. -pīḍayati-, to torment, harass, annoy (ind.p. vinipīḍya-,with varia lectio ca nipīḍya-). View this entry on the original dictionary page scan.
vinirbāhu vi-nirbhaya- etc. See . View this entry on the original dictionary page scan.
vinirbandham. ( bandh-) persistence or perseverance in (compound) View this entry on the original dictionary page scan.
vinirbānum. a particular mode of fighting with a sword View this entry on the original dictionary page scan.
vinirbhagnamfn. ( bhañj-) broken asunder, broken down View this entry on the original dictionary page scan.
vinirbhagnanayanamfn. one who has his eyes dashed out View this entry on the original dictionary page scan.
vinirbharts(only ind.p. -bhartsya-), to threaten or revile View this entry on the original dictionary page scan.
vinirbhayam. Name of a sādhya- View this entry on the original dictionary page scan.
vinirbhid(only ind.p. -bhidya-), to split asunder, pierce, shoot through View this entry on the original dictionary page scan.
vinirbhinnamfn. split asunder, cleft, opened, pierced View this entry on the original dictionary page scan.
vinirbhogam. Name of a cosmic period View this entry on the original dictionary page scan.
vinirbhogam. (prob. fr.3. bhuj-) Name of a particular cosmic period View this entry on the original dictionary page scan.
vinirbhuj(only ind.p. -bhujya-), to bend or turn on one side View this entry on the original dictionary page scan.
vinirdagdhamfn. completely burned up or consumed, utterly destroyed View this entry on the original dictionary page scan.
vinirdahP. -dahati-, to burn completely, consume by fire, destroy View this entry on the original dictionary page scan.
vinirdahanan. the act of burning or destroying utterly View this entry on the original dictionary page scan.
vinirdahanīf. a particular remedy View this entry on the original dictionary page scan.
vinirdeśyamfn. to be announced or reported View this entry on the original dictionary page scan.
vinirdhū(only ind.p. -dhūya-), to shake off, drive or blow away, scatter ; to shake about, agitate ; to reject, repudiate View this entry on the original dictionary page scan.
vinirdhutamfn. shaken off or about, tossed, agitated View this entry on the original dictionary page scan.
vinirdhūtamfn. shaken off View this entry on the original dictionary page scan.
vinirdhūtamfn. driven away View this entry on the original dictionary page scan.
vinirdiśP. -diśati-, to assign, destine for (locative case) ; to point out, indicate, state, declare, designate as (two accusative) ; to announce, proclaim ; to determine, resolve, fix upon View this entry on the original dictionary page scan.
vinirdiṣṭamfn. pointed out etc. View this entry on the original dictionary page scan.
vinirdiṣṭamfn. charged or entrusted with (locative case) View this entry on the original dictionary page scan.
vinirgamP. -gacchati-, to go out or away, depart or escape from (ablative) etc. ; to be beside one's self View this entry on the original dictionary page scan.
vinirgamam. going out, departure from (ablative) etc. View this entry on the original dictionary page scan.
vinirgamam. being spread or divulged, spreading abroad View this entry on the original dictionary page scan.
vinirgamam. the last of the three divisions of an astrological house View this entry on the original dictionary page scan.
vinirgatamfn. gone out, come forth, issued etc. View this entry on the original dictionary page scan.
vinirgatamfn. liberated or freed from (ablative) View this entry on the original dictionary page scan.
vinirgatif. coming forth, issuing View this entry on the original dictionary page scan.
vinirghoṣam. ( ghuṣ-) sound View this entry on the original dictionary page scan.
vinirhatamfn. ( han-) completely destroyed View this entry on the original dictionary page scan.
vinirhṛP. A1. -harati-, te-, to take out, extract ; to remove, destroy View this entry on the original dictionary page scan.
vinirjayam. complete victory, conquest View this entry on the original dictionary page scan.
vinirjiP. -jayati-, to conquer completely, win ; to vanquish, defeat, overpower, subdue View this entry on the original dictionary page scan.
vinirjitamfn. entirely conquered, subdued, won View this entry on the original dictionary page scan.
vinirjñā(only Passive voice -jñāyate-), to distinguish, discern, find out View this entry on the original dictionary page scan.
vinirlikhP. -likhati-, to make incisions in, scarify ; to scratch or scrape off, free from dirt View this entry on the original dictionary page scan.
vinirmā(only perfect tense -mame-,with act. and pass. meaning) , to fabricate, create, fashion, form, build, construct out of (instrumental case or ablative) View this entry on the original dictionary page scan.
vinirmalamfn. extremely pure View this entry on the original dictionary page scan.
vinirmāṇan. meting out, measuring View this entry on the original dictionary page scan.
vinirmāṇan. building, forming, creating (in fine compositi or 'at the end of a compound' made of formed according to) View this entry on the original dictionary page scan.
vinirmath(or manth-;only ind.p. -mathya-), to churn out ; to crush, annihilate
vinirmātṛm. a maker, builder, creator View this entry on the original dictionary page scan.
vinirmitamfn. formed, created, constructed, built, prepared, made from or fashioned out of (ablative or compound) etc. View this entry on the original dictionary page scan.
vinirmitamfn. laid out (as a garden) View this entry on the original dictionary page scan.
vinirmitamfn. fixed, appointed, destined to be (Nominal verb) View this entry on the original dictionary page scan.
vinirmitamfn. kept, celebrated, observed (as a feast) View this entry on the original dictionary page scan.
vinirmitif. formation, building, creation View this entry on the original dictionary page scan.
vinirmitsumfn. (fr. Desiderative) wishing to form or create View this entry on the original dictionary page scan.
vinirmokṣam. ( mokṣ-) emancipation, liberation, release from (compound) View this entry on the original dictionary page scan.
vinirmokṣam. exclusion, exemption View this entry on the original dictionary page scan.
vinirmucP. -muñcati- (only ind.p. -mucya-), to abandon, relinquish (the body id est to die) : Passive voice -mucyate-, to be liberated or set free, be delivered from, be rid of (instrumental case) View this entry on the original dictionary page scan.
vinirmūḍhamfn. not stultified, not made void or vain View this entry on the original dictionary page scan.
vinirmūḍhapratijñamfn. one who is faithful to a promise or agreement View this entry on the original dictionary page scan.
vinirmuktamfn. liberated, escaped, free or exempt from (instrumental case or compound) etc. View this entry on the original dictionary page scan.
vinirmuktamfn. discharged, shot off, hurled View this entry on the original dictionary page scan.
vinirmuktif. (in fine compositi or 'at the end of a compound') liberation View this entry on the original dictionary page scan.
vinirṇayam. complete settlement or decision, certainty, a settled rule View this entry on the original dictionary page scan.
vinirṇī( -;only ind.p. -ṇīya-), to decide or determine clearly View this entry on the original dictionary page scan.
vinirṇītamfn. determined clearly, ascertained, certain View this entry on the original dictionary page scan.
vinirodhamfn. uninfluenced, inactive View this entry on the original dictionary page scan.
vinirodhinmfn. ( rudh-) checking, obstructing View this entry on the original dictionary page scan.
vinirvamP. -vamati-, to vomit or spit out View this entry on the original dictionary page scan.
vinirvarṇ(only ind.p. -varṇya-), to look closely at, contemplate (varia lectio for nir-varṇya-). View this entry on the original dictionary page scan.
vinirvṛttamfn. ( vṛt-) proceeded, come forth, issued from (ablative) View this entry on the original dictionary page scan.
vinirvṛttamfn. completed, finished View this entry on the original dictionary page scan.
viniryāP. -yāti-, to go forth, go out, issue, set out View this entry on the original dictionary page scan.
viniryāṇan. the act of going forth, setting out View this entry on the original dictionary page scan.
viniryatmfn. (5. i-) going forth, issuing View this entry on the original dictionary page scan.
viniryātamfn. gone forth or out, set out View this entry on the original dictionary page scan.
viniryuj(only future -yokṣyāmi-), to discharge, shoot off (Bombay edition vi-ni-yokṣyāmi-). View this entry on the original dictionary page scan.
viniṣad( sad-) P. -ṣīdati- to sit down separately. View this entry on the original dictionary page scan.
viniśam(only ind.p. -śamya-), to hear, learn View this entry on the original dictionary page scan.
viniścalamfn. immovable, firm, steady View this entry on the original dictionary page scan.
viniścarP. -carati-, to go forth in all directions View this entry on the original dictionary page scan.
viniścayam. deciding, settling, ascertainment, settled opinion, decision, firm resolve regarding (genitive case or compound) etc. (aṅga-v-,the fixing or settling of a horoscope ) View this entry on the original dictionary page scan.
viniścayajñamfn. knowing the certainty of anything View this entry on the original dictionary page scan.
viniścāyinmfn. settling finally, deciding View this entry on the original dictionary page scan.
viniści(only ind.p. -citya-), to debate about, deliberate, consider etc. ; to determine, resolve, decide View this entry on the original dictionary page scan.
viniścitamfn. firmly resolved upon (compound) View this entry on the original dictionary page scan.
viniścitamfn. ascertained, determined, settled, certain etc. View this entry on the original dictionary page scan.
viniścitamind. most certainly, decidedly View this entry on the original dictionary page scan.
viniścitārthamfn. having a decided meaning View this entry on the original dictionary page scan.
viniṣkampamfn. idem or 'mfn. immovable, firm, steady ' , View this entry on the original dictionary page scan.
viniṣkampa vi-niṣkriya- etc. See . View this entry on the original dictionary page scan.
viniṣkṛCaus. -kārayati-, to cause to be mended or repaired View this entry on the original dictionary page scan.
viniṣkramP. A1. -krāmati-, -kramate- (ind.p. -kramya-), to step forth, go out, issue from (ablative) View this entry on the original dictionary page scan.
viniṣkrāntamfn. gone forth, come out View this entry on the original dictionary page scan.
viniṣkriyamfn. abstaining from ceremonial rites View this entry on the original dictionary page scan.
vinismṛtamfn. ( smṛ-) recorded, mentioned View this entry on the original dictionary page scan.
viniṣpādyamfn. ( pad-) to be accomplished or effected View this entry on the original dictionary page scan.
viniṣpaṭP. -pāṭayati- to split or cleave asunder
viniṣpatP. -patati-, to fall out of, fly forth from, rush forth, issue etc. ; to fly or run away ("to double or flee or move crookedly, as a hare") . View this entry on the original dictionary page scan.
viniṣpātam. rushing forth or out, pushing on (muṣṭi-vi-niṣ-,a blow with the fist) View this entry on the original dictionary page scan.
viniṣpatitamfn. rushed forth, lept out View this entry on the original dictionary page scan.
viniṣpeṣam. grinding to pieces, rubbing together, friction View this entry on the original dictionary page scan.
viniṣpīḍP. pīḍayati-, to squeeze out View this entry on the original dictionary page scan.
viniṣpiṣP. -pinaṣṭi-, to grind to pieces, crush, bruise etc. ; (pāṇau pāṇim-), to rub the hands together View this entry on the original dictionary page scan.
viniṣpiṣṭamfn. ground down, crushed into powder, smashed View this entry on the original dictionary page scan.
vinisṛtaSee vi-niḥ-sṛta-. View this entry on the original dictionary page scan.
viniṣṭan (prob. for vi-niḥ-ṣṭan-; ṣṭan- equals stan-) P. -ṣṭanati-, to groan loudly View this entry on the original dictionary page scan.
vinistapSee vi-niṣ-ṭapta-. View this entry on the original dictionary page scan.
viniṣṭaptamfn. ( tap-; see ) well roasted or fried View this entry on the original dictionary page scan.
viniṣṭhivP. -ṣṭhīvati-, or vyati-, to spit out View this entry on the original dictionary page scan.
vinisūdSee vi-ni-ṣūdita-. View this entry on the original dictionary page scan.
viniṣūditamfn. ( sūd-) destroyed utterly (Calcutta edition -sūdita-). View this entry on the original dictionary page scan.
viniśvas(see vi-niḥ-śvas-) P. -śvasita-, to breathe hard, snort, hiss ; to sigh deeply View this entry on the original dictionary page scan.
viniśvāsam. breathing hard, sighing, a sigh View this entry on the original dictionary page scan.
viniśvasitan. exhalation View this entry on the original dictionary page scan.
vinītamfn. led or taken away, removed etc. View this entry on the original dictionary page scan.
vinītamfn. stretched, extended View this entry on the original dictionary page scan.
vinītamfn. tamed, trained, educated, well-behaved, humble, modest etc. View this entry on the original dictionary page scan.
vinītamfn. versed in, acquainted or familiar with (locative case or compound) etc. View this entry on the original dictionary page scan.
vinītamfn. performed, accomplished View this entry on the original dictionary page scan.
vinītamfn. one who has subdued his passions View this entry on the original dictionary page scan.
vinītamfn. lovely, handsome View this entry on the original dictionary page scan.
vinītamfn. plain, neat (in dress etc.) View this entry on the original dictionary page scan.
vinītam. a trained horse View this entry on the original dictionary page scan.
vinītam. a merchant, trader View this entry on the original dictionary page scan.
vinītam. Name of a son of pulastya- View this entry on the original dictionary page scan.
vinītadatta m. Name of a poet View this entry on the original dictionary page scan.
vinītadevam. Name of a poet View this entry on the original dictionary page scan.
vinītakamn. equals vainītaka-. View this entry on the original dictionary page scan.
vinītamatim. Name of two men View this entry on the original dictionary page scan.
vinītaprabham. Name of a Buddhist scholar View this entry on the original dictionary page scan.
vinītasattvamfn. (a grove) containing tame animals View this entry on the original dictionary page scan.
vinītasenam. Name of a man View this entry on the original dictionary page scan.
vinītāśvam. Name of a man View this entry on the original dictionary page scan.
vinītatāf. (), modesty, decency, decorum View this entry on the original dictionary page scan.
vinītātmanmfn. having a well-controlled mind, well-behaved, modest View this entry on the original dictionary page scan.
vinītatvan. () modesty, decency, decorum View this entry on the original dictionary page scan.
vinītaveṣam. modest or plain attire View this entry on the original dictionary page scan.
vinītaveṣābharaṇamfn. humble or modest in dress and ornaments View this entry on the original dictionary page scan.
vinīteśvaram. Name of a divine being View this entry on the original dictionary page scan.
vinītif. training, good behaviour, modesty View this entry on the original dictionary page scan.
vinīvaraṇamfn. without hindrance View this entry on the original dictionary page scan.
vinivāraṇan. keeping off, restraining View this entry on the original dictionary page scan.
vinivāritamfn. kept off, prevented, hindered, opposed View this entry on the original dictionary page scan.
vinivāritamfn. screened, covered View this entry on the original dictionary page scan.
vinivartakamfn. reversing, annulling View this entry on the original dictionary page scan.
vinivartanan. turning back, return etc. View this entry on the original dictionary page scan.
vinivartanan. coming to an end, cessation View this entry on the original dictionary page scan.
vinivartif. ceasing, cessation View this entry on the original dictionary page scan.
vinivartinSee a-vinivartin-. View this entry on the original dictionary page scan.
vinivartitamfn. caused to turn back or to desist from anything View this entry on the original dictionary page scan.
vinivartitamfn. turned away, averted View this entry on the original dictionary page scan.
vinivāryamfn. to be removed or supplanted View this entry on the original dictionary page scan.
vinivedanan. the act of announcing, announcement View this entry on the original dictionary page scan.
