Donate
   
Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Grammar Search
"tana" has 1 results
tana: masculine vocative singular stem: tana
Amarakosha Search
48 results
WordReferenceGenderNumberSynonymsDefinition
abhram1.3.6-7NeuterSingularmudiraḥ, ambubhṛt, jaladharaḥ, stanayitnuḥ, dhūmayoniḥ, jīmūtaḥ, vāridaḥ, dhārādharaḥ, vārivāhaḥ, jalamuk, ghanaḥ, taḍitvān, balāhakaḥ, meghaḥcloud
anurodhaḥ2.8.12MasculineSingularanuvartanam
ātmajaḥ2.6.27MasculineSingulartanayaḥ, ‍sunuḥ, ‍sutaḥ, putraḥ
avanāyaḥ2.4.27MasculineSingularnipātanam
caityamNeuterSingularāyatanam
deśaḥ2.1.8MasculineSingularviṣayaḥ, upavartanam
duhitā2.6.27FeminineSingulartana, ‍sunū, ‍sutā, putrī, ātmajā
gaṃgā1.10.31FeminineSingularbhāgīrathī, tripathagā, trisrotā, viṣṇupadī, bhīṣmasūḥ, jahnutana, suranimnagāganges(river)
gardabhāṇḍaḥ2.2.43MasculineSingularplakṣaḥ, kandarālaḥ, kapītana, supārśvakaḥ
gāyatrī2.2.49FeminineSingularbālatanayaḥ, khadiraḥ, dantadhāvanaḥ
gṛham2.2.4-5NeuterSingularagāram, vastyam, sadma, geham, ālayaḥ, gṛhāḥ, bhavanam, niśāntam, veśma, nilayaḥ, mandiram, sadanam, niketanam, udavasitam, nikāyyaḥ
jīvikā2.9.1FeminineSingular‍ājīvaḥ, vārtā, vṛttiḥ, vartanam, jīvanam
kakṣyā3.3.166FeminineSingularātmavān, arthātanapetaḥ
kālindīFeminineSingularśamanasvasā, sūryatana, yamunāyamuna(river)
kuṅkumam2.6.124NeuterSingularlohitacandanam, saṅkocam, bāhlīkam, kāśmīrājanma, dhīram, raktam, varam, piśunam, tanam, agniśikham
lakṣmīḥ1.1.27FeminineSingularbhārgavī, , haripriyā, padmā, kṣīrasāgarakanyakā, ramā, lokamātā, śrīḥ, padmālayā, lokajananī, kṣīrodatana, indirā, kamalālaxmi, goddess of wealth
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketana, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
māraṇam2.8.118NeuterSingularnirbahaṇam, pravāsanam, nihiṃsanam, nirgranthanam, nihānanam, nirvāpaṇam, pratighātanam, krathanam, piñjaḥ, unmāthaḥ, nikāraṇam, parāsanam, nirvāsanam, apāsanam, kṣaṇanam, viśasanam, udvāsanam, ujjāsanam, viśaraḥ, pramāpaṇam, viśāraṇam, niṣūdanam, saṃjñapanam, ni‍starhaṇam, parivarjanam, māraṇam, pramathanam, ālambhaḥ, ghātaḥ
mūlyam2.10.38-39NeuterSingularbharaṇam, bharma, vidhā, paṇaḥ, bharaṇyam, bhṛ‍tiḥ, karmaṇyā, nirveśaḥ, vetanam, bhṛtyā
parighaḥ2.8.93MasculineSingularparighātana
patākā2.8.102FeminineSingular‍vaijayantī, ketanam, ‍‍dhvajam
tanaMasculineSingularāmrātakaḥ, kapītana
prakāraḥ3.3.170MasculineSingularabdaḥ, strīstana
prāṇīMasculineSingularjantuḥ, janyuḥ, śarīrī, cetana, janmīanimal
prasavaḥ3.3.216MasculineSingularśastraḥ, śūdrāyāṃvipratanayaḥ
pratīkāraḥ2.8.112MasculineSingularvairaśuddhiḥ, vairaniryātanam
pratyagraḥ3.1.77MasculineSingulartana, navaḥ, nūtnaḥ, abhinavaḥ, navyaḥ, navīnaḥ
pūḥFeminineSingularnagarī, pattanam, puṭabhedanam, sthānīyam, nigamaḥ, purī
purāṇaḥ3.1.76MasculineSingularpurātanam, cirantanam, pratanam, pratnam
rītipuṣpam2.9.104NeuterSingularpiñjaram, tanam, tālam, ālam
śāśvataḥ3.1.71MasculineSingularsanātana, dhruvaḥ, nityaḥ, sadātana
śirīṣaḥ2.2.63MasculineSingularkapītana, maṇḍilaḥ
stanaṃdhayī2.6.41MasculineSingularuttānaśayā, ḍimbhā, stana
sūraḥ1.3.28-30MasculineSingularsahasrāṃśuḥ, raviḥ, chāyānāthaḥ, jagaccakṣuḥ, pradyotana, lokabāndhavaḥ, aryamā, dhāmanidhiḥ, divākaraḥ, braghnaḥ, bhāsvān, haridaśvaḥ, arkaḥ, aruṇaḥ, taraṇiḥ, virocanaḥ, tviṣāṃpatiḥ, haṃsaḥ, savitā, tejasāṃrāśiḥ, karmasākṣī, trayītanuḥ, khadyotaḥ, sūryaḥ, bhagaḥ, dvādaśātmā, abjinīpatiḥ, ahaskaraḥ, vibhākaraḥ, saptāśvaḥ, vikartana, mihiraḥ, dyumaṇiḥ, citrabhānuḥ, grahapatiḥ, bhānuḥ, tapanaḥ, padmākṣaḥ, tamisrahā, lokabandhuḥ, dinamaṇiḥ, inaḥ, ādityaḥ, aṃśumālī, bhāskaraḥ, prabhākaraḥ, vivasvān, uṣṇaraśmiḥ, mārtaṇḍaḥ, pūṣā, mitraḥ, vibhāvasuḥ, aharpatiḥ(53)the sun
tāṇḍavam1.7.9MasculineSingularnāṭyam, lāsyam, nṛtyam, nartanam, naṭanamdancing(particularly, the frantic or violent dance of shiva)
udyānam3.3.124NeuterSingularupakaraṇam, māraṇam, anuvrajyā, mṛtasaṃskāraḥ, gatiḥ, dravyopapādanam, nirvartanam
utsādanam2.6.122NeuterSingularudvartanam
velljam2.9.36NeuterSingularkṛṣṇam, ūṣaṇam, dharmapattanam, marīcam, kolakam
vivadhaḥ3.3.103MasculineSingulardoṣotpādaḥ, prakṛtyādivinaśvaraḥ(vyākaraṇe), mukhyānuyāyīśiśuḥ, prakṛtasyānuvartanam
vyāpādaḥMasculineSingulardrohacintanammalice
yantā3.3.66MasculineSingularpārthivaḥ, tanayaḥ
tanaMasculineSingularāmrātakaḥ, kapītana
stanaṃdhayī2.6.41MasculineSingularuttānaśayā, ḍimbhā, stana
stanau2.6.78MasculineDualkucau
artanam2.4.32NeuterSingularṛtīyā, hṛṇīyā, ghṛṇā
ketanam3.3.121NeuterSingularlokavādaḥ, paśvahipakṣiṇāṃyuddham
niryātanam3.3.127NeuterSingularguhyam, akāryam
stana3.5.12MasculineSingular
Monier-Williams Search
1129 results for tana
Devanagari
BrahmiEXPERIMENTAL
tanan. offspring, posterity (n/āyā-for nāya-) View this entry on the original dictionary page scan.
tanabālam. pl, Name of a people View this entry on the original dictionary page scan.
tanaka(for vet-?), a reward View this entry on the original dictionary page scan.
tanasn. offspring View this entry on the original dictionary page scan.
tanas nikā-, nitṛ-, etc. See 3. tan-.
tanayamfn. propagating a family, belonging to one's own family (often said of tok/a-) View this entry on the original dictionary page scan.
tanayam. a son (dual number"son and daughter", ) View this entry on the original dictionary page scan.
tanayam. equals -bhavana- View this entry on the original dictionary page scan.
tanayam. Name of a vāsiṣṭha- (varia lectio anagha-) View this entry on the original dictionary page scan.
tanayam. plural Name of a people View this entry on the original dictionary page scan.
tanayan. posterity, family, race, offspring, child ("grandchild" , opposed to tok/a-,"child" ) (in fine compositi or 'at the end of a compound' f(ā-)., ) View this entry on the original dictionary page scan.
tanaf. (gaRa priyādi-) a daughter (varia lectio) etc. View this entry on the original dictionary page scan.
tanayan. the plant cakra-tulyā- View this entry on the original dictionary page scan.
tanayabhavanan. the 5th lunar mansion View this entry on the original dictionary page scan.
tanayasarasn. "offspring-receptacle", a mother View this entry on the original dictionary page scan.
tanayīkṛtamfn. made a son View this entry on the original dictionary page scan.
tanayitnumfn. (equals stan-) roaring, thundering, . View this entry on the original dictionary page scan.
tanayitnuSee 2. tan-. View this entry on the original dictionary page scan.
abdhitanayam. dual number the aśvin-s View this entry on the original dictionary page scan.
abdhitanayam. dual number the two aśvin-s, View this entry on the original dictionary page scan.