viniveditamfn. made known, announced View this entry on the original dictionary page scan.
viniveśam. putting down, placing upon View this entry on the original dictionary page scan.
viniveśam. an impression (as of the fingers etc.) View this entry on the original dictionary page scan.
viniveśam. putting down (in a book) id est mentioning View this entry on the original dictionary page scan.
viniveśam. suitable apportionment or disposition View this entry on the original dictionary page scan.
viniveśam. entrance, settling down View this entry on the original dictionary page scan.
viniveśanan. setting down View this entry on the original dictionary page scan.
viniveśanan. raising, erection, building View this entry on the original dictionary page scan.
viniveśanan. arrangement, disposition View this entry on the original dictionary page scan.
viniveśanan. impressing View this entry on the original dictionary page scan.
viniveśinmfn. situated in or on (compound)
viniveśitamfn. raised, erected, built View this entry on the original dictionary page scan.
viniveśitamfn. placed or fixed in or on (locative case) View this entry on the original dictionary page scan.
vivimfn. deprived of a skirt or covering, denuded View this entry on the original dictionary page scan.
vinividCaus. -vedayati-, to make known, announce, inform, report ; to offer, present View this entry on the original dictionary page scan.
viniviśCaus. -veśayati-, to cause to enter into, set down or place in, put on ; to apply ; to appoint to, institute or instal in (locative case) ; to fix (the eyes or thoughts) upon (locative case) ; to fix or erect (a statue) ; to establish or found (a city) ; to draw up in array (as troops) ; (with kare-) to place in tribute, make tributary ; (with hṛdaye-) to impress on the heart View this entry on the original dictionary page scan.
viniviṣṭamfn. dwelling or residing in (compound) View this entry on the original dictionary page scan.
viniviṣṭamfn. occurring in (locative case) View this entry on the original dictionary page scan.
viniviṣṭamfn. placed on or in (locative case) View this entry on the original dictionary page scan.
viniviṣṭamfn. drawn on (locative case) View this entry on the original dictionary page scan.
viniviṣṭamfn. laid out (as tanks) View this entry on the original dictionary page scan.
viniviṣṭamfn. divided id est various or different View this entry on the original dictionary page scan.
vinivṛCaus. -vārayati- (Passive voice -vāryate-), to keep or ward off, check, prevent, suppress etc. ; to prohibit, forbid ; to remove, destroy etc. ; to dismiss (a minister), depose (a king) View this entry on the original dictionary page scan.
vinivṛtA1. -vartate-, to turn back, return etc. ; to turn away, desist or cease from (ablative) ; to cease, end, disappear etc. ; to be extinguished (as fire) ; to be omitted : Causal -vartayati-, to cause to return, call or lead back from (ablative) etc. ; to cause to cease or desist from (ablative) ; to draw back (a missile) ; to avert, divert (the gaze) ; to give up, abandon ; to cause to cease, remove ; to render ineffective, annul (a curse, fraudulent transactions etc.) View this entry on the original dictionary page scan.
vinivṛttamfn. turned back, returned, retired, withdrawn View this entry on the original dictionary page scan.
vinivṛttamfn. turned away or averted or adverse from, (ablative or compound) View this entry on the original dictionary page scan.
vinivṛttamfn. (in fine compositi or 'at the end of a compound') freed from View this entry on the original dictionary page scan.
vinivṛttamfn. desisting from (ablative), having abandoned or given up , disappeared, ended, ceased to be View this entry on the original dictionary page scan.
vinivṛttakāmamfn. one whose desires have ceased, foiled in one's wishes View this entry on the original dictionary page scan.
vinivṛttaśāpamfn. freed from (the evil effects of) a curse View this entry on the original dictionary page scan.
vinivṛttif. cessation, coming to an end etc. View this entry on the original dictionary page scan.
vinivṛttif. omission, discontinuance View this entry on the original dictionary page scan.
vinivṛtticessation of work, inactivity, View this entry on the original dictionary page scan.
vinīyam. equals kalka- View this entry on the original dictionary page scan.
viniyamP. -yacchati-, to restrain, check, control, keep in check, regulate etc. ; to draw in, withdraw ; to keep off View this entry on the original dictionary page scan.
viniyamam. limitation, restriction to (locative case) View this entry on the original dictionary page scan.
viniyamam. restraint, government View this entry on the original dictionary page scan.
viniyamyamfn. to be restricted or limited View this entry on the original dictionary page scan.
viniyatamfn. restrained, checked, regulated View this entry on the original dictionary page scan.
viniyatamfn. retrenched, limited (See compound) View this entry on the original dictionary page scan.
viniyatacetasmfn. one who has a controlled or regulated mind View this entry on the original dictionary page scan.
viniyatāhāramfn. moderate in food or diet, abstemious View this entry on the original dictionary page scan.
viniyogam. apportionment, distribution, division View this entry on the original dictionary page scan.
viniyogam. appointment to (locative case), commission, charge, duty, task, occupation etc.
viniyogam. employment, use, application (especially of a verse in ritual) etc. View this entry on the original dictionary page scan.
viniyogam. relation, correlation View this entry on the original dictionary page scan.
viniyogam. equals adhikāra-,"governing rule" on View this entry on the original dictionary page scan.
viniyogam. separation, abandonment View this entry on the original dictionary page scan.
viniyogam. impediment View this entry on the original dictionary page scan.
viniyogamālāf. Name of work View this entry on the original dictionary page scan.
viniyogasaṃgraham. Name of work View this entry on the original dictionary page scan.
viniyogasatkriyāf. Name of work View this entry on the original dictionary page scan.
viniyojitamfn. (fr. Causal) appointed or directed or applied to, destined for, chosen as (with locative case, artham-or arthāya-) etc. (paśu-tve-,destined for a sacrificial victim; adhipati-tve-,appointed to the sovereignty) View this entry on the original dictionary page scan.
viniyojitamfn. commissioned, charged, deputed View this entry on the original dictionary page scan.
viniyojyamfn. to be applied or used or employed View this entry on the original dictionary page scan.
viniyoktavyamfn. to be appointed to or employed in View this entry on the original dictionary page scan.
viniyoktavyamfn. to be enjoined or commanded View this entry on the original dictionary page scan.
viniyoktṛmfn. one who appoints etc. View this entry on the original dictionary page scan.
viniyoktṛmfn. appointer to (locative case), employer View this entry on the original dictionary page scan.
viniyoktṛmf(trī-)n. containing the special disposition of anything View this entry on the original dictionary page scan.
viniyujA1. -yuṅkte- (rarely P. -yunakti-; see on ), to unyoke, disjoin, loose, detach, separate ; to discharge (an arrow) at (locative case) ; to assign, commit, appoint to, charge or entrust with, destine for (dative case locative case,or artham-) etc. (with sakhye-,to chose for a friend) ; to apply, use, employ ; to eat : Passive voice -yujyate-, to be unyoked etc. ; to fall to pieces, decay : Causal -yojayati-, to appoint or assign to, commit to (locative case,or arthāya-,or /artham-) etc. ; to entrust anything (accusative) to (locative case) ; to offer or present, anything (accusative) to (dative case) ; to use, employ ; to perform View this entry on the original dictionary page scan.
viniyuktamfn. unyoked, disjoined etc. View this entry on the original dictionary page scan.
viniyuktamfn. appointed to, destined for (locative case) View this entry on the original dictionary page scan.
viniyuktamfn. enjoined, commanded View this entry on the original dictionary page scan.
viniyuktātmanmfn. one who has his mind fixed on or directed towards View this entry on the original dictionary page scan.
viñjamaraor viñjāmara- n. the white of the eye View this entry on the original dictionary page scan.
viñjolīf. a line, row, range View this entry on the original dictionary page scan.
viṅkam. (with bhāgavata-) Name of a poet View this entry on the original dictionary page scan.
viṅkham. a horse's hoof View this entry on the original dictionary page scan.
viṇmūtraSee under 3. viṣ-. View this entry on the original dictionary page scan.
viṇmūtran. (sg. or dual number) feces and urine View this entry on the original dictionary page scan.
vinnamfn. known, understood (equals jñāta-) View this entry on the original dictionary page scan.
vinnamfn. found, acquired etc. View this entry on the original dictionary page scan.
vinnamfn. existent, real View this entry on the original dictionary page scan.
vinnāf. a married woman View this entry on the original dictionary page scan.
vinnamfn. equals vicārita- View this entry on the original dictionary page scan.
vinnaSee pp. 964, 965. View this entry on the original dictionary page scan.
vinnapam. Name of a king
vinnapam. of the saint agastya- (perhaps wrong reading for vitta-pa-). View this entry on the original dictionary page scan.
vinnibhaṭṭam. Name of an author View this entry on the original dictionary page scan.
vinodam. driving away, removal View this entry on the original dictionary page scan.
vinodam. diversion, sport, pastime, pleasure, playing or amusing one's self with (compound) etc. ( vinodāya dāya- ind.for pleasure) View this entry on the original dictionary page scan.
vinodam. eagerness, vehemence View this entry on the original dictionary page scan.
vinodam. a kind of embrace View this entry on the original dictionary page scan.
vinodam. a kind of palace View this entry on the original dictionary page scan.
vinodam. Name of work on music View this entry on the original dictionary page scan.
vinodakallolam. Name of work View this entry on the original dictionary page scan.
vinodamañjarif. Name of work View this entry on the original dictionary page scan.
vinodanan. diversion, play, amusement, pastime ( vinodanatā -- f.) View this entry on the original dictionary page scan.
vinodanaśatan. plural hundreds of amusements View this entry on the original dictionary page scan.
vinodanatāf. vinodana
vinodāpapādinmfn. causing pleasure or delight View this entry on the original dictionary page scan.
vinodaraṅgam. Name of work View this entry on the original dictionary page scan.
vinodarasikamfn. given or addicted to pleasure View this entry on the original dictionary page scan.
vinodārthamind. for the sake of sport or pleasure View this entry on the original dictionary page scan.
vinodasthāṇan. ground (literally and figuratively) for pleasure or enjoyment View this entry on the original dictionary page scan.
vinodavatmfn. amusing, delightful View this entry on the original dictionary page scan.
vinodāyaind. vinoda
vinodinmfn. driving away, dispelling View this entry on the original dictionary page scan.
vinodinmfn. amusing, diverting View this entry on the original dictionary page scan.
vinoditamfn. (fr. Causal) driven away, dispelled View this entry on the original dictionary page scan.
vinoditamfn. diverted, amused, delighted View this entry on the original dictionary page scan.
vinoditamfn. allayed, soothed View this entry on the original dictionary page scan.
vinoktif. (in rhetoric) a figure of speech (using) vinā- (exempli gratia, 'for example' kā niśā śaśinā vinā-,"what is the night without the moon?") View this entry on the original dictionary page scan.
vinoktiSee under vinā-, p.969. View this entry on the original dictionary page scan.
vinṛtP. -nṛtyati-, to begin to dance View this entry on the original dictionary page scan.
viṇṭ cl.10 P. viṇṭayati-," to kill "or"to perish" (varia lectio) View this entry on the original dictionary page scan.
vintam. Name of a particular divine being View this entry on the original dictionary page scan.
viṇṭaka wrong reading for vi-ṭaṅka- View this entry on the original dictionary page scan.
vinuA1. -navate-, to go or spread in different directions View this entry on the original dictionary page scan.
vinudP. A1. -nudati-, te-, to drive away or asunder, scare away, dispel, remove ; to strike (cords), play (on a musical instrument) (varia lectio vi-tud-), Causal -nodayati-, to drive asunder or away, dispel ; to spend (time) ; to divert, amuse, entertain ; to amuse one's self with, delight in (instrumental case) View this entry on the original dictionary page scan.
vinudf. a stroke, thrust, blow View this entry on the original dictionary page scan.
vinunnamfn. driven asunder etc. View this entry on the original dictionary page scan.
vinunnamfn. stricken, hurt, wounded
vinuttif. dispelling, removal View this entry on the original dictionary page scan.
vinuttif. Name of an ekāha- View this entry on the original dictionary page scan.
vinyākam. the tree Echites Scholaris View this entry on the original dictionary page scan.
vinyasP. -asyati- (rarely -asati-), to put or place down in different places, spread out, distribute, arrange etc. ; to put down, deposit, place or lay on, fix in, turn or direct towards, apply to (locative case) etc. ; to mark or designate by (instrumental case) ; to entrust or make over to (locative case) View this entry on the original dictionary page scan.
vinyāsam. putting or placing down etc. View this entry on the original dictionary page scan.
vinyāsam. a deposit View this entry on the original dictionary page scan.
vinyāsam. putting on (ornaments) View this entry on the original dictionary page scan.
vinyāsam. movement, position (of limbs), attitude View this entry on the original dictionary page scan.
vinyāsam. arrangement, disposition, order View this entry on the original dictionary page scan.
vinyāsam. scattering, spreading out View this entry on the original dictionary page scan.
vinyāsam. establishment, foundation View this entry on the original dictionary page scan.
vinyāsam. putting together, connecting (words etc.), composition (of literary works) etc. View this entry on the original dictionary page scan.
vinyāsam. exhibition, display (in fine compositi or 'at the end of a compound' = showing, displaying) View this entry on the original dictionary page scan.
vinyāsam. the utterance of words of despair View this entry on the original dictionary page scan.
vinyāsam. assemblage, collection View this entry on the original dictionary page scan.
vinyāsam. any site or receptacle on or in which anything is deposited View this entry on the original dictionary page scan.
vinyasanan. putting down (pada-vinyasaṇam-kṛ-,to put down the feet, step, stride) View this entry on the original dictionary page scan.
vinyāsarekhāf. a line drawn View this entry on the original dictionary page scan.
vinyastamfn. put or placed down etc. View this entry on the original dictionary page scan.
vinyastamfn. directed to (as the mind, eyes) View this entry on the original dictionary page scan.
vinyastamfn. entrusted, delivered View this entry on the original dictionary page scan.
vinyasyamfn. to be put or placed upon (upari-) View this entry on the original dictionary page scan.
vinyayam. (5. i-) position, situation View this entry on the original dictionary page scan.
vip (or vep-) cl.1 A1. () vepate- (Epic also ti-; parasmE-pada vipān/a- ; perfect tense vivepe- grammar; vivipre- ; Aorist avepiṣṭa- ; future vepitā-, vepiṣyate- grammar; infinitive mood vepitum- ), to tremble, shake, shiver, vibrate, quiver, be stirred etc. ; to start back through fear : Causal vip/ayati- or vepayati- (Aorist avīvipat-), to cause to tremble or move, shake, agitate [ confer, compare Latin vibrare; Gothic weipan; German wi7fen,weifen,Wipfel English whiffle.] View this entry on the original dictionary page scan.
vipmfn. inwardly stirred or excited, inspired View this entry on the original dictionary page scan.
vipf. "easily moved or bent, flexible (?)", a switch, rod etc., the shaft (of an arrow), the rods (which form the bottom of the soma- filter, and support the straining cloth) View this entry on the original dictionary page scan.
vipf. a finger View this entry on the original dictionary page scan.
vipam. a learned man (equals medhāvin-) View this entry on the original dictionary page scan.
vif. speech (equals vāc-) View this entry on the original dictionary page scan.
viP. A1. -pibati-, te- (rarely -pip-), to drink at different times, drink deep ; to drink up from (ablative) View this entry on the original dictionary page scan.
vipacP. -pacati-, to cook thoroughly, dissolve by cooking or boiling ; Passive voice -pacyate-, to be cooked or baked or roasted ; to be digested ; to be completely matured or ripened or developed ; to bear fruit, develop consequences : Causal -pācayati-, to cook thoroughly, dissolve by cooking, melt, liquefy
vipadA1. -padyate-, to fall or burst asunder ; to come between, intervene, prevent, hinder ; to go wrongly, fail, miscarry, come to nought, perish die etc.: Causal pādayati-, to cause to perish, destroy, kill View this entry on the original dictionary page scan.
vipadf. going wrongly, misfortune, adversity, calamity, failure, ruin, death etc. View this entry on the original dictionary page scan.
vipadāf. misfortune, adversity, calamity View this entry on the original dictionary page scan.
vipadākrāntamfn. fallen into misfortune View this entry on the original dictionary page scan.
vipādanan. the act of destroying, killing, destruction View this entry on the original dictionary page scan.
vipādaniyamfn. to be killed, destructible View this entry on the original dictionary page scan.
vipaddaśāf. a state of misfortune, calamitous position View this entry on the original dictionary page scan.
vipadgatamfn. fallen into misfortune View this entry on the original dictionary page scan.
vipadgrastamfn. seized by misfortune, unfortunate View this entry on the original dictionary page scan.
vipadīf. gaRa kumbha-pady-ādi-. View this entry on the original dictionary page scan.
vipādikāf. (fr. -pāda-) a disease of the foot, a sore tumour on the foot View this entry on the original dictionary page scan.
vipādikāf. a riddle, enigma View this entry on the original dictionary page scan.
vipāditamfn. destroyed, killed View this entry on the original dictionary page scan.
vipāditavya mfn. to be killed, destructible View this entry on the original dictionary page scan.
vipadmamfn. deprived of a lotus-flower View this entry on the original dictionary page scan.
vipadrahitamfn. free from misfortune, prosperous View this entry on the original dictionary page scan.
vipaduddhāram. extrication from misfortune View this entry on the original dictionary page scan.
vipaduddharaṇan. extrication from misfortune View this entry on the original dictionary page scan.
vipadumaka(?) n. a dead body gnawed by worms View this entry on the original dictionary page scan.
vipādyamfn. to be killed, destructible View this entry on the original dictionary page scan.
vipadyuktamfn. attended with misfortune, unfortunate View this entry on the original dictionary page scan.
vipākamf(ā-)n. ripe, mature View this entry on the original dictionary page scan.
vipākam. cooking, dressing (equals pacana-) View this entry on the original dictionary page scan.
vipākam. ripening, maturing (especially of the fruit of actions), effect, result, consequence (of actions in the present or former births pursuing those who commit them through subsequent existences) etc. View this entry on the original dictionary page scan.
vipākam. maturing of food (in the stomach), digestion conversion of food into a state for assimilation View this entry on the original dictionary page scan.
vipākam. bad digestion View this entry on the original dictionary page scan.
vipākam. any change of form or state View this entry on the original dictionary page scan.
vipākam. calamity, distress, misfortune View this entry on the original dictionary page scan.
vipākam. withering, fading View this entry on the original dictionary page scan.
vipākam. "sweat"or"flavour" (sveda-or svāda-) View this entry on the original dictionary page scan.
vipākam. (in the beginning of a compound) subsequently, afterwards (See compound) View this entry on the original dictionary page scan.
vipāka vi-pākin- See under vi-pac-, p.973. View this entry on the original dictionary page scan.
vipākadāruṇamfn. terrible or dangerous in results View this entry on the original dictionary page scan.
vipākadoṣam. morbid affection of the digestive powers View this entry on the original dictionary page scan.
vipākakālam. the time of ripening or maturing View this entry on the original dictionary page scan.
vipākakaṭukamfn. sharp or bitter in its consequences View this entry on the original dictionary page scan.
vipākaśrutan. Name of a sacred book of the jaina-s View this entry on the original dictionary page scan.
vipākatīvramfn. sharp or terrible in consequence of (compound) View this entry on the original dictionary page scan.
vipākavisphūrjathum. the consequences (of sins committed in a former birth) compared to a thunder stroke View this entry on the original dictionary page scan.
vipākinmfn. ripening, maturing bearing fruits or having consequences, View this entry on the original dictionary page scan.
vipākinmfn. difficult to be digested (in a-vip-) View this entry on the original dictionary page scan.
vipakṣaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipakṣamfn. deprived of wings View this entry on the original dictionary page scan.
vipakṣam. "being on a different side.", an opponent, adversary, enemy (mfn."counteracting") View this entry on the original dictionary page scan.
vipakṣam. a disputant View this entry on the original dictionary page scan.
vipakṣam. a female rival View this entry on the original dictionary page scan.
vipakṣam. the day of transition from one half of a lunar month to another View this entry on the original dictionary page scan.
vipakṣam. (in gram.) an exception View this entry on the original dictionary page scan.
vipakṣam. (in logic) a counter-statement, counter-instance, argument proving the contrary (exempli gratia, 'for example'"there cannot be fire in a lake, because there is no smoke there") View this entry on the original dictionary page scan.
vipakṣabhāvam. hostile disposition, state of hostility View this entry on the original dictionary page scan.
vipakṣākrāntamfn. seized by an enemy View this entry on the original dictionary page scan.
vipakṣapātamfn. free from partisanship, impartial, indifferent
vipakṣapātam. impartiality, indifference View this entry on the original dictionary page scan.
vipakṣaramaṇīf. a female rival View this entry on the original dictionary page scan.
vipakṣas(v/i--) mfn. going on both sides (of a chariot) View this entry on the original dictionary page scan.
vipakṣaśūlam. Name of a chief of a sect called ārādhya- View this entry on the original dictionary page scan.
vipakṣatāf. hostility, enmity, opposition View this entry on the original dictionary page scan.
vipakṣatasind. from or after a rival View this entry on the original dictionary page scan.
vipakṣatasind. hostilely, inimically View this entry on the original dictionary page scan.
vipakṣatvan. hostility, enmity, opposition View this entry on the original dictionary page scan.
vipakṣayaNom. P. yati-, to make enemies (past participle vi-pakṣita-) View this entry on the original dictionary page scan.
vipakṣīkṛP. -karoti-, to deprive of wings View this entry on the original dictionary page scan.
vipakṣīyamfn. hostile, inimical View this entry on the original dictionary page scan.
vipaktavyamfn. to be cooked or boiled View this entry on the original dictionary page scan.
vipaktrimamfn. thoroughly matured, fulfilled, developed View this entry on the original dictionary page scan.
vipaktrima vi-pakva- See . View this entry on the original dictionary page scan.
vipakvamf(ā-)n. (v/i--) well cooked, well done View this entry on the original dictionary page scan.
vipakvamf(ā-)n. matured, ripe (as fruit) View this entry on the original dictionary page scan.
vipakvamf(ā-)n. fully developed, perfect View this entry on the original dictionary page scan.
vipakvamf(ā-)n. thoroughly burnt id est destroyed View this entry on the original dictionary page scan.
vipakvamf(ā-)n. not burnt (equals pāka-hīna-) () View this entry on the original dictionary page scan.
vipalan. See sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipālamfn. having no keeper or attendant, unguarded View this entry on the original dictionary page scan.
vipalan. (fr. pala-) a moment, instant, 1/6 or 1/10 of a breathing, siddhānta-s. View this entry on the original dictionary page scan.
vipalāśamfn. leafless View this entry on the original dictionary page scan.
vipalāśa vi-pavana- etc. See . View this entry on the original dictionary page scan.
vipalāy (fr. palā- equals parā-+ ay-=5. i-;only imperfect tense vy-apalāyata-), to run away in different directions View this entry on the original dictionary page scan.
vipalāyanan. running away or asunder View this entry on the original dictionary page scan.
vipalāyinmfn. running away, fleeing View this entry on the original dictionary page scan.
vipalāyitamfn. run away, routed, put to flight View this entry on the original dictionary page scan.
vipalyaṅg(paly- equals pari-;only Causal vi-palyāṅgayanta-), to envelop, surround View this entry on the original dictionary page scan.
vipalyay(paly- equals pari+ay- equals i-) A1. -ayate-, to go back, turn round, return View this entry on the original dictionary page scan.
vipāṃsulamf(ā-)n. free from dust, dustless View this entry on the original dictionary page scan.
vipaṇP. -paṇati-, to sell ; A1. -paṇate-, to bet, wager for (genitive case) View this entry on the original dictionary page scan.
vipan(only 1. plural proper Passive voice -panyāmahe-), to pride one's self, boast View this entry on the original dictionary page scan.
vipaṇam. (for 2.See vi-paṇ-) low or petty traffic View this entry on the original dictionary page scan.
vipaṇam. (for 1.See) selling, sale etc. View this entry on the original dictionary page scan.
vipaṇam. a wager View this entry on the original dictionary page scan.
vipaṇam. a trading-place, shop, market-place View this entry on the original dictionary page scan.
vipaṇam. "market" (figuratively applied to speech, the organ of speech, or the energy of activity) View this entry on the original dictionary page scan.
vipaṇam. Name of śiva- (equals nirvyavahāra-or daṇḍādi-rahita-) View this entry on the original dictionary page scan.
vipānan. drinking up View this entry on the original dictionary page scan.
vipaṇanan. selling, traffic View this entry on the original dictionary page scan.
vipaṇāpaṇavatmfn. furnished with shops and markets View this entry on the original dictionary page scan.
vipañcanaka m. a soothsayer View this entry on the original dictionary page scan.
vipañcayaP. -pañcayati-, to divulge, proclaim (see pra-pañcaya-). View this entry on the original dictionary page scan.
vipañcīf. the Indian lute (in fine compositi or 'at the end of a compound' (cīka-) mfn. ) View this entry on the original dictionary page scan.
vipañcīf. sport, amusement View this entry on the original dictionary page scan.
vipañcikāf. equals next View this entry on the original dictionary page scan.
vipañcikāf. Name of work View this entry on the original dictionary page scan.
vipañcikam. a soothsayer View this entry on the original dictionary page scan.
vipañcikā vi-patāka- etc. See . View this entry on the original dictionary page scan.
vipāṇḍava wrong reading for -pāṇḍura- View this entry on the original dictionary page scan.
vipāṇḍumfn. pale, pallid ( vipāṇḍutā -- f.) View this entry on the original dictionary page scan.
vipāṇḍumfn. painted with different yellow colours View this entry on the original dictionary page scan.
vipāṇḍuramf(ā-)n. pale, pallid View this entry on the original dictionary page scan.
vipāṇḍutāf. vipāṇḍu
vipaṇif. sale, traffic View this entry on the original dictionary page scan.
vipaṇif. a place where things are sold, shop, stall, fair, market-place etc. (alsof(ī-).) View this entry on the original dictionary page scan.
vipaṇif. any article or commodity for sale View this entry on the original dictionary page scan.
vipaṇif. a street of shops View this entry on the original dictionary page scan.
vipaṇigatamfn. being on the market View this entry on the original dictionary page scan.
vipaṇijīvif. subsistence by traffic View this entry on the original dictionary page scan.
vipaṇijīvinmfn. subsisting by traffic View this entry on the original dictionary page scan.
vipaṇimadhyagamfn. being in the midst of a market View this entry on the original dictionary page scan.
vipaṇinm. a trader, shopkeeper, merchant View this entry on the original dictionary page scan.
vipaṇipatham. a shop-street View this entry on the original dictionary page scan.
vipaṇisthapaṇyamfn. (a town) containing commodities exposed for sale View this entry on the original dictionary page scan.
vipannamfn. gone wrong, failed, miscarried (opp. to sam-panna-) View this entry on the original dictionary page scan.
vipannamfn. afflicted, distressed View this entry on the original dictionary page scan.
vipannamfn. ruined, destroyed, decayed, dead, gone etc. View this entry on the original dictionary page scan.
vipannam. a snake View this entry on the original dictionary page scan.
vipannadehamfn. "having a decomposed body", dead, defunct View this entry on the original dictionary page scan.
vipannadīdhitimfn. one whose splendour or glory is gone. View this entry on the original dictionary page scan.
vipannagamfn. destitute of serpents View this entry on the original dictionary page scan.
vipannakamfn. unfortunate, dead, destroyed View this entry on the original dictionary page scan.
vipannakṛtyamfn. (a deity) whose rites have been disturbed or neglected View this entry on the original dictionary page scan.
vipannāpatyāf. a woman who has lost her child by abortion View this entry on the original dictionary page scan.
vipannārthamfn. one whose property or fortune is ruined (varia lectio nnātman-). View this entry on the original dictionary page scan.
vipannatāf. misfortune, ruin, destruction (-tāṃgataḥ-,ruined ) View this entry on the original dictionary page scan.
vipanyā ind. joyfully, wonderfully View this entry on the original dictionary page scan.
vipanyayāind. joyfully, wonderfully View this entry on the original dictionary page scan.
vipanyumfn. praising, admiring, rejoicing, exulting View this entry on the original dictionary page scan.
vipanyumfn. wonderful, admirable (said of the aśvin-s and marut-s) View this entry on the original dictionary page scan.
vipāpamf(ā-)n. faultless, sinless View this entry on the original dictionary page scan.
vipāpāf. Name of various rivers View this entry on the original dictionary page scan.
vipāpa vi-pāpman- etc. See p.951. View this entry on the original dictionary page scan.
vipāpmanmfn. (v/i--) equals prec. etc. View this entry on the original dictionary page scan.
vipāpmanmfn. free from suffering View this entry on the original dictionary page scan.
vipāpmanm. Name of a being reckoned among the viśve- devāḥ- View this entry on the original dictionary page scan.
viparākramamfn. destitute of courage or energy View this entry on the original dictionary page scan.
vipare( -parā-i-;only imperative -p/aretana-), to go back again, return View this entry on the original dictionary page scan.
viparī( -pari-i-) P. -pary-eti-, to turn round or back, return ; to turn out badly or wrongly, fail, View this entry on the original dictionary page scan.
viparibhraṃśam. ( bhraṃś-) failure, miscarriage View this entry on the original dictionary page scan.
viparibhraṃśam. (in fine compositi or 'at the end of a compound') being deprived of, loss View this entry on the original dictionary page scan.
viparicchinnamfn. ( chid-) cut off on all sides, utterly destroyed View this entry on the original dictionary page scan.
viparicchinnamūlamfn. having the roots cut completely round or off, entirely uprooted View this entry on the original dictionary page scan.
viparidhāA1. -dhatte-, to exchange, alter ; (ind.p. -dhāya-,with or scilicet vāsas-,having shifted one's clothes) View this entry on the original dictionary page scan.
viparidhānan. change, exchange View this entry on the original dictionary page scan.
viparidhāvP. -dhāvati-, to run about or through, overrun View this entry on the original dictionary page scan.
viparidhāvakamfn. running about or in all directions View this entry on the original dictionary page scan.
viparidruP. -dravati-, to run round about View this entry on the original dictionary page scan.
viparigāP. -jigāti-, to go over, be upset (as a cart) View this entry on the original dictionary page scan.
viparihāram. idem or 'n. transposition, exchange ' View this entry on the original dictionary page scan.
vipariharaṇan. transposition, exchange View this entry on the original dictionary page scan.
viparihṛP. A1. -harati-, te-, to transpose, exchange View this entry on the original dictionary page scan.
viparikramP. A1. -krāmati-, -kramate-, to step or walk round, circumambulate View this entry on the original dictionary page scan.