abhibhāyatanan. "abode of superiority", Name of the eight sources of superiority with Buddhists View this entry on the original dictionary page scan.
abhiniṣpatanan. springing forth, issuing. View this entry on the original dictionary page scan.
abhipatanan. flying towards. View this entry on the original dictionary page scan.
abhipravartanan. coming or flowing forth (said of the sweat) View this entry on the original dictionary page scan.
abhiśasticātanamfn. keeping off imprecation View this entry on the original dictionary page scan.
abhyutpatanan. springing or leaping against any one View this entry on the original dictionary page scan.
acetanamfn. without consciousness, inanimate View this entry on the original dictionary page scan.
acetanamfn. unconscious, insensible, senseless, fainting, etc. View this entry on the original dictionary page scan.
adhastanamfn. lower, being underneath View this entry on the original dictionary page scan.
adhastanamfn. preceding (in a book). View this entry on the original dictionary page scan.
adhiketanamind. on a flag, View this entry on the original dictionary page scan.
adhivartanan. rolling on, View this entry on the original dictionary page scan.
adhivikartanan. the act of cutting off or cutting asunder View this entry on the original dictionary page scan.
adhunātanamf(ī-)n. belonging to or extending over the present time
adritanaf. "mountain-daughter", Name of pārvatī- View this entry on the original dictionary page scan.
adritanaf. Name of a metre (of four lines, each containing twenty-three syllables). View this entry on the original dictionary page scan.
adyatanamf(ī-)n. extending over or referring to to-day View this entry on the original dictionary page scan.
adyatanamf(ī-)n. now-a-days, modern View this entry on the original dictionary page scan.
adyatanam. the period of a current day, either from midnight to midnight, or from dawn to dark
adyatanabhūtam. the aorist. View this entry on the original dictionary page scan.
āgatanandin([or -gata-nardin- ]) mfn. (gaRa yuktārohy-ādi- q.v) View this entry on the original dictionary page scan.
āghātanan. a slaughter-house View this entry on the original dictionary page scan.
āghātanan. place of execution View this entry on the original dictionary page scan.
agnipatanan. throwing one's self into fire, View this entry on the original dictionary page scan.
agnyāyatanan. a fire-shrine, View this entry on the original dictionary page scan.
agretanamfn. occurring further on, subsequently (in a book). View this entry on the original dictionary page scan.
ahipūtanam. sores on the hinder part of the body (of children) View this entry on the original dictionary page scan.
aiṣamastanamfn. occurring in or relating to this year, of this year View this entry on the original dictionary page scan.
ajāgalastanam. nipple or fleshy protuberance on the neck of goats, an emblem of any useless or worthless object or person. View this entry on the original dictionary page scan.
akartanam. a dwarf View this entry on the original dictionary page scan.
ākāśānantyāyatanan. "abode of infinity or of infinite space", Name of a world View this entry on the original dictionary page scan.
ākāśānantyāyatanam. plural Name (also title or epithet) of a class of gods, (also tano- paga-, ) View this entry on the original dictionary page scan.
aketanamfn. houseless. View this entry on the original dictionary page scan.
ākiṃcanyāyatanan. "abode of absolute want of any existence","non-existence", Name of a world with Buddhists View this entry on the original dictionary page scan.
ākiṃcanyāyatanam. plural Name (also title or epithet) of a class of gods, (also tano- paga-, ). View this entry on the original dictionary page scan.
akṣapātanan. act of casting dice. View this entry on the original dictionary page scan.
akṣaprapātanan. casting glances, View this entry on the original dictionary page scan.
amīvacātanamf(ī-)n. driving away pains, diseases, or tormenting spirits View this entry on the original dictionary page scan.
amoghapatanamfn. "not falling in vain", reaching the aim View this entry on the original dictionary page scan.
anadyatanam. a tense (either past or future) not applicable to the current day View this entry on the original dictionary page scan.
ānartanan. the act of dancing towards or near, dancing View this entry on the original dictionary page scan.
anāyatanan. or an-āyatan/a- that which is not really a resting-place or an altar View this entry on the original dictionary page scan.
anāyatanagroundless, View this entry on the original dictionary page scan.
anāyatanamfn. (an-āyatan/a-) having no resting-place or altar View this entry on the original dictionary page scan.
anāyatanavatmfn. = the last View this entry on the original dictionary page scan.
aṅgakartanan. cutting off a limb. View this entry on the original dictionary page scan.
anīcaistanamfn. not low, View this entry on the original dictionary page scan.
anivartanamfn. not turning back or away, steadfast, improper to be abandoned, right. View this entry on the original dictionary page scan.
aṅkaparivartanan. turning the body, turning on the other side. View this entry on the original dictionary page scan.
antarikṣāyatanamfn. having its abode in the atmosphere View this entry on the original dictionary page scan.
anucintanan. thinking of, meditating upon, recalling, recollecting View this entry on the original dictionary page scan.
anucintanan. anxiety. View this entry on the original dictionary page scan.
anukīrtanan. the act of narrating or proclaiming or publishing. View this entry on the original dictionary page scan.
anupatanan. falling on or upon View this entry on the original dictionary page scan.
anupatanan. following View this entry on the original dictionary page scan.
anupatanan. (in mathem.) proportion. View this entry on the original dictionary page scan.
anupravartanan. urging to (locative case), View this entry on the original dictionary page scan.
anuvartanaetc. See anu-vṛt-. View this entry on the original dictionary page scan.
anuvartanan. obliging, serving or gratifying another View this entry on the original dictionary page scan.
anuvartanan. compliance, obedience View this entry on the original dictionary page scan.
anuvartanan. following, attending View this entry on the original dictionary page scan.
anuvartanan. concurring View this entry on the original dictionary page scan.
anuvartanan. consequence, result View this entry on the original dictionary page scan.
anuvartanan. continuance View this entry on the original dictionary page scan.
anuvartanan. supplying from a previous rule. View this entry on the original dictionary page scan.
anvāyatanamfn. latitudinal. View this entry on the original dictionary page scan.
apakartanan. cutting in pieces, dismembering, View this entry on the original dictionary page scan.
apakṛṣṭacetanamfn. mentally debased. View this entry on the original dictionary page scan.
aparāhṇatana([ ]) ([ ]) mfn. belonging to or produced at the close of the day. View this entry on the original dictionary page scan.
aparāhṇetana([ ]) mfn. belonging to or produced at the close of the day. View this entry on the original dictionary page scan.
apastanamfn. far from the mother's breast, View this entry on the original dictionary page scan.
āpatanan. happening, appearing View this entry on the original dictionary page scan.
āpatanan. coming, approaching View this entry on the original dictionary page scan.
āpatanan. reaching View this entry on the original dictionary page scan.
āpatanan. unexpected appearance (as from fate) View this entry on the original dictionary page scan.
apatanadharminmfn. not liable to fall out, View this entry on the original dictionary page scan.
apatanadharmin(n.) View this entry on the original dictionary page scan.
apavartanan. taking away, removal View this entry on the original dictionary page scan.
apavartanan. ademption View this entry on the original dictionary page scan.
apavartanan. reduction of a fraction to its lowest terms, division without remainder View this entry on the original dictionary page scan.
apavartanan. divisor. View this entry on the original dictionary page scan.
apāvartanan. turning away or from, retreat View this entry on the original dictionary page scan.
apāvartanan. repulse View this entry on the original dictionary page scan.
apravartanan. the act of refraining from, not engaging in View this entry on the original dictionary page scan.
apravartanan. not exciting to any action. View this entry on the original dictionary page scan.
āpravartanan. general outbreak (of perspiration), View this entry on the original dictionary page scan.
apunarāvartanan. final exemption from life or transmigration View this entry on the original dictionary page scan.
arāyacātanan. idem or 'n. anything that serves to destroy evil spirits ' View this entry on the original dictionary page scan.
aricintanan. plotting against an enemy, administration of foreign affairs View this entry on the original dictionary page scan.
arkatanayam. equals -ja- View this entry on the original dictionary page scan.
arkatanayam. the planet Saturn View this entry on the original dictionary page scan.
arkatanayam. Name of karṇa- View this entry on the original dictionary page scan.
arkatanayam. of manu- vaivasvata- and manu- sāvarṇi- View this entry on the original dictionary page scan.
arkatanaf. Name of the rivers yamunā- and tapatī- View this entry on the original dictionary page scan.
artanamfn. ( ṛt-), reviling ([ ; equals duhkhin- commentator or commentary ]) View this entry on the original dictionary page scan.
artanan. censure, blame View this entry on the original dictionary page scan.
ārtanamfn. ([connected with ār/āt-and ār/e- ]) uncultivated, waste, desert View this entry on the original dictionary page scan.
arthacintanan. attention or consideration of affairs View this entry on the original dictionary page scan.
arvāktanamf(ā-)n. being on this side of, not reaching up to View this entry on the original dictionary page scan.
āścotana n. aspersion, sprinkling View this entry on the original dictionary page scan.
āścotanan. applying (ghee etc.) to the eyelids View this entry on the original dictionary page scan.
āścyotanan. aspersion, sprinkling View this entry on the original dictionary page scan.