viparikrāmamind. having walked round, going all about View this entry on the original dictionary page scan.
viparikrāntamfn. one who has shown valour (in battle), courageous, powerful View this entry on the original dictionary page scan.
vipariluparilopam. destruction, loss, ruin View this entry on the original dictionary page scan.
vipariluptamfn. ( lup-) broken or destroyed utterly, broken up View this entry on the original dictionary page scan.
viparimlānamfn. ( mlai-) entirely faded or withered View this entry on the original dictionary page scan.
viparimuc Passive voice -mucyate-, to be freed or released from (ablative) View this entry on the original dictionary page scan.
vipariṇam( nam-) Passive voice -ṇamyate- to undergo change or alteration, be changed into (instrumental case) : Causal -ṇamayati-, to alter, change into (instrumental case)
vipariṇāmam. change, exchange, transformation etc. View this entry on the original dictionary page scan.
vipariṇāmam. ripening, maturing View this entry on the original dictionary page scan.
vipariṇamanan. changing, change, alteration View this entry on the original dictionary page scan.
vipariṇamayitavyamfn. to be changed or altered View this entry on the original dictionary page scan.
vipariṇāminmfn. undergoing a change of state or form, turning into (instrumental case) on View this entry on the original dictionary page scan.
vipariṇatamfn. altered, changed View this entry on the original dictionary page scan.
vipariṇītamfn. ( -) having one's place changed for that of another View this entry on the original dictionary page scan.
viparipatP. -patati-, to fly round or back View this entry on the original dictionary page scan.
viparītamfn. turned round, reversed, inverted etc. View this entry on the original dictionary page scan.
viparītamfn. being the reverse of anything, acting in a contrary manner, opposite, contrary to (ablative) etc. View this entry on the original dictionary page scan.
viparītamfn. going asunder or in different directions, various, different View this entry on the original dictionary page scan.
viparītamfn. perverse, wrong, contrary to rule etc. View this entry on the original dictionary page scan.
viparītamfn. adverse, inauspicious, unfavourable View this entry on the original dictionary page scan.
viparītamfn. false, untrue View this entry on the original dictionary page scan.
viparītāf. a perverse or unchaste woman View this entry on the original dictionary page scan.
viparītāf. Name of two metres View this entry on the original dictionary page scan.
viparītabodhamfn. () equals -citta- View this entry on the original dictionary page scan.
viparītabuddhimfn. () equals -citta- View this entry on the original dictionary page scan.
viparītacetasmfn. () contrary-minded, having a perverted mind or impaired mental faculties View this entry on the original dictionary page scan.
viparītacittamfn. () contrary-minded, having a perverted mind or impaired mental faculties View this entry on the original dictionary page scan.
viparītādin. (with vakra-) a kind of metre
viparītagatimfn. going backwards or in a reverse direction View this entry on the original dictionary page scan.
viparītagatif. inverse or reverse motion View this entry on the original dictionary page scan.
viparītagrahaprakaraṇan. Name of. work View this entry on the original dictionary page scan.
viparītakamfn. reversed, inverted View this entry on the original dictionary page scan.
viparītakam. (with bandha-) inverted coitus View this entry on the original dictionary page scan.
viparītakaramfn. acting in a contrary manner or perversely View this entry on the original dictionary page scan.
viparītakārinmfn. idem or 'mfn. acting in a contrary manner or perversely ' View this entry on the original dictionary page scan.
viparītakartṛmfn. acting in a contrary manner or perversely View this entry on the original dictionary page scan.
viparītākhyānakīf. "inverted ākhyānakī-", a kind of metre View this entry on the original dictionary page scan.
viparītakrīḍāf. Name of a chapter of View this entry on the original dictionary page scan.
viparītalakṣaṇāf. ironical description of an object by mentioning its contrary properties View this entry on the original dictionary page scan.
viparītamallatailan. a kind of preparation made of oil View this entry on the original dictionary page scan.
viparītamatimfn. () equals -citta- View this entry on the original dictionary page scan.
viparītāntam. (with pragātha-) a kind of metre View this entry on the original dictionary page scan.
viparitap Passive voice -tapyate-, to be greatly distressed, suffer great pain View this entry on the original dictionary page scan.
viparītapathyāf. a kind of metre View this entry on the original dictionary page scan.
viparītapratyaṅgirāf. Name of a Tantric work View this entry on the original dictionary page scan.
viparītaratan. inverted sexual intercourse View this entry on the original dictionary page scan.
viparītatāf. contrariety, inversion, counterpart View this entry on the original dictionary page scan.
viparītatvan. contrariety, inversion, counterpart View this entry on the original dictionary page scan.
viparītavatind. invertedly View this entry on the original dictionary page scan.
viparītavṛttimfn. acting or behaving in a contrary manner View this entry on the original dictionary page scan.
viparītāyanan. a contrary ayana- or progress of the sun from solstice to solstice ( viparītāyanagata -gata- mfn.situated in contrary ayana-s) View this entry on the original dictionary page scan.
viparītāyanagatamfn. viparītāyana
viparītottaran. (with pragātha-) a kind of metre View this entry on the original dictionary page scan.
viparivartanamf(ī-)n. causing to turn round or to return View this entry on the original dictionary page scan.
viparivartanan. turning round View this entry on the original dictionary page scan.
viparivartanan. rolling about, wallowing View this entry on the original dictionary page scan.
viparivartanīf. (with or scilicet vidyā-) a particular magical formula supposed to be efficacious in causing the return of an absent person View this entry on the original dictionary page scan.
viparivartitamfn. (fr. Causal) turned away View this entry on the original dictionary page scan.
viparivartitādharamfn. having the lips turned away View this entry on the original dictionary page scan.
viparivatsaram. a year View this entry on the original dictionary page scan.
viparivṛtA1. -vartate-, to turn round, revolve ; to roll (on the ground) ; to move about, roam, wander ; etc. ; to turn round or back, return ; to be transformed, change, alter ; to visit or afflict continually : Causal -vartayati-, to cause to turn round or revolve, turn round or away View this entry on the original dictionary page scan.
viparivṛttif. turning round or back, return View this entry on the original dictionary page scan.
viparṇa(prob.) wrong reading for dvi-p-,"two-leaved" View this entry on the original dictionary page scan.
viparṇakam. the palāśa- tree, Butea Frondosa View this entry on the original dictionary page scan.
vipārśva(only instrumental case) close by View this entry on the original dictionary page scan.
viparus(v/i--) mfn. without knots or joints View this entry on the original dictionary page scan.
viparva(v/i--) mfn. without joints or vulnerable points View this entry on the original dictionary page scan.
viparvan(v/i--) mfn. idem or '(v/i--) mfn. without joints or vulnerable points ' (used to explain the prec.) View this entry on the original dictionary page scan.
viparyam. or n. (?) a particular high number View this entry on the original dictionary page scan.
viparyakind. (fr. -paryañc-) invertedly View this entry on the original dictionary page scan.
viparyāṇamfn. unsaddled View this entry on the original dictionary page scan.
viparyāṇīkṛtamfn. idem or 'mfn. unsaddled ' View this entry on the original dictionary page scan.
viparyasA1. -asyate-, to turn over, turn round, overturn, reverse, invert ; to change, interchange, exchange ; to have a wrong notion, be in error : Causal -āsayati-, to cause to turn round or to change View this entry on the original dictionary page scan.
viparyāsam. overturning, overthrow, upsetting (of a car) View this entry on the original dictionary page scan.
viparyāsam. transposition, transportation View this entry on the original dictionary page scan.
viparyāsam. expiration, lapse (of time) View this entry on the original dictionary page scan.
viparyāsam. exchange, inversion, change, interchange etc. View this entry on the original dictionary page scan.
viparyāsam. reverse, contrariety, opposition, opposite of (exempli gratia, 'for example' stuti-v-,the opposite of praise id est blame) etc. View this entry on the original dictionary page scan.
viparyāsam. change for the worse, deterioration View this entry on the original dictionary page scan.
viparyāsam. death View this entry on the original dictionary page scan.
viparyāsam. perverseness View this entry on the original dictionary page scan.
viparyāsam. error, mistake, delusion, imagining what is unreal or false to be real or true View this entry on the original dictionary page scan.
viparyāsamind. alternately View this entry on the original dictionary page scan.
viparyāsopamāf. an inverted comparison (in which the relation between the upamāna- and upameya- is inverted) View this entry on the original dictionary page scan.
viparyastamfn. turned over, reversed, opposite, contrary etc. View this entry on the original dictionary page scan.
viparyastamfn. (in gram.) interchanged, inverted View this entry on the original dictionary page scan.
viparyastamfn. standing round View this entry on the original dictionary page scan.
viparyastamfn. erroneously conceived to be real View this entry on the original dictionary page scan.
viparyastamanaśceṣṭamfn. having mind and actions perverted or inverted View this entry on the original dictionary page scan.
viparyastaputrāf. a woman bearing no male children View this entry on the original dictionary page scan.
viparyastatāf. perverseness View this entry on the original dictionary page scan.
viparyāvṛtA1. -vartate-, to be turned back : Causal -vartayati-, to cause to turn away from, cause to be overturned View this entry on the original dictionary page scan.
viparyayamfn. reversed, inverted, perverse, contrary to (genitive case) View this entry on the original dictionary page scan.
viparyayam. turning round, revolution View this entry on the original dictionary page scan.
viparyayam. running off, coming to an end View this entry on the original dictionary page scan.
viparyayam. transposition, change, alteration, inverted order or succession, opposite of. etc. (exempli gratia, 'for example' buddhi-v-,the opposite opinion; svapna-v-,the opp of sleep, state of being awake; saṃdhi-viparyayau-,peace and its opposite id est war; viparyayaye yaye- ind., viparyayena yena- ind.and viparyayāt yāt- ind.in the opposite case, other wise) View this entry on the original dictionary page scan.
viparyayam. exchange, barter (exempli gratia, 'for example' dravya-v-,exchange of goods, buying and selling, trade) View this entry on the original dictionary page scan.
viparyayam. change for the worse, reverse of fortune, calamity, misfortune etc. View this entry on the original dictionary page scan.
viparyayam. perverseness View this entry on the original dictionary page scan.
viparyayam. overthrow, min, loss, destruction (especially of the world) View this entry on the original dictionary page scan.
viparyayam. change of opinion View this entry on the original dictionary page scan.
viparyayam. change of purpose or conduct, enmity, hostility View this entry on the original dictionary page scan.
viparyayam. misapprehension, error, mistake View this entry on the original dictionary page scan.
viparyayam. mistaking anything to be the reverse or opposite of what it is View this entry on the original dictionary page scan.
viparyayam. shunning, avoiding (Scholiast or Commentator) View this entry on the original dictionary page scan.
viparyayam. Name of particular forms of intermittent fever View this entry on the original dictionary page scan.
viparyāyam. equals vi-paryaya-, reverse, contrariety View this entry on the original dictionary page scan.
viparyayātind. viparyaya
viparyayayeind. viparyaya
viparyayenaind. viparyaya
viparyūhP. -ūhati-, to place or fix separately View this entry on the original dictionary page scan.
vipāś See sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipaśin compound for vipas-. View this entry on the original dictionary page scan.
vipaśP. -paśyati- (rarely te-), to see in different places or in detail, discern, distinguish ; to observe, perceive, learn, know
vipasn. inspiration (see vipaś-- ci- etc., parasmE-pada 972, col, 3). View this entry on the original dictionary page scan.
vipāśf. (Nominal verb -pāṭ-) "fetterless" (see next) , the vipāś- or vipāśā- river (See below) (in fine compositi or 'at the end of a compound' ind(śam-). gaRa śarad-ādi-) View this entry on the original dictionary page scan.
vipāśaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipāśamfn. having no noose View this entry on the original dictionary page scan.
vipāśamfn. unnoosed, untied, freed from fetters View this entry on the original dictionary page scan.
vipāśāf. the vipāśā- or Beas river (one of the 5 rivers of the Panjab, said to be so called as having destroyed the cord with which vasiṣṭha- had tried to hang himself through grief for his son slain by viśvāmitra-;it rises in the Kullu range of the himālaya-, and after a course of 290 miles joins the Sutlej at the southern boundary of Kapurthala;it is considered identical with the of Arrian, the Hyphasis of Pliny, and of Ptolemy) View this entry on the original dictionary page scan.
vipāśanan. unbinding, unfettering View this entry on the original dictionary page scan.
vipāśayaNom. (fr. vi-pāśa-;only Passive voice vyapāśyanta-), to unbind, loose View this entry on the original dictionary page scan.
vipaścimfn. equals next View this entry on the original dictionary page scan.
vipaści vipaś-cit- See vip-. View this entry on the original dictionary page scan.
vipaścitmfn. inspired, wise, learned, versed in or acquainted with (compound) etc. View this entry on the original dictionary page scan.
vipaścitm. Name of indra- under manu- svārociṣa- View this entry on the original dictionary page scan.
vipaścitm. of the Supreme Spirit View this entry on the original dictionary page scan.
vipaścitm. of a buddha- (prob. wrong reading for vipaśyin-) View this entry on the original dictionary page scan.
vipaścitamfn. equals prec. View this entry on the original dictionary page scan.
vipāśin(v/i-) mfn. without fastenings, without a trace (as a chariot) (;but v/ipāśi-is prob. locative case of v/i-pāś-). View this entry on the original dictionary page scan.
vipaśumfn. deprived of cattle View this entry on the original dictionary page scan.
vipaśvinm. Name of a buddha- View this entry on the original dictionary page scan.
vipaśyanan. (orf(ā-).) right knowledge View this entry on the original dictionary page scan.
vipaśyinm. Name of a buddha- (sometimes mentioned as the first of the 7 tathāgata-s or principal buddha-s, the other six being śikhin-, viśva-bhū-, kraku-cchanda-, kanaka-- muni-, kāśyapa-, and śākya-siṃha-) (see ) . View this entry on the original dictionary page scan.
vipaṭP. -pāṭayati-, to split in two, tear open, tear out, destroy etc. ; to drive asunder, scare away View this entry on the original dictionary page scan.
vipatP. -patati-, to fly or dash or rush through ; to fly apart, fall off, burst asunder, be divided or separated ; to fly along : Causal -patayati-, to fly in various directions ; to fall asunder, be opened ; -pātayati-, to cause to fly away, shoot off (arrows) ; to cause to fly asunder or off, split or strike off (a head) ; to strike down, kill View this entry on the original dictionary page scan.
vipatin compound for vi-pad- View this entry on the original dictionary page scan.
vipāṭam. a kind of arrow View this entry on the original dictionary page scan.
vipāṭam. Name of a man View this entry on the original dictionary page scan.
vipāta gaRa brāhmaṇādi-. View this entry on the original dictionary page scan.
vipatākamfn. deprived of a flag or banner View this entry on the original dictionary page scan.
vipāṭakamfn. (prob.) opening, unfolding, bringing View this entry on the original dictionary page scan.
vipātakamfn. (fr. prec.) gaRa yāvādi-. View this entry on the original dictionary page scan.
vipāṭalamfn. very red View this entry on the original dictionary page scan.
vipāṭala vi-pāṇḍu- etc. See . View this entry on the original dictionary page scan.
vipāṭanan. the act of splitting in two, tearing open View this entry on the original dictionary page scan.
vipāṭanan. eradication, destruction View this entry on the original dictionary page scan.