āścyotanan. applying (ghee etc.) to the eyelids View this entry on the original dictionary page scan.
asitanayanamfn. black-eyed. View this entry on the original dictionary page scan.
aśvaprapatanan. commentator or commentary View this entry on the original dictionary page scan.
aśvaprapatana nīya- (read prapad-) View this entry on the original dictionary page scan.
aśvastanamf(ī-)n. not for to-morrow, not provided for to-morrow View this entry on the original dictionary page scan.
aśvastanavidmfn. ignorant of the future View this entry on the original dictionary page scan.
aśvastanavidhānan. non-provision for the future (= ) . View this entry on the original dictionary page scan.
aśvastanavidhātṛmfn. not providing for the future View this entry on the original dictionary page scan.
atanam. a passer on View this entry on the original dictionary page scan.
atanan. act of passing on View this entry on the original dictionary page scan.
atanavatm. one who wanders View this entry on the original dictionary page scan.
atipatanan. act of falling or flying beyond, passing, missing, transgressing. View this entry on the original dictionary page scan.
atītanaukamfn. passed out of a ship, landed. View this entry on the original dictionary page scan.
ativartanan. a pardonable offence or misdemeanour. View this entry on the original dictionary page scan.
avadyotanan. illustrating View this entry on the original dictionary page scan.
avajyotanan. causing a light to shine upon, illumining View this entry on the original dictionary page scan.
avakartanan. cutting off, N. View this entry on the original dictionary page scan.
avapatanan. falling down, (see avarāvap-.) jaina- Prakrit ovaDaNa See śastrāvapāta-. View this entry on the original dictionary page scan.
avapātanan. felling, knocking or throwing down View this entry on the original dictionary page scan.
avapātanan. (in dramatical language) a scene during which a person enters the stage in terror but leaves it at the end in good humour View this entry on the original dictionary page scan.
avarāvapatanan. dropping of or discharge of the secundines, miscarriage View this entry on the original dictionary page scan.
āvartanamfn. turning round or towards View this entry on the original dictionary page scan.
āvartanamfn. revolving View this entry on the original dictionary page scan.
āvartanan. turning, turning round, returning View this entry on the original dictionary page scan.
āvartanan. circular motion, gyration, churning, stirring anything in fusion View this entry on the original dictionary page scan.
āvartanan. melting metals together, alligation View this entry on the original dictionary page scan.
āvartanan. the time when the sun begins to cast shadows towards the east or when shadows are cast in an opposite direction, noon View this entry on the original dictionary page scan.
āvartanan. year View this entry on the original dictionary page scan.
āvartanan. repeating, doing over again View this entry on the original dictionary page scan.
āvartanan. study, practising View this entry on the original dictionary page scan.
āvartanam. Name of an upa-dvīpa- in jambu-dvīpa- View this entry on the original dictionary page scan.
āvartanam. a magic art View this entry on the original dictionary page scan.
āvartanamaṇim. a gem of secondary order (generally known as rājāvarta-) View this entry on the original dictionary page scan.
avaśātanan. ( śad-, Causal) , withering, drying up View this entry on the original dictionary page scan.
avatāradvādaśakīrtanan. "giving an account of the twelve avatāra-s", Name of a chapter of the work ūrdhvāmnāya-saṃhitā-. View this entry on the original dictionary page scan.
avicetanamfn. unintelligible View this entry on the original dictionary page scan.
avicintanan. not thinking of View this entry on the original dictionary page scan.
ayamitanakhamfn. with untrimmed nails View this entry on the original dictionary page scan.
āyatanan. resting-place, support, seat, place, home, house, abode etc. View this entry on the original dictionary page scan.
āyatanan. the place of the sacred fire (equals agny-āyatana-) and View this entry on the original dictionary page scan.
āyatanan. an altar View this entry on the original dictionary page scan.
āyatanan. a shed for sacrifices View this entry on the original dictionary page scan.
āyatanan. a sanctuary etc. View this entry on the original dictionary page scan.
āyatanan. a plot of ground, the site of a house View this entry on the original dictionary page scan.
āyatanan. a barn View this entry on the original dictionary page scan.
āyatanan. the cause of a disease View this entry on the original dictionary page scan.
āyatanan. (with Buddhists) the five senses and manas- (considered as the inner seats or āyatana-s) and the qualities perceived by the above (the outer āyatana-s) . View this entry on the original dictionary page scan.
āyatanatvan. the state of being the site of, etc. View this entry on the original dictionary page scan.
āyatanavatmfn. having a seat or home View this entry on the original dictionary page scan.
āyatanavatm. (ān-) Name of the fourth foot of brahman- View this entry on the original dictionary page scan.
ayathādyotanan. intimation of something that should not be commentator or commentary View this entry on the original dictionary page scan.
bahutanayamfn. one who has many sons View this entry on the original dictionary page scan.
baladevapattanan. Name of a town View this entry on the original dictionary page scan.
bālatanayam. a young son View this entry on the original dictionary page scan.
bālatanayam. Acacia Catechu View this entry on the original dictionary page scan.
bhaganetranipātanam. "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhagnadantanakhamfn. having the teeth and claws broken View this entry on the original dictionary page scan.
bhāṣyapradīpoddyotanan. bhāṣyapradīpa
bhaṭṭārakāyatanan. a temple View this entry on the original dictionary page scan.
bhaviṣyadanadyatanam. not the same day in the future on View this entry on the original dictionary page scan.
bhittikhātanam. "wall-digger", a rat View this entry on the original dictionary page scan.
bhittipātanam. "wall-destroyer", a kind of rat View this entry on the original dictionary page scan.
bhogāyatanan. a place of enjoyments, View this entry on the original dictionary page scan.
bhogīndratanayam. patronymic of śāli-vāhana- View this entry on the original dictionary page scan.
bhrāntākulitacetanamfn. one whose mind is troubled by doubt or error View this entry on the original dictionary page scan.
bhrātṛvyacātanamfn. driving away rivals View this entry on the original dictionary page scan.
bhṛgupatanan. a fall from a precipice View this entry on the original dictionary page scan.
bhṛgutanaya() m. "son of bhṛgu-", the planet Venus. View this entry on the original dictionary page scan.
bhūmitanayam. the planet Mars View this entry on the original dictionary page scan.
bhūmitanayaTuesday, View this entry on the original dictionary page scan.
bhūtānadyatanam. not the current day in past time on View this entry on the original dictionary page scan.
bhūtanandam. Name of a king View this entry on the original dictionary page scan.
bhūtikīrtanan. "praise of prosperity", Name of chapter of View this entry on the original dictionary page scan.
bhūyaḥstana(bh/ūyaḥ--.) mfn. having more teats than (ablative) View this entry on the original dictionary page scan.
brahmacintananirākaraṇan. Name of work View this entry on the original dictionary page scan.
brahmāyatanan. a temple of brahmā- View this entry on the original dictionary page scan.
capeṭāpātanan. "id.", in compound capeṭāpātanātithi tithi- mfn. blown with the open hand View this entry on the original dictionary page scan.
caraṇapatanan. a foot-fall View this entry on the original dictionary page scan.
carmāvakartanan. "act of cutting leather", equals ma-karaṇa- View this entry on the original dictionary page scan.
tanamfn. ( cat-, Causal) in fine compositi or 'at the end of a compound' "driving away" See abhiśasti--, amīva--, arāya--, durṇāma--, piśāca--, bhrātṛvya--, yātu--, sadānvā--, and sapatna-c/ātana- View this entry on the original dictionary page scan.
tanam. Name of the ṛṣi- of the cātana- verses View this entry on the original dictionary page scan.
tanan. certain verses of the (for exorcising demons) View this entry on the original dictionary page scan.
cetanamf(-)n. visible, conspicuous, distinguished, excellent View this entry on the original dictionary page scan.
cetanamf(-)n. percipient, conscious, sentient, intelligent etc. View this entry on the original dictionary page scan.
cetanam. an intelligent being, man View this entry on the original dictionary page scan.
cetanam. soul, mind View this entry on the original dictionary page scan.
cetanan. conspicuousness View this entry on the original dictionary page scan.
cetanan. soul, mind View this entry on the original dictionary page scan.
cetanaetc. See View this entry on the original dictionary page scan.
cetanabhāvam. idem or 'n. idem or 'f. the state of a sentient or conscious being, intelligence.' ' View this entry on the original dictionary page scan.
cetanācetana plural sentient and unsentient beings View this entry on the original dictionary page scan.
cetanaf. equals nikā- View this entry on the original dictionary page scan.
cetanaf. equals nikā- View this entry on the original dictionary page scan.
cetanaf. the state of a sentient or conscious being, intelligence. View this entry on the original dictionary page scan.
cetanatvan. idem or 'f. the state of a sentient or conscious being, intelligence.' View this entry on the original dictionary page scan.
chandakanivartanan. " candaka-'s return", Name of a caitya-, View this entry on the original dictionary page scan.
chandakapātanam. a hypocrite View this entry on the original dictionary page scan.
chandapātanam. equals ndaka-p- View this entry on the original dictionary page scan.
chāyātanayam. "son of chāyā-", the planet Saturn View this entry on the original dictionary page scan.
cintanan. thinking, thinking of. reflecting upon View this entry on the original dictionary page scan.
cintanan. anxious thought View this entry on the original dictionary page scan.
cintanan. consideration View this entry on the original dictionary page scan.
cirantanamfn. (fr. raṃ-t-, ) idem or 'mfn. ancient ' View this entry on the original dictionary page scan.
cirantanamfn. existing from ancient times View this entry on the original dictionary page scan.
cirantanam. brahmā- View this entry on the original dictionary page scan.
cirantanam. śiva- View this entry on the original dictionary page scan.
cirantanam. plural the ancients View this entry on the original dictionary page scan.