vipāṭanan. acute pain View this entry on the original dictionary page scan.
vipātanan. (fr. Causal) melting, liquefying View this entry on the original dictionary page scan.
vipāṭchutudrīf. dual number the river vipāśā- and śutudrī- View this entry on the original dictionary page scan.
vipaṭhP. -paṭhati-, to read through, peruse View this entry on the original dictionary page scan.
vipathaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipatham. n. a different path, wrong road, evil course
vipatham. a particular high number View this entry on the original dictionary page scan.
vipathamn. a kind of chariot (fit for untrodden paths) View this entry on the original dictionary page scan.
vipāṭham. (see vi-pāṭa-under vi-paṭ-) a kind of large arrow (described by as viśālo vaiśākhī-mukha-vat-) View this entry on the original dictionary page scan.
vipāṭhāf. Name of a woman View this entry on the original dictionary page scan.
vipathagāminmfn. going in a wrong way or evil course View this entry on the original dictionary page scan.
vipathagatif. the going in a wrong way View this entry on the original dictionary page scan.
vipathavāham. drawing a chariot called vipatha- (See above) View this entry on the original dictionary page scan.
vipathāvapātaparatāf. the inclination to go in wrong ways (or pursue evil courses) View this entry on the original dictionary page scan.
vipathayaNom. P. yati-, to lead upon the wrong way View this entry on the original dictionary page scan.
vipathayamakan. a kind of yamaka- (q.v) in which the paronomasia is only at the beginning and end of the verse (exempli gratia, 'for example' ) View this entry on the original dictionary page scan.
vipathayugan. a yoke fit for bad roads View this entry on the original dictionary page scan.
vipathimfn. (vi--) going in wrong ways View this entry on the original dictionary page scan.
vipathimfn. going on paths that spread in different directions View this entry on the original dictionary page scan.
vipāṭitamfn. split in two, torn asunder, uprooted, eradicated, destroyed etc. View this entry on the original dictionary page scan.
vipāṭitamfn. separated, divided View this entry on the original dictionary page scan.
vipatitamfn. (v/i--) flown away, fallen off etc. View this entry on the original dictionary page scan.
vipatitalomanmfn. one whose hair has fallen out View this entry on the original dictionary page scan.
vipatkālam. season of misfortune or calamity View this entry on the original dictionary page scan.
vipatkaramf(ī-)n. causing misfortune View this entry on the original dictionary page scan.
vipatkarīf. (ī-) Name of a goddess View this entry on the original dictionary page scan.
vipatman(v/i--) mfn. having the flight of (id est flying as fast as) a bird View this entry on the original dictionary page scan.
vipatman(v/i--) mfn. See under 1. vi-, p.949. View this entry on the original dictionary page scan.
vipatmanSee under 1. vi-, . View this entry on the original dictionary page scan.
vipatna(?) m. or n. a kind of disease View this entry on the original dictionary page scan.
vipatphalamfn. resulting in misfortune, calamitous View this entry on the original dictionary page scan.
vipatsāgaram. "ocean of misfortune", heavy calamity View this entry on the original dictionary page scan.
vipattif. going wrongly, adversity, misfortune, failure, disaster (opp. to sam-patt/i-) etc. View this entry on the original dictionary page scan.
vipattif. unfavourableness (of time) View this entry on the original dictionary page scan.
vipattif. ruin, destruction, death etc. View this entry on the original dictionary page scan.
vipattif. cessation, end View this entry on the original dictionary page scan.
vipattif. agony, torment (equals yātanā-) View this entry on the original dictionary page scan.
vipattikālam. a season of adversity or misfortune View this entry on the original dictionary page scan.
vipattikaramfn. causing misfortune or calamity View this entry on the original dictionary page scan.
vipattirahitamfn. free from misfortune, prosperous, happy View this entry on the original dictionary page scan.
vipattiyuktamfn. attended with misfortune, unfortunate View this entry on the original dictionary page scan.
vipavanamf(ā-)n. windless View this entry on the original dictionary page scan.
vipavyaSee vi--, p.975. View this entry on the original dictionary page scan.
vipavyamfn. to be thoroughly cleansed or purified View this entry on the original dictionary page scan.
vipayasmfn. destitute of water, waterless View this entry on the original dictionary page scan.
viphamfn. without the sound or letter pha- View this entry on the original dictionary page scan.
viphal(only perfect tense -paphāla-,3. plural -phelire-, varia lectio -pecire-), to burst or split asunder ; to bear or produce fruit, become fruitful (Calcutta edition) . View this entry on the original dictionary page scan.
viphalaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
viphalamf(ā-)n. bearing no fruit (as a tree) View this entry on the original dictionary page scan.
viphalamf(ā-)n. fruitless, useless, ineffectual, futile, vain, idle etc. View this entry on the original dictionary page scan.
viphalamf(ā-)n. having no testicles View this entry on the original dictionary page scan.
viphalam. Pandanus Odoratissimus View this entry on the original dictionary page scan.
viphalapreraṇamfn. flung in vain View this entry on the original dictionary page scan.
viphalārambhamfn. one whose efforts are vain or idle View this entry on the original dictionary page scan.
viphalāśamfn. one whose hopes are disappointed (varia lectio niṣphal-). View this entry on the original dictionary page scan.
viphalaśramamfn. exerting one's self in vain ( viphalaśramatva -tva- n.), View this entry on the original dictionary page scan.
viphalaśramatvan. viphalaśrama
viphalatāf. fruitlessness, uselessness, unprofitableness View this entry on the original dictionary page scan.
viphalatvan. fruitlessness, uselessness, unprofitableness View this entry on the original dictionary page scan.
viphalayaNom. P. yati-, to render fruitless, frustrate, disappoint, prevent any one (genitive case) from (infinitive mood) View this entry on the original dictionary page scan.
viphalīin compound for vi-phala-. View this entry on the original dictionary page scan.
viphalībhaviṣṇumfn. becoming or become useless or unprofitable ( viphalībhaviṣṇutā -- f. viphalībhaviṣṇutva -tva- n.) View this entry on the original dictionary page scan.
viphalībhaviṣṇutāf. viphalībhaviṣṇu
viphalībhaviṣṇutvan. viphalībhaviṣṇu
viphalībhūP. -bhavati-, to become useless, be unprofitable View this entry on the original dictionary page scan.
viphalībhūtamfn. become useless View this entry on the original dictionary page scan.
viphalīkaraṇan. making fruitless, frustrating, foiling, defeating View this entry on the original dictionary page scan.
viphalīkaraṇan. doing anything in vain View this entry on the original dictionary page scan.
viphalīkṛP. A1. -karoti-, -kurute-, to make fruitless or useless, frustrate, thwart, foil ; to emasculate View this entry on the original dictionary page scan.
viphalīkṛtamfn. rendered fruitless, frustrated View this entry on the original dictionary page scan.
viphalīkṛtamfn. done in vain ( viphalīkṛtayatna ta-yatna- mfn.making fruitless efforts ) View this entry on the original dictionary page scan.
viphalīkṛtayatnamfn. viphalīkṛta
viphalphamfn. (see vi-gulpha-) abundant, plentiful (?w.r. for vi-phalka-). View this entry on the original dictionary page scan.
viphāṇṭamf(ā-)n. decocted or distilled with (compound) View this entry on the original dictionary page scan.
vipīḍamind. without harm or injury View this entry on the original dictionary page scan.
vipinan. "stirring or waving (scilicet in the wind)", a wood, forest, thicket, grove etc. View this entry on the original dictionary page scan.
vipinan. a multitude, quantity View this entry on the original dictionary page scan.
vipinatilakan. a kind of metre View this entry on the original dictionary page scan.
vipinaukasm. "wood-dweller", an ape, monkey View this entry on the original dictionary page scan.
vipināyaNom. A1. yate-, to become or be like a forest View this entry on the original dictionary page scan.
vipipānamfn. one who drinks much or variously View this entry on the original dictionary page scan.
vipiśP. -piṃśati- equals vi-puṣyati- View this entry on the original dictionary page scan.
vipiśitamfn. equals vi-kasita-, or vinihita-, placed or laid on (as an ornament) View this entry on the original dictionary page scan.
vipiṣṭīSee vi-pṛṣṭhī-, p.951. View this entry on the original dictionary page scan.
vipītamfn. drunk up View this entry on the original dictionary page scan.
vipītavatmfn. one who has drunk up View this entry on the original dictionary page scan.
viplavamfn. (for 2.See vi-plu-) having no ship or boat View this entry on the original dictionary page scan.
viplavam. (for 1.See) confusion, trouble, disaster, evil, calamity, misery, distress etc. View this entry on the original dictionary page scan.
viplavam. tumult, affray, revolt View this entry on the original dictionary page scan.
viplavam. destruction, ruin etc. View this entry on the original dictionary page scan.
viplavam. loss, damage View this entry on the original dictionary page scan.
viplavam. violation (of a woman) View this entry on the original dictionary page scan.
viplavam. profanation of the veda- by unseasonable study View this entry on the original dictionary page scan.
viplavam. shipwreck View this entry on the original dictionary page scan.
viplavam. rust (on a mirror) View this entry on the original dictionary page scan.
viplavam. portent, evil omen View this entry on the original dictionary page scan.
viplavam. terrifying an enemy by shouts and gestures View this entry on the original dictionary page scan.
viplavam. spreading abroad, divulging (vaṃ-gam-,to become widely known) View this entry on the original dictionary page scan.
viplavamfn. confused (as words) View this entry on the original dictionary page scan.
viplāvam. a horse's canter or gallop View this entry on the original dictionary page scan.
viplāvam. deluging View this entry on the original dictionary page scan.
viplāvam. devastating View this entry on the original dictionary page scan.
viplāvam. causing tumult or public disturbance View this entry on the original dictionary page scan.
viplāvaka() mfn. spreading abroad, divulging. View this entry on the original dictionary page scan.
viplāvanan. abusing, reviling View this entry on the original dictionary page scan.
viplavatasind. in consequence of misfortune
viplavāṭṭahāsam. malicious laughter View this entry on the original dictionary page scan.
viplavinmfn. fugitive, transitory View this entry on the original dictionary page scan.
viplāvin() mfn. spreading abroad, divulging. View this entry on the original dictionary page scan.
viplāvitamfn. (fr. Causal) made to float or drift about, divulged, confused, etc. View this entry on the original dictionary page scan.
viplāvitamfn. confounded, ruined, lost View this entry on the original dictionary page scan.
vipluA1. -plavate- (mc. also P.), to float asunder, drift about, be dispersed or scattered ; to fall into disorder or confusion, go astray, be lost or ruined, perish etc.: Causal -plāvayati-, to cause to swim or float about ; to spread abroad, make known, divulge ; to bring to ruin or calamity, waste, destroy ; (-plav-), to perplex, confuse, confound View this entry on the original dictionary page scan.
vipluṣm. f. = vi-pruṣ-2, a drop of water View this entry on the original dictionary page scan.
vipluṣm. plural drops falling from the mouth while speaking View this entry on the original dictionary page scan.
vipluṣṭamfn. ( pluṣ-) burned, scorched View this entry on the original dictionary page scan.
viplutamfn. drifted apart or asunder, scattered, dispersed etc. View this entry on the original dictionary page scan.
viplutamfn. confused, disordered, gone astray, lost, perished etc. View this entry on the original dictionary page scan.
viplutamfn. suffused, dimmed (as the eyes) View this entry on the original dictionary page scan.
viplutamfn. agitated, excited, troubled (as speech or reason) View this entry on the original dictionary page scan.
viplutamfn. broken, violated (as chastity, a vow etc.) View this entry on the original dictionary page scan.
viplutamfn. vicious, immoral View this entry on the original dictionary page scan.
viplutamfn. committing adultery with (saha-) View this entry on the original dictionary page scan.
viplutamfn. (with karmaṇā-) wrongly treated, mismanaged (in med.) View this entry on the original dictionary page scan.
viplutamfn. (with plava-) drawn out of the water, landed (?) View this entry on the original dictionary page scan.
viplutamfn. depraved, wicked View this entry on the original dictionary page scan.
viplutamfn. contrary, adverse View this entry on the original dictionary page scan.
viplutamfn. inundated, immersed View this entry on the original dictionary page scan.
viplutan. springing or bursting asunder View this entry on the original dictionary page scan.
viplutabhāṣinmf(iṇī-)n. speaking confusedly, stammering, stuttering View this entry on the original dictionary page scan.
viplutalocanamfn. having the eyes suffused or bathed (with tears, joy etc.) View this entry on the original dictionary page scan.
viplutanetramfn. having the eyes suffused or bathed (with tears, joy etc.) View this entry on the original dictionary page scan.
viplutayonif. (in med.) a particular painful condition of the vagina- View this entry on the original dictionary page scan.
viplutif. destruction, ruin, loss View this entry on the original dictionary page scan.
vipodhāmfn. (fr. vipas-+ dhā-) bestowing inspiration View this entry on the original dictionary page scan.
vipodhāSee vip-, p.972. View this entry on the original dictionary page scan.
vipothitamfn. crushed, shattered View this entry on the original dictionary page scan.
vipramf(ā-)n. stirred or excited (inwardly), inspired, wise (said of men and gods, especially of agni-, indra-, the aśvin-s, marut-s etc.; see paṇḍita-)
vipramf(ā-)n. learned (especially in theology) View this entry on the original dictionary page scan.
vipramf(ā-)n. a sage, seer, singer, poet, learned theologian View this entry on the original dictionary page scan.
vipramf(ā-)n. a Brahman (ā- f.a Brahman woman) etc. View this entry on the original dictionary page scan.
vipramf(ā-)n. a priest, domestic priest View this entry on the original dictionary page scan.
vipramf(ā-)n. the moon View this entry on the original dictionary page scan.
vipramf(ā-)n. the month bhādrapada- View this entry on the original dictionary page scan.
vipramf(ā-)n. Ficus Religiosa View this entry on the original dictionary page scan.
vipramf(ā-)n. Acacia Sirissa View this entry on the original dictionary page scan.
vipramf(ā-)n. (in prosody) a proceleusmatic View this entry on the original dictionary page scan.
vipramf(ā-)n. Name of a son of ślīṣṭi- (varia lectio ripra-) View this entry on the original dictionary page scan.
vipramf(ā-)n. of a son of śrutaṃ-jaya- (or śṛtaṃ-jaya-) View this entry on the original dictionary page scan.
vipramf(ā-)n. of a son of dhruva- View this entry on the original dictionary page scan.
vipramf(ā-)n. plural a class of demi-gods (mentioned with the sādhya-s, yakṣa-s and rākṣasa-s) View this entry on the original dictionary page scan.
viprā(only 2. sg. perfect tense -papr/ātha-), to fill completely View this entry on the original dictionary page scan.
viprabandhum. "Brahman's friend", Name of the author of (having the patronymic gaupāyana- or laupāyana-) View this entry on the original dictionary page scan.
viprabhāvam. the rank or dignity of a Brahman View this entry on the original dictionary page scan.
viprabodhitamfn. (fr. Causal) mentioned, discussed View this entry on the original dictionary page scan.
viprabuddhamfn. ( budh-) awakened, awake View this entry on the original dictionary page scan.
vipracchannamfn. ( chad-) concealed, hidden, secret View this entry on the original dictionary page scan.
viprachP. -pṛcchati- (rarely te-;Ved. infinitive mood -p/ṛccham-), to ask various questions, make various inquiries View this entry on the original dictionary page scan.
vipracint(only ind.p. -cintya-), to meditate on, think about View this entry on the original dictionary page scan.
vipracitm. Name of a dānava- (father of rāhu-) (see -citti-). View this entry on the original dictionary page scan.
vipracita gaRa sutaṃ-gamādi-. View this entry on the original dictionary page scan.
vipracitta wrong reading for next. View this entry on the original dictionary page scan.
vipracittimfn. (v/ipra--) sagacious View this entry on the original dictionary page scan.
vipracittim. Name of a preceptor View this entry on the original dictionary page scan.
vipracittim. of a dānava- (father of rāhu-) etc. (see -cit-) View this entry on the original dictionary page scan.
vipracittif. Name of an apsaras- View this entry on the original dictionary page scan.
vipracūdāmaṇim. "Brahman-jewel", an excellent Brahman View this entry on the original dictionary page scan.
vipradaham. (possibly vi-+ pra-+ daha-) dried fruit or roots etc. View this entry on the original dictionary page scan.
vipradamanam. "Brahman-tamer", Name of a man (in a farce) View this entry on the original dictionary page scan.
vipradevam. Name of a prince View this entry on the original dictionary page scan.
vipradevam. of a chief of the bhāgavata-s View this entry on the original dictionary page scan.
vipradharṣam. ( dhṛṣ-) harassing, annoyance (in ati-v-) View this entry on the original dictionary page scan.
vipradhāvP. -dhāvati-, to run in different directions View this entry on the original dictionary page scan.
viprādhipam. the moon View this entry on the original dictionary page scan.
viprādhipamukhāf. a moon-faced woman View this entry on the original dictionary page scan.
vipradruP. -dravati-, to run asunder or away, disperse, flee View this entry on the original dictionary page scan.
vipradrutamfn. fled, escaped View this entry on the original dictionary page scan.
vipraduhP. -dogdhi- (see pravi-duh-), to milk out, drain, exploit ("to take") . View this entry on the original dictionary page scan.
vipraduṣṭamfn. ( duṣ-) very corrupt or corrupted, very sensual or dissolute, very bad View this entry on the original dictionary page scan.
vipraduṣṭabhāvamfn. having a very wicked or vicious disposition View this entry on the original dictionary page scan.
vipragam -gacchati-, to go apart or asunder, be dispersed or scattered View this entry on the original dictionary page scan.
vipragītamfn. ( gai-) that about which opinions differ, not agreed upon View this entry on the original dictionary page scan.
viprahāP. -jahāti-, to give up, abandon View this entry on the original dictionary page scan.
viprahāṇan. disappearance, cessation View this entry on the original dictionary page scan.
viprahatamfn. ( han-) struck down, beaten, defeated (as an army) View this entry on the original dictionary page scan.
viprahatamfn. trodden (See a-v-). View this entry on the original dictionary page scan.
viprahīṇamfn. (also written hīna-) excluded from (ablative) View this entry on the original dictionary page scan.
viprahīṇamfn. disappeared, vanished, gone View this entry on the original dictionary page scan.
viprahīṇamfn. deprived or destitute of, without, lacking (instrumental case) View this entry on the original dictionary page scan.
viprajanam. a Brahman or a priest (also collectively) View this entry on the original dictionary page scan.
viprajanam. Name of a man (with the patronymic saurāki-), View this entry on the original dictionary page scan.
viprajittim. Name of a preceptor (see vipra-citti-). View this entry on the original dictionary page scan.
viprajūta(v/ipra--) mfn. impelled or urged by the wise View this entry on the original dictionary page scan.
viprajūtim. Name of a man (with the patronymic vātaraśana-, author of ) View this entry on the original dictionary page scan.
viprakam. a contemptible Brahman View this entry on the original dictionary page scan.
viprakanyāf. a Brahman girl View this entry on the original dictionary page scan.
viprakāram. treating with disrespect, hurt, injury, wickedness etc. View this entry on the original dictionary page scan.
viprakāram. retaliation View this entry on the original dictionary page scan.
viprakāram. various manner (rather fr. vi-pra-kṝ-). View this entry on the original dictionary page scan.
viprakārinmfn. treating with contempt, opposing, retaliating View this entry on the original dictionary page scan.
viprakarṣam. dragging away, carrying off View this entry on the original dictionary page scan.
viprakarṣam. remoteness, distance (in space or time) View this entry on the original dictionary page scan.
viprakarṣam. difference, contrast View this entry on the original dictionary page scan.
viprakarṣam. (in gram.) the separation of two consonants by the insertion of a vowel. View this entry on the original dictionary page scan.
viprakartṛmfn. injuring an injurer, offender View this entry on the original dictionary page scan.
viprakāśamfn. (in fine compositi or 'at the end of a compound') equals prakāśa-, resembling, similar to View this entry on the original dictionary page scan.
viprakāṣṭhan. Thespesia Populneoides View this entry on the original dictionary page scan.
viprakīrṇamfn. ( kṝ--) scattered or thrown about, dispersed, dashed to pieces etc. View this entry on the original dictionary page scan.
viprakīrṇamfn. dishevelled, loose (See compound), extended, wide, spacious View this entry on the original dictionary page scan.
viprakīrṇaikapārśvamfn. having one side stretched out (varia lectio for saṃ-ni-kīrṇ-). View this entry on the original dictionary page scan.
viprakīrṇaśiroruhamfn. having dishevelled or flowing hair View this entry on the original dictionary page scan.
viprakḷptif. ( kḷp-) separate or special arrangement or preparation
viprakṛP. -karoti-, to treat with disrespect, hurt, injure, offend, oppress etc. ; to appoint, admit (sākṣye-,as a witness) (prob. wrong reading for adhi-kṛ-): Passive voice of Causal -kāryate-, to be slighted or injured or treated disrespectfully View this entry on the original dictionary page scan.
viprakṛṣP. -karṣati-, to drag or draw apart, lead away or home ; to remove from (ablative) View this entry on the original dictionary page scan.
viprakṛṣṭamfn. dragged or drawn apart etc. View this entry on the original dictionary page scan.
viprakṛṣṭamfn. remote, distant, a long way off : (with genitive case or ablative ; ṭādāgataḥ-,come from afar ) View this entry on the original dictionary page scan.
viprakṛṣṭamfn. remote in rank See a-vip- - protracted, lengthened View this entry on the original dictionary page scan.
viprakṛṣṭakamfn. remote, distant View this entry on the original dictionary page scan.
viprakṛṣṭāntaramfn. separated by a long distance View this entry on the original dictionary page scan.
viprakṛṣṭatvan. remoteness, distance View this entry on the original dictionary page scan.
viprakṛtmfn. hurting, injuring, offending (with genitive case) View this entry on the original dictionary page scan.
viprakṛtamfn. hurt, injured, offended etc. etc. View this entry on the original dictionary page scan.
viprakṛtamfn. thwarted, frustrated View this entry on the original dictionary page scan.
viprakṛtif. change, variation View this entry on the original dictionary page scan.
viprakṛtif. injury, offence, opposition, retaliation View this entry on the original dictionary page scan.
viprakuṇḍam. adulterous offspring of Brahman parents View this entry on the original dictionary page scan.
vipralabdhamfn. insulted, violated etc. View this entry on the original dictionary page scan.
vipralabdhāf. a female disappointed by her lover's breaking his appointment (one of the incidental characters in a drama) View this entry on the original dictionary page scan.
vipralabdhamind. deceitfully, falsely (in a-v-) View this entry on the original dictionary page scan.
vipralabdhṛmfn. deceiving, a deceiver View this entry on the original dictionary page scan.
vipralabhA1. -labhate-, to insult, violate, to mock at, take in, cheat, deceive etc. ; to regain, recover (Bombay edition) (Calcutta edition pra-vi-l-,prob. wrong reading for prati-l-): Causal -lambhayati-, to mock, insult, violate View this entry on the original dictionary page scan.
vipralabhyamfn. to be mocked at or imposed upon View this entry on the original dictionary page scan.
vipralambaka wrong reading for lambhaka- View this entry on the original dictionary page scan.
vipralambham. (fr. Causal) deception, deceit, disappointment etc. View this entry on the original dictionary page scan.
vipralambham. the being disappointed or deceived through (ablative) View this entry on the original dictionary page scan.
vipralambham. separation of lovers etc. View this entry on the original dictionary page scan.
vipralambham. disunion, disjunction View this entry on the original dictionary page scan.
vipralambham. quarrel, disagreement View this entry on the original dictionary page scan.
vipralambhakamfn. deceiving, fallacious, a cheat or deceiver View this entry on the original dictionary page scan.
vipralambhakatvan. deceptiveness, fallaciousness View this entry on the original dictionary page scan.
vipralambhanan. plural deception, fraud, trick View this entry on the original dictionary page scan.
vipralambhinmfn. deceiving, fallacious View this entry on the original dictionary page scan.
vipralapP. -lapati-, to discourse or speak about variously, be at variance, disagree (also A1.) ; to complain, lament, bewail View this entry on the original dictionary page scan.
vipralāpamfn. (for 2.See under vi-pra-lap-) free from mere chatter (as truth) View this entry on the original dictionary page scan.
vipralāpam. (for 1.See) discussion, explanation
vipralāpam. talking idly, prattle View this entry on the original dictionary page scan.
vipralāpam. mutual contradiction View this entry on the original dictionary page scan.
vipralāpam. breaking of a promise or engagement, deception View this entry on the original dictionary page scan.
vipralāpinmfn. prattling, a prattler View this entry on the original dictionary page scan.
vipralapitamfn. discussed, debated about View this entry on the original dictionary page scan.
vipralaptan. discussion, debate, disquisition View this entry on the original dictionary page scan.
vipralayam. ( -) extinction, annihilation, absorption in (locative case) View this entry on the original dictionary page scan.
vipralīnamfn. dispersed or scattered in all directions, routed (said of a defeated army) View this entry on the original dictionary page scan.
vipralobhinm. "Brahman-enticing", Name of the kiṅkirāta- tree View this entry on the original dictionary page scan.
vipralobhinm. a species of plant (equals kiṃkirāta-) View this entry on the original dictionary page scan.
vipraloḍitamfn. (fr. Causal of luḍ-) disarranged, spoiled View this entry on the original dictionary page scan.
vipralokam. ( lok-) a bird-catcher View this entry on the original dictionary page scan.
vipralopam. destruction, annihilation View this entry on the original dictionary page scan.
vipralopralopinmfn. plucking off View this entry on the original dictionary page scan.
vipralubh Causal A1. -lobhayate-, to allure, try to seduce or deceive View this entry on the original dictionary page scan.
vipralumpakamfn. rapacious, exacting, avaricious View this entry on the original dictionary page scan.
vipralūnamfn. ( -) cut off, plucked off, gathered View this entry on the original dictionary page scan.
vipralupP. -lumpati-, to tear or snatch away, rob, plunder ; to visit, afflict, disturb View this entry on the original dictionary page scan.
vipraluptamfn. robbed, plundered View this entry on the original dictionary page scan.
vipraluptamfn. interrupted, disturbed View this entry on the original dictionary page scan.
vipramādinmfn. ( mad-) heeding nothing, thoroughly heedless (varia lectio) View this entry on the original dictionary page scan.
vipramanasmfn. dejected, low-spirited (Bombay edition tipramanaso-for te vipr-; see tipr-). View this entry on the original dictionary page scan.
vipramanman(v/ipra--) mfn. having an inspired mind View this entry on the original dictionary page scan.
vipramaṭham. a Brahman monastery View this entry on the original dictionary page scan.
vipramāthinmfn. ( math-) destroying everything, destructive View this entry on the original dictionary page scan.
vipramattamfn. (prob.) not neglected View this entry on the original dictionary page scan.
vipramocyamfn. to be liberated or freed from (ablative) View this entry on the original dictionary page scan.
vipramoham. committing a fault, transgression (in a-vipr-) View this entry on the original dictionary page scan.
vipramohitamfn. confused, perplexed, bewildered View this entry on the original dictionary page scan.
vipramokṣam. ( mokṣ-) loosening, release View this entry on the original dictionary page scan.
vipramokṣam. deliverance from (ablative or genitive case) View this entry on the original dictionary page scan.
vipramokṣaṇan. (in fine compositi or 'at the end of a compound') deliverance from View this entry on the original dictionary page scan.
vipramucP. -muñcati-, to loosen, unfasten, take off ; to liberate, set free ; to discharge, hurl, shoot : Passive voice -mucyate-, to be liberated or released from (ablative), get off free View this entry on the original dictionary page scan.
vipramuhCaus. -mohayati-, to throw into confusion, render confused View this entry on the original dictionary page scan.
vipramuktamfn. loosened etc. View this entry on the original dictionary page scan.
vipramuktamfn. discharged, shot, hurled View this entry on the original dictionary page scan.
vipramuktamfn. delivered or freed from (instrumental case or compound) View this entry on the original dictionary page scan.
vipramuktamfn. varia lectio for vi-prayukta- (below) View this entry on the original dictionary page scan.
vipramuktabhayamfn. removed from danger, free from fear View this entry on the original dictionary page scan.
vipraṇaś(2 naś-) P. -ṇaśyati-, -ṇaśati-, to be lost, perish, disappear ; to have no effect or result, bear no fruit : Causal -ṇāśayati-, to cause to be lost or perish View this entry on the original dictionary page scan.
vipraṇāśaSee a-v-. View this entry on the original dictionary page scan.
vipranaṣṭamfn. (not praṇaṣṭa- see ) lost, disappeared, gone, fruitless, vain View this entry on the original dictionary page scan.
vipranaṣṭaSee vi-pra-ṇaś-. View this entry on the original dictionary page scan.
vipranaṣṭaviśeṣakamfn. one who has lost his discriminative faculty View this entry on the original dictionary page scan.
vipraṇī( -) to turn (the mind) to (locative case) ; to let elapse or pass away (time) View this entry on the original dictionary page scan.
viprānumaditamfn. rejoiced at by seer or poets View this entry on the original dictionary page scan.
viprāpaṇan. ( āp-) View this entry on the original dictionary page scan.
viprapātam. ( pat-) a particular method of flying View this entry on the original dictionary page scan.
viprapātam. a precipice. abyss View this entry on the original dictionary page scan.
viprāpavādam. abuse of a Brahman View this entry on the original dictionary page scan.
viprāprāptamfn. (to explain vi-ṣpitā-) (equals vi-stīrṇa- Scholiast or Commentator) View this entry on the original dictionary page scan.
viprapriyamfn. dear to Brahman View this entry on the original dictionary page scan.
viprapriyam. the palāśa- tree View this entry on the original dictionary page scan.
viprapriyan. thick sour milk View this entry on the original dictionary page scan.
vipraputram. a Brahman's son View this entry on the original dictionary page scan.
viprarāyan. the reign of the wise or pious View this entry on the original dictionary page scan.
viprarāyan. the kingdom or sovereignty of the Brahman or priests View this entry on the original dictionary page scan.
viprarṣabha(for ṛṣ-) m. bull id est chief among Brahman View this entry on the original dictionary page scan.
viprarṣi(for ṛṣi-) m. a Brahman ṛṣi-, priestly sage (exempli gratia, 'for example' vasiṣṭha-) View this entry on the original dictionary page scan.
viprasamāgamam. a concourse of Brahmans View this entry on the original dictionary page scan.
viprasannamfn. tranquil, calm, View this entry on the original dictionary page scan.
viprasāraṇan. (fr. Causal) stretching out (the limbs) View this entry on the original dictionary page scan.