dahanaketanam. "mark of burning", smoke View this entry on the original dictionary page scan.
daivacintanan. () fatalism or astrology. View this entry on the original dictionary page scan.
daṇḍanipātanaapplication of the rod, punishing (with genitive case) View this entry on the original dictionary page scan.
daṇḍapātanan. equals -nip- View this entry on the original dictionary page scan.
daśaśatanayanam. "thousand-eyed", indra- View this entry on the original dictionary page scan.
dāyāpavartanan. forfeiture of property View this entry on the original dictionary page scan.
dehapatanan. () "decay of the body", death. View this entry on the original dictionary page scan.
devapattanan. Name of a town View this entry on the original dictionary page scan.
devatāyatana(y-) n. equals -gṛha- View this entry on the original dictionary page scan.
devāyatanan. "the dwelling of a god", a temple View this entry on the original dictionary page scan.
devyāyatanan. equals -dhāman- View this entry on the original dictionary page scan.
dhānyakartanan. "corn-reaping", Name of chapter of View this entry on the original dictionary page scan.
dharmacakrapravartanan. setting in motion the wheel of the law, ibidem or 'in the same place or book or text' as the preceding ; View this entry on the original dictionary page scan.
dharmacintanan. () consideration of the law or duty, virtuous reflection. View this entry on the original dictionary page scan.
dharmapattanan. "the city of the law", Name of the city of śrāvastī- (varia lectio pattana- ) View this entry on the original dictionary page scan.
dharmapattanan. pepper View this entry on the original dictionary page scan.
dhārmapattanan. black pepper View this entry on the original dictionary page scan.
dharmāyatanan. the sphere or objects of manas- View this entry on the original dictionary page scan.
dhūmaketanam. "smoke-marked", fire View this entry on the original dictionary page scan.
dhūmaketanam. meteor, a comet View this entry on the original dictionary page scan.
dhūmaketanam. ketu- or the personified descending node View this entry on the original dictionary page scan.
dhūrtanartakan. Name of a drama. View this entry on the original dictionary page scan.
dīnacetanamfn. "distressed in mind", dejected View this entry on the original dictionary page scan.
dinakaratanayam. "son of the sun", the planet Saturn View this entry on the original dictionary page scan.
dīptanayanam. "having glittering eyes", Name of an owl View this entry on the original dictionary page scan.
dititanayam. equals -ja- View this entry on the original dictionary page scan.
divātana(t-) mfn. idem or 'mfn. idem or 'mfn. going by day ' ' m. a crow View this entry on the original dictionary page scan.
divātanam. a crow View this entry on the original dictionary page scan.
divātanamf(ī-)n. () daily, diurnal View this entry on the original dictionary page scan.
dornikartanan. amputation of the arm View this entry on the original dictionary page scan.
doṣātanamf(ī-)n. (fr. doṣā- ind.) nocturnal, at evening View this entry on the original dictionary page scan.
drohacintanan. injurious design View this entry on the original dictionary page scan.
dugdhābdhitanaf. Name of lakṣmi- View this entry on the original dictionary page scan.
dūrapātanan. the act of shooting to a distance View this entry on the original dictionary page scan.
durghaṭaghātanamn. Name of Comm. View this entry on the original dictionary page scan.
durṇāmacātanamfn. driving away the demons called durṇāman- View this entry on the original dictionary page scan.
durniṣprapatanan. (wrongly written tara-), View this entry on the original dictionary page scan.
duṣpatanan. falling badly View this entry on the original dictionary page scan.
dyotana mf(ā-or ī-)n. shining, glittering View this entry on the original dictionary page scan.
dyotanamf(ā-or ī-)n. illuminating, enlightening (see kha--) View this entry on the original dictionary page scan.
dyotanamf(ā-or ī-)n. explaining, meaning View this entry on the original dictionary page scan.
dyotanam. a lamp View this entry on the original dictionary page scan.
dyotanam. Name of a man () View this entry on the original dictionary page scan.
dyotanan. shining, being bright View this entry on the original dictionary page scan.
dyotanan. illumination View this entry on the original dictionary page scan.
dyotanan. making manifest, explaining, showing View this entry on the original dictionary page scan.
dyotanan. seeing, sight View this entry on the original dictionary page scan.
dyotanamf(ā-or ī-)n. shining, glittering View this entry on the original dictionary page scan.
dyotanamf(ā-or ī-)n. illuminating, enlightening (see kha--) View this entry on the original dictionary page scan.
dyotanamf(ā-or ī-)n. explaining, meaning View this entry on the original dictionary page scan.
dyotanam. a lamp View this entry on the original dictionary page scan.
dyotanam. Name of a man () View this entry on the original dictionary page scan.
dyotanan. shining, being bright View this entry on the original dictionary page scan.
dyotanan. illumination View this entry on the original dictionary page scan.