vipraśastakam. plural Name of a people View this entry on the original dictionary page scan.
viprasātkṛP. -karoti-, to present anything (accusative) to Brahman View this entry on the original dictionary page scan.
vipraśeṣitan. the remainder of a Brahman food View this entry on the original dictionary page scan.
viprasevāf. service of a Brahman master View this entry on the original dictionary page scan.
viprāṣika(?) m. a kind of culinary herb View this entry on the original dictionary page scan.
vipraśnam. interrogation of fate (see vaipraśnika-). View this entry on the original dictionary page scan.
vipraśna vi-praśnika- See under vi-prach-, . View this entry on the original dictionary page scan.
vipraśnikam. a fortune-teller, kath-. View this entry on the original dictionary page scan.
vipraśnikāf. View this entry on the original dictionary page scan.
viprasṛP. -sarati- (Ved. infinitive mood -sartave-), to spread, be expanded or extended View this entry on the original dictionary page scan.
viprasṛpP. -sarpati-, to wind about or round, meander (said of a river) View this entry on the original dictionary page scan.
viprasṛtamfn. spread, extended, diffused View this entry on the original dictionary page scan.
viprasthāA1. -tiṣṭhate- (mc. also ti-), to spread in different directions, go apart or asunder, be diffused or dispersed ; to set out, depart View this entry on the original dictionary page scan.
viprasthitamfn. set out on a journey, departed View this entry on the original dictionary page scan.
viprasvan. the property of a Brahman View this entry on the original dictionary page scan.
vipratāf. the rank or condition of a Brahman (-tām upa-gam-,to become a Brahman) View this entry on the original dictionary page scan.
vipratama(v/ipra--) mfn. most wise, wisest View this entry on the original dictionary page scan.
vipratāpasam. a Brahman ascetic View this entry on the original dictionary page scan.
vipratārakam. ( tṝ-) an impostor, deceiver View this entry on the original dictionary page scan.
vipratāritamfn. (fr. Causal) imposed upon, deceived View this entry on the original dictionary page scan.
viprathP. A1. -prathati-, te-, (P.) to spread (trans.) ; (A1.) to spread out, extend (intrans.), be wide : Causal -prathayati-, spread out or abroad, celebrate ; to unfold, display, exhibit View this entry on the original dictionary page scan.
viprathitamfn. spread out or abroad, celebrated View this entry on the original dictionary page scan.
vipratibhāP. -bhāti-, to appear as, seem to be (Nominal verb) View this entry on the original dictionary page scan.
vipratikāram. counteraction, opposition, reverse, retaliation View this entry on the original dictionary page scan.
vipratikṛP. -karoti-, to counteract, oppose View this entry on the original dictionary page scan.
vipratikṛtamfn. counteracted, opposed, requited View this entry on the original dictionary page scan.
vipratikūlamfn. obstinate, refractory View this entry on the original dictionary page scan.
vipratīpamfn. equals -pratikūla- View this entry on the original dictionary page scan.
vipratīpamfn. reversed, inverted View this entry on the original dictionary page scan.
vipratipadA1. -padyate-, to go in different or opposite directions, turn here and there ; to roam, wander (said of the senses) ; to be perplexed or confounded, be uncertain how to act, waver, hesitate ; to differ or diverge in opinion, be mutually opposed ; to be mistaken, have a false opinion about (locative case) ; to reply falsely or erroneously View this entry on the original dictionary page scan.
vipratipadyamfn. to be opposed or contested View this entry on the original dictionary page scan.
vipratipadyamfn. to be variously acquired View this entry on the original dictionary page scan.
vipratipannamfn. gone in different directions etc. View this entry on the original dictionary page scan.
vipratipannamfn. perplexed, confounded, uncertain View this entry on the original dictionary page scan.
vipratipannamfn. of opposite opinion, dissentient View this entry on the original dictionary page scan.
vipratipannamfn. wrong, false (as an opinion) View this entry on the original dictionary page scan.
vipratipannamfn. having a false opinion, being mistaken about or in (locative case) View this entry on the original dictionary page scan.
vipratipannamfn. forbidden, prohibited View this entry on the original dictionary page scan.
vipratipannamfn. conversant or acquainted with in various ways View this entry on the original dictionary page scan.
vipratipannamfn. mutually connected View this entry on the original dictionary page scan.
vipratipannabuddhimfn. having a false opinion, being mistaken or in error View this entry on the original dictionary page scan.
vipratipattif. divergence, difference or opposition (of opinion or interests), contrariety, contradiction, etc. View this entry on the original dictionary page scan.
vipratipattif. incompatibility of two conceptions, opposition of one rule to another View this entry on the original dictionary page scan.
vipratipattif. erroneous perception or notion, error, mistake View this entry on the original dictionary page scan.
vipratipattif. suspicion about (locative case) View this entry on the original dictionary page scan.
vipratipattif. aversion, hostile feeling or treatment View this entry on the original dictionary page scan.
vipratipattif. false reply or objection (in argument) View this entry on the original dictionary page scan.
vipratipattif. various acquirement, conversancy View this entry on the original dictionary page scan.
vipratipattif. mutual connection or relation View this entry on the original dictionary page scan.
vipratipratyanīkamfn. equals -pratyanīka- View this entry on the original dictionary page scan.
vipratisāran. ( m.fr. sṛ-) repentance
vipratisāran. evil, wickedness View this entry on the original dictionary page scan.
vipratisāran. anger, wrath View this entry on the original dictionary page scan.
vipratīsāram. equals pratisāra- View this entry on the original dictionary page scan.
vipratisāravatmfn. equals next View this entry on the original dictionary page scan.
vipratisārinmfn. full of repentance View this entry on the original dictionary page scan.
vipratisārinmfn. afflicted, dejected View this entry on the original dictionary page scan.
vipratiṣedham. restraining, keeping in check View this entry on the original dictionary page scan.
vipratiṣedham. opposition, contradiction, contrariety, conflict (of two statements) etc. (especially in gram., pratiṣedhe-,where there is a conflict between two rules ; dhena-,in consequence of a conflict of two rules, iv, 1, 170 Va1rtt. 1; pūrva-vipratiṣedha-,a conflict of two rules of which the former prohibits the latter, iv, 2, 39 Va1rtt. 1; para-v-,a conflict of two rules of which the latter prohibits the former, Va1rtt. 1 ) View this entry on the original dictionary page scan.
vipratiṣedham. prohibition, negation, annulment View this entry on the original dictionary page scan.
vipratiṣiddhamfn. (2. sidh-) prohibited, forbidden View this entry on the original dictionary page scan.
vipratiṣiddhamfn. contradicted, opposed ( vipratiṣiddham am- ind.) etc. View this entry on the original dictionary page scan.
vipratiṣiddhamfn. of opposed meaning View this entry on the original dictionary page scan.
vipratiṣiddhamind. vipratiṣiddha
vipratvan. the rank of a Brahman or a scholar View this entry on the original dictionary page scan.
vipratyanīkamfn. hostile View this entry on the original dictionary page scan.
vipratyanīyakamfn. idem or 'mfn. hostile ' View this entry on the original dictionary page scan.
vipratyayam. distrust View this entry on the original dictionary page scan.
vipravācanan. equals /orāhmaṇa-v- View this entry on the original dictionary page scan.
vipravacas(v/ipra--) mfn. one whose words are inspired View this entry on the original dictionary page scan.
vipravadP. A1. -vadati-, te-, to speak variously, be at variance, disagree (see ) . View this entry on the original dictionary page scan.
vipravādam. disagreement View this entry on the original dictionary page scan.
vipravāhasmfn. receiving the homage and offerings of the wise View this entry on the original dictionary page scan.
viprāvamanyakamfn. despising Brahmans View this entry on the original dictionary page scan.
vipravasP. -vasati-, to set out on a journey, go or dwell abroad : Causal -vāsayati-, to cause to dwell away, banish, expel from (ablative) ; to take away, remove View this entry on the original dictionary page scan.
vipravāsam. going or dwelling abroad, staying away from (ablative or compound) View this entry on the original dictionary page scan.
vipravāsam. (4. vas-) the offence committed by a monk in giving away his garment View this entry on the original dictionary page scan.
vipravāsanan. expulsion, banishment View this entry on the original dictionary page scan.
vipravāsanan. residence abroad View this entry on the original dictionary page scan.
vipravasitamfn. withdrawn, departed (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
vipravāsitamfn. removed, destroyed (as sin) View this entry on the original dictionary page scan.
vipravatind. like a Brahman View this entry on the original dictionary page scan.
vipraviddhamfn. ( vyadh-) dispersed, scattered View this entry on the original dictionary page scan.
vipraviddhamfn. violently struck or shaken View this entry on the original dictionary page scan.
vipravīram. a heroic Brahman View this entry on the original dictionary page scan.
vipravīramfn. having inspired men or inspiring men View this entry on the original dictionary page scan.
vipravitti varia lectio for -citti-. View this entry on the original dictionary page scan.
vipravrajP. -vrajati-, to go away in different directions ; to depart from (ablative) View this entry on the original dictionary page scan.
vipravrājinīf. a woman who consorts with two men (equals dvi-pr- Scholiast or Commentator)
viprayāṇan. ( -) going away, flight View this entry on the original dictionary page scan.
viprayātamfn. gone apart or asunder, fled in all directions View this entry on the original dictionary page scan.
viprayogam. disjunction, dissociation, separation from (instrumental case with or without saha- genitive case,or compound) etc. View this entry on the original dictionary page scan.
viprayogam. absence, want View this entry on the original dictionary page scan.
viprayogam. quarrel, disagreement View this entry on the original dictionary page scan.
viprayogam. the being fit or deserving View this entry on the original dictionary page scan.
viprayoginmfn. separated (from a beloved object) View this entry on the original dictionary page scan.
viprayojitamfn. (fr. Causal) freed from (instrumental case) View this entry on the original dictionary page scan.
viprayujP. -yunakti-, to separate from, deprive of (instrumental case) : Passive voice -yujyate-, to be separated from (instrumental case) : Causal -yojayati-, to cause to be separated from, deprive of (instrumental case) ; to release from (instrumental case) View this entry on the original dictionary page scan.
viprayuktamfn. separated or removed or absent from, destitute of, free from, without (instrumental case or compound). etc. View this entry on the original dictionary page scan.
viprayuktamfn. not being in conjunction with (varia lectio pramukta-). View this entry on the original dictionary page scan.
vipṛcP. -pṛṇakti- (imperative -pṛṅktam- Potential -papṛcyāt- infinitive mood -p/ṛce-), to isolate, separate from (instrumental case) ; to scatter, dispel ; to fill, satiate View this entry on the original dictionary page scan.
vipṛcmfn. isolated, separate View this entry on the original dictionary page scan.
vipṛcchamSee vi-prach-. View this entry on the original dictionary page scan.
vipre( -pra-i-) P. -praiti- (imperative -praihi-for -prehi- ), to go forth in different directions, disperse ; to go away, depart View this entry on the original dictionary page scan.
viprekṣ( -pra-īkṣ-) A1. -prekṣate-, to look here and there, regard, consider View this entry on the original dictionary page scan.
viprekṣaṇan. looking round View this entry on the original dictionary page scan.
viprekṣitan. a look, glance View this entry on the original dictionary page scan.
viprekṣitṛmfn. one who looks round View this entry on the original dictionary page scan.
vipremann. estrangement (cf. -priya-). View this entry on the original dictionary page scan.
viprendram. chief of Brahmans View this entry on the original dictionary page scan.
vipretamfn. gone asunder or away, dispersed View this entry on the original dictionary page scan.
vipriyamfn. (v/i--) disaffected, estranged (see -preman-) View this entry on the original dictionary page scan.
vipriyamfn. disagreeable, unpleasant to (genitive case or compound) etc. View this entry on the original dictionary page scan.
vipriyan. (also plural) anything unpleasant or hateful, offence, transgression View this entry on the original dictionary page scan.
vipriyakaramfn. () doing what is displeasing, acting unkindly, offensive View this entry on the original dictionary page scan.
vipriyakārinmfn. () doing what is displeasing, acting unkindly, offensive View this entry on the original dictionary page scan.
vipriyaṃkaramfn. () doing what is displeasing, acting unkindly, offensive View this entry on the original dictionary page scan.
vipriyatvan. unpleasantness View this entry on the original dictionary page scan.
vipṛkta(v/i--) mfn. separated, divided View this entry on the original dictionary page scan.
vipṛkvatmfn. unmixed, pure (= sarvato vyāpta- ) View this entry on the original dictionary page scan.
viproṣitamfn. (vi-pra-+ uṣita-) dwelling abroad, set out or gone away to (accusative), absent from (ablative) View this entry on the original dictionary page scan.
viproṣitamfn. banished (See next) View this entry on the original dictionary page scan.
viproṣita vi-proṣya- See under vi-pra-vas-, column 1. View this entry on the original dictionary page scan.
viproṣitabhartṛkāf. (a woman) whose husband or lover is absent View this entry on the original dictionary page scan.
viproṣitakumāram. (a kingdom) whose hereditary prince is banished View this entry on the original dictionary page scan.
viproṣyaind. having dwelt abroad, having been absent, (returning) after a journey View this entry on the original dictionary page scan.
vipṛṣṭam. Name of a son of vasu-deva- View this entry on the original dictionary page scan.
vipṛṣṭhībhūP. -bhavati-, to be depressed or dejected (prob. wrong reading for -piṣṭī-bhū-). View this entry on the original dictionary page scan.
vipṛtha vi-pṛthu- See p.951. View this entry on the original dictionary page scan.
vipṛthum. varia lectio for vi-path/a- View this entry on the original dictionary page scan.
vipṛthum. Name of a prince belonging to the vṛṣṇi-s View this entry on the original dictionary page scan.
vipṛthum. of a son of citraka- and younger brother of pṛthu- (wrong reading pṛtha-). View this entry on the original dictionary page scan.
vipru(see vi-plu-) A1. -pravate-, to sprinkle about, scatter View this entry on the original dictionary page scan.
vipruḍḍhomam. (for 2. vipruṣ-+ homa-) an expiatory offering designed to atone for the drops of soma- let fall at a sacrifice View this entry on the original dictionary page scan.
vipruṣ -pruṣyati-, to ooze out, drip away View this entry on the original dictionary page scan.
vipruṣf. (Nominal verb pr/uṭ-) a drop (of water), spark (of fire), speck, spark, small bit, atom etc. View this entry on the original dictionary page scan.
vipruṣf. plural (with or scilicet mukhyāḥ-) drops falling from the mouth while speaking View this entry on the original dictionary page scan.
vipruṣf. a phenomenon (equals āścarya-v-) View this entry on the original dictionary page scan.
vipruṣamn. a drop View this entry on the original dictionary page scan.
vipruṣam. a bird View this entry on the original dictionary page scan.
vipruṣmatmfn. having or covered with drops View this entry on the original dictionary page scan.
vipruta(v/i--) mfn. borne away, cast or carried away, vagrant View this entry on the original dictionary page scan.
vipsāf. equals psā-, repetition, succession View this entry on the original dictionary page scan.
viP. -punāti-, to cleanse thoroughly, purity effectually ; equals vi-dārayati- View this entry on the original dictionary page scan.
vipūjanam. ( pūj-) Name of a man View this entry on the original dictionary page scan.
vipulaSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
vipulamf(ā-)n. (prob. fr. pula- equals pura-; see under pul-) large, extensive, wide, great, thick, long (also of time), abundant, numerous, important, loud (as a noise), noble (as a race) etc. View this entry on the original dictionary page scan.
vipulam. a respectable man View this entry on the original dictionary page scan.
vipulam. Name of a prince of the sauvīra-s View this entry on the original dictionary page scan.
vipulam. of a pupil of deva-śarman- (who guarded the virtue of ruci-, his preceptor's wife, when tempted by indra- during her husband's absence) View this entry on the original dictionary page scan.
vipulam. of a son of vasu-deva- View this entry on the original dictionary page scan.
vipulam. of a mountain (either meru- or the himālaya-) View this entry on the original dictionary page scan.
vipulāf. the earth View this entry on the original dictionary page scan.
vipulam. a form of the āryā- metre (in which the caesura is irregular;divided into 3 species, ādi--, antya--, and ubhaya-vipulā-) View this entry on the original dictionary page scan.
vipulam. (in music) a kind of measure View this entry on the original dictionary page scan.
vipulan. a sort of building View this entry on the original dictionary page scan.
vipulabuddhimfn. () endowed with great understanding View this entry on the original dictionary page scan.
vipulacchāyamfn. having ample shade, shady, umbrageous View this entry on the original dictionary page scan.
vipuladravyamfn. having great wealth, wealthy View this entry on the original dictionary page scan.
vipulagrīvamfn. long-necked View this entry on the original dictionary page scan.
vipulahṛdayamfn. large-hearted, large-minded (varia lectio) View this entry on the original dictionary page scan.
vipulajaghanāf. a woman with large hips View this entry on the original dictionary page scan.
vipulakamfn. "very extensive"and"without bristling hair" (see pulaka-). View this entry on the original dictionary page scan.
vipulamatimfn. idem or 'mfn. () endowed with great understanding' View this entry on the original dictionary page scan.
vipulamatim. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
vipulapārśvam. Name of a mountain View this entry on the original dictionary page scan.
vipulaprajñamfn. () endowed with great understanding View this entry on the original dictionary page scan.
vipularasam. "having abundant juice", the sugar-cane View this entry on the original dictionary page scan.
vipulārthabhogavatmfn. having great wealth and many enjoyments View this entry on the original dictionary page scan.
vipulaskandham. "broad-shouldered", Name of arjuna- View this entry on the original dictionary page scan.
vipulasravāf. equals sravā- View this entry on the original dictionary page scan.
vipulāśravāf. Aloe Perfoliata View this entry on the original dictionary page scan.
vipulaśroṇimf(ī-)n. having swelling hips View this entry on the original dictionary page scan.
vipulaśroṇībharamf(ā-)n. idem or 'mf(ī-)n. having swelling hips ' View this entry on the original dictionary page scan.
vipulatāf. () largeness, greatness, extent, width, magnitude View this entry on the original dictionary page scan.
vipulataramfn. larger or very large View this entry on the original dictionary page scan.
vipulatvan. () largeness, greatness, extent, width, magnitude View this entry on the original dictionary page scan.
vipulaujasmfn. having great strength, very strong View this entry on the original dictionary page scan.
vipulavratamfn. one who has undertaken great duties View this entry on the original dictionary page scan.
vipulayaNom. P. yati-, to lengthen, make longer View this entry on the original dictionary page scan.
vipulāyatākṣamfn. having large and long eyes View this entry on the original dictionary page scan.
vipulekṣaṇamfn. large-eyed View this entry on the original dictionary page scan.
vipulībhāvam. spaciousness, extensiveness View this entry on the original dictionary page scan.
vipulīkṛP. -karoti-, to extend View this entry on the original dictionary page scan.
vipulināmburuhamfn. having no sandbanks nor lotus-flowers (as a river) View this entry on the original dictionary page scan.
vipuloraskamfn. broad-chested View this entry on the original dictionary page scan.
vipuṃsakamfn. not quite manly, unmanly View this entry on the original dictionary page scan.
vipuṃsīf. a masculine woman (varia lectio -and ṣī-). View this entry on the original dictionary page scan.
vipuran. the intellect (see 3. pur-). View this entry on the original dictionary page scan.
vipuramfn. having no fixed abode or home View this entry on the original dictionary page scan.
vipurībhū -bhavati-, to become homeless (-bhāva- m.homelessness) View this entry on the original dictionary page scan.
vipurīṣamfn. freed from ordure View this entry on the original dictionary page scan.
vipuruṣamfn. void of men, empty View this entry on the original dictionary page scan.
vipuṣpamf(ā-)n. flowerless (as a tree) View this entry on the original dictionary page scan.
vipuṣṭamfn. ill-fed, under-fed View this entry on the original dictionary page scan.
vipuṣṭif. perfect welfare or prosperity View this entry on the original dictionary page scan.
vipuṭamf(ā-)n. (prob.) without (large) apertures (said of a nose) View this entry on the original dictionary page scan.
viputhCaus. -pothayati-, te-, to crush, dash to pieces ; to grind down, pulverise View this entry on the original dictionary page scan.
viputramf(ā-)n. bereft of a son (calf) View this entry on the original dictionary page scan.
vipūyamfn. cleansing, purifying View this entry on the original dictionary page scan.
vipūyam. Saccharum Munjia View this entry on the original dictionary page scan.
vipūyakan. ( pūy-) suppuration or an offensive smell View this entry on the original dictionary page scan.
vipūyakan. a decomposed corpse View this entry on the original dictionary page scan.
vif. a wife, matron (whose husband and sons are still alive) View this entry on the original dictionary page scan.
vif. an intoxicating beverage View this entry on the original dictionary page scan.
vif. Name of various plants and drugs (Flacourtia Cataphracta;Convolvulus Paniculatus;Gmelina Arborea;the drug ela-vāluka- etc.) View this entry on the original dictionary page scan.
viracP. -racayati- (rarely A1.; Aorist vy-araracat-,once -arīracat-; ind.p. vi-racayya-; Passive voice vi-racyate-; Aorist vy-araci-), to construct, contrive, form, fashion, make, arrange etc. ; to build, erect ; to invent, produce, compose, write etc. ; to put on, don, wear View this entry on the original dictionary page scan.
viracanan. (andf(ā-).) arrangement, disposition, embellishment (with alakānām-,beautifully arranged locks ) View this entry on the original dictionary page scan.
viracanan. putting on, wearing (ornaments etc.) View this entry on the original dictionary page scan.
viracanan. composition, compilation View this entry on the original dictionary page scan.
viracayitavyamfn. to be formed or made View this entry on the original dictionary page scan.
viracitamfn. constructed, arranged etc.
viracitamfn. performed View this entry on the original dictionary page scan.
viracitamfn. composed, written, View this entry on the original dictionary page scan.
viracitamfn. put together, spoken, uttered (See compound) View this entry on the original dictionary page scan.
viracitamfn. put on, worn View this entry on the original dictionary page scan.
viracitamfn. furnished with (instrumental case) View this entry on the original dictionary page scan.
viracitamfn. put in, inlaid, set View this entry on the original dictionary page scan.
viracitāf. Name of a woman View this entry on the original dictionary page scan.
viracitapadamfn. (a speech or song etc.) the words of which are artificially composed or arranged, rhythmic, poetic View this entry on the original dictionary page scan.
viracitavācmfn. one who has composed a speech or who has spoken View this entry on the original dictionary page scan.
viracitavapusmfn. one who has his body formed or arranged View this entry on the original dictionary page scan.
viracitoktimfn. idem or 'mfn. one who has composed a speech or who has spoken ' View this entry on the original dictionary page scan.
viradP. -radati-, to rend asunder, sever ; to open to, bestow on, View this entry on the original dictionary page scan.
virāḍin compound for 2. vi-rāj- View this entry on the original dictionary page scan.
viradaSee viruda-. View this entry on the original dictionary page scan.
virāḍaṣṭama(vir/āḍ--) mfn. having the metre virāj- in the eighth place View this entry on the original dictionary page scan.
virāḍdeham. "having the body of virāj-", Name of the Universe View this entry on the original dictionary page scan.
virāddhamfn. opposed, thwarted, offended, reviled, abused View this entry on the original dictionary page scan.
virāddhṛmfn. opposing, thwarting View this entry on the original dictionary page scan.
virāddhṛmfn. an injurer, offender View this entry on the original dictionary page scan.
virādhP. -rādhyati-, to hurt, injure ; (only Aorist A1. -rādhiṣi-), to lose, be deprived of (instrumental case) : ; Causal -rādhayati-, to become disunited, be at variance, disagree (see a-virādhayat-). View this entry on the original dictionary page scan.
virādham. thwarting, opposition, vexation View this entry on the original dictionary page scan.
virādham. Name of a rākṣasa- etc. View this entry on the original dictionary page scan.
virādham. of a dānava- View this entry on the original dictionary page scan.
virādhaguptam. Name of a man View this entry on the original dictionary page scan.
virādhahanm. "slayer of virādha-", Name of indra- or viṣṇu- View this entry on the original dictionary page scan.
virādhanan. failure, want of success View this entry on the original dictionary page scan.
virādhanan. injury, offence View this entry on the original dictionary page scan.
virādhanāf. hurt, injury View this entry on the original dictionary page scan.
virādhāna(?) n. hurt, pain View this entry on the original dictionary page scan.
virādhaya(fr. Causal) gaRa brāhmaṇādi-. View this entry on the original dictionary page scan.
virādhyamfn. to be lost, anything of which one is to be deprived View this entry on the original dictionary page scan.
virāḍrūpāf. a Vedic form of the triṣṭubh- metre View this entry on the original dictionary page scan.
virāḍvarṇamf(ā-)n. having the form of the metre virāj- View this entry on the original dictionary page scan.
virāgamf(ā-)n. passionless, without feeling, dispassionate, indifferent (sarvatas-,"to everything") View this entry on the original dictionary page scan.
viragam. or n. (?) a particular high number View this entry on the original dictionary page scan.
virāgam. (for 1.See) change or loss of colour View this entry on the original dictionary page scan.
virāgam. excitement, irritation View this entry on the original dictionary page scan.
virāgam. aversion, dislike or indifference to (locative case ablative,or compound) View this entry on the original dictionary page scan.
virāgam. indifference to external things or worldly objects View this entry on the original dictionary page scan.
virāgam. the faulty suppression of a sound in pronunciation,
virāgam. a particular high number View this entry on the original dictionary page scan.
virāgārhamfn. qualified for freedom from passion (equals vairaṅgika-) View this entry on the original dictionary page scan.
virāgatāf. indifference to everything, stoicism View this entry on the original dictionary page scan.
virāgavatmfn. indifferent (sarvatra-,"to everything") View this entry on the original dictionary page scan.
virāgaviṣabhṛtmfn. cherishing the poison of dislike or aversion View this entry on the original dictionary page scan.
virāgayaNom. P. yati- to estrange, alienate ; to displease View this entry on the original dictionary page scan.
virāginmfn. indifferent to (locative case) View this entry on the original dictionary page scan.
virāgitamfn. exasperated, irritated View this entry on the original dictionary page scan.
virāgitamfn. in fine compositi or 'at the end of a compound' , feeling aversion or dislike to View this entry on the original dictionary page scan.
virahP. -rahayati- (infinitive mood -rahitum-; ind.p. -rahayya-), to abandon, desert, relinquish, leave View this entry on the original dictionary page scan.
viraham. abandonment, desertion, parting, separation (especially of lovers), absence from (instrumental case or compound) etc. View this entry on the original dictionary page scan.
viraham. lack, want (in fine compositi or 'at the end of a compound' = lacking, with the exception of) etc. View this entry on the original dictionary page scan.
virahādhigamam. experiencing separation View this entry on the original dictionary page scan.
virahaguṇitamfn. increased by separation View this entry on the original dictionary page scan.
virahajamfn. arising from separation View this entry on the original dictionary page scan.
virahajanitamfn. idem or 'mfn. arising from separation ' View this entry on the original dictionary page scan.
virahajvaram. the anguish of separation View this entry on the original dictionary page scan.
virahānalam. the fire of separation View this entry on the original dictionary page scan.
virahārtamfn. pained by separation View this entry on the original dictionary page scan.
virahaśayanan. a solitary couch or bed View this entry on the original dictionary page scan.
virahāvasthāf. state of separation View this entry on the original dictionary page scan.
virahavirasamfn. painful through (the idea of) separation, View this entry on the original dictionary page scan.
virahavyāpadmfn. decreased by separation View this entry on the original dictionary page scan.
virahīkṛP. -karoti-, to separate from (instrumental case) View this entry on the original dictionary page scan.
virahinmfn. separated, parted (especially from a beloved person), lonely, solitary etc. View this entry on the original dictionary page scan.
virahinmfn. absent View this entry on the original dictionary page scan.
virahinmfn. (in fine compositi or 'at the end of a compound') abstaining from View this entry on the original dictionary page scan.
virahiṇīf. a woman separated from her husband or lover View this entry on the original dictionary page scan.
virahiṇīf. wages, hire View this entry on the original dictionary page scan.
virahiṇīmanovinodam. Name of work View this entry on the original dictionary page scan.
virahitamfn. abandoned, deserted, solitary, lonely, separated or free from, deprived of (instrumental case genitive case,or compound) etc. View this entry on the original dictionary page scan.
virahitātind. with the exception of (genitive case) View this entry on the original dictionary page scan.
virahotkaṇṭhikāf. (in dramatic language) a woman who longs after her absent lover or husband View this entry on the original dictionary page scan.
virahotsukamfn. suffering from separation View this entry on the original dictionary page scan.
virājm. (for 2.See sub voce, i.e. the word in the Sanskrit order) king of birds View this entry on the original dictionary page scan.
virājP. A1. -rājati-, te-, to reign, rule, govern, master (genitive case or accusative), excel (ablative) ; to be illustrious or eminent, shine forth, shine out (ablative), glitter etc. ; to appear as (Nominal verb) : Causal -rājayati-, (rarely te-) cause to shine forth, give radiance or lustre, brighten, illuminate View this entry on the original dictionary page scan.
virājmfn. (for 1.See) ruling far and wide, sovereign, excellent, splendid View this entry on the original dictionary page scan.
virājmfn. a ruler, chief. king or queen (applied to agni-, sarasvatī-, the Sun etc.) View this entry on the original dictionary page scan.
virājf. excellence, pre-eminence, high rank, dignity, majesty View this entry on the original dictionary page scan.
virājmf. the first progeny of brahmā- (according to , brahmā- having divided his own substance into male and female, produced from the female the male power virāj-, who then produced the first manu- or manu- svāyambhuva-, who then created the ten prajā-pati-s;the states that the male half of brahmā- was manu-, and the other half śata-rūpā-, and does not allude to the intervention of virāj-;other purāṇa-s describe the union of śata-rūpā- with virāj- or puruṣa- in the first instance, and with manu- in the second; virāj- as a sort of secondary creator, is sometimes identified with prajā-pati-, brahmā-, agni-, puruṣa-, and later with viṣṇu- or kṛṣṇa-, while in , he is represented as born from puruṣa-, and puruṣa- from him;in the , virāj- is spoken of as a female, and regarded as a cow;being elsewhere, however, identified with prāṇa-) View this entry on the original dictionary page scan.
virājm. (in vedānta-) Name of the Supreme Intellect located in a supposed aggregate of gross bodies (equals vaiśvānara-,q. v.) , vedānta-s. View this entry on the original dictionary page scan.