dyotanan. making manifest, explaining, showing View this entry on the original dictionary page scan.
dyotanan. seeing, sight View this entry on the original dictionary page scan.
dyotanaSee hrid-d-. View this entry on the original dictionary page scan.
dyotanakamf(ikā-)n. making manifest, explaining View this entry on the original dictionary page scan.
ekacintanan. unanimous or joint consideration View this entry on the original dictionary page scan.
etanam. expiration, breathing out, discharging air from the lungs View this entry on the original dictionary page scan.
etanam. the fish Silurus Pelorius View this entry on the original dictionary page scan.
galitanakhamfn. having the claws or nails fallen off View this entry on the original dictionary page scan.
galitanakhadantamfn. one who has lost his claws and teeth View this entry on the original dictionary page scan.
galitanayanamfn. one who has lost his eyes, blind, View this entry on the original dictionary page scan.
garbhapātanam. (equals taka-) a variety of karañja- View this entry on the original dictionary page scan.
garbhapātanam. equals -nud- View this entry on the original dictionary page scan.
garbhapātanan. causing miscarriage View this entry on the original dictionary page scan.
garbhaśātanan. the procuring abortion View this entry on the original dictionary page scan.
garbhaśātanan. a drug procuring abortion View this entry on the original dictionary page scan.
gārhapatyāyatanan. idem or 'm. idem or 'n. the place where the gārhapatya- fire is kept ' ' , 8, 24. View this entry on the original dictionary page scan.
gatacetanamfn. deprived of sense or consciousness, senseless, void of understanding, fainted away View this entry on the original dictionary page scan.
ghatanaSee ghāt-. View this entry on the original dictionary page scan.
ghātanamfn. killing (also ghat-) View this entry on the original dictionary page scan.
ghātanam. Name of an inhabitant of a hell View this entry on the original dictionary page scan.
ghātanan. slaying, killing, slaughter, immolating View this entry on the original dictionary page scan.
ghātanakṣatran. an inauspicious nakṣatra- View this entry on the original dictionary page scan.
ghātanasthānan. a slaughter-house View this entry on the original dictionary page scan.
ghṛtapātrastanavatīf. (a cow) whose nipples are represented by vessels filled with ghee View this entry on the original dictionary page scan.
golāṅgulaparivartanam. Name of a mountain near rāja-gṛha- (varia lectio golī-gulap-). View this entry on the original dictionary page scan.
golīgulaparivartanafor go-lāṅg- View this entry on the original dictionary page scan.
gostanam. a cow's dug View this entry on the original dictionary page scan.
gostanam. a cluster of blossoms, nosegay View this entry on the original dictionary page scan.
gostanam. a pearl necklace consisting of 4 (or of 34 ) strings View this entry on the original dictionary page scan.
gostanam. a kind of fort View this entry on the original dictionary page scan.
gṛhītavetanamfn. one who has received his wages, paid View this entry on the original dictionary page scan.
guṇakīrtanan. telling the merits View this entry on the original dictionary page scan.
guṇasaṃkīrtanan. celebration of qualities (edition Gorr.) View this entry on the original dictionary page scan.
guṇotkīrtanan. equals ṇa-kīrt- View this entry on the original dictionary page scan.
haṃsakālītanayam. a buffalo (See kālī-t-) View this entry on the original dictionary page scan.
haṃsaprapatanan. Name of a tīrtha- View this entry on the original dictionary page scan.
hanumatkīrtanan. Name of work View this entry on the original dictionary page scan.
harāyatanan. a temple of śiva- View this entry on the original dictionary page scan.
harikīrtanan. Name of a stotra-. View this entry on the original dictionary page scan.
harisaṃkīrtanan. the act of pronouncing or repeating the name of viṣṇu- (supposed to possess great efficacy) View this entry on the original dictionary page scan.
harisaṃkīrtanan. Name of work View this entry on the original dictionary page scan.
himādritanaf. "daughter of himālaya-", parvatī- ( himādritanayapati -pati- m."husband of parvatī-", śiva-) View this entry on the original dictionary page scan.
himādritanaf. the Ganges View this entry on the original dictionary page scan.
himādritanayapatim. himādritanayā
himakaratanayam. "son of the Moon", Name of the planet Mercury View this entry on the original dictionary page scan.
hṛcchayāviṣṭacetanamfn. having a heart penetrated by love View this entry on the original dictionary page scan.
hṛdayodvartanam. "heart-splitting", Name of a demon View this entry on the original dictionary page scan.
hṛddyotanamfn. (see 3. dyut-) breaking or crushing the heart View this entry on the original dictionary page scan.
hṛdyotanaSee hṛd-dy-. View this entry on the original dictionary page scan.
hṛṣṭacetana () mfn. rejoiced in heart. View this entry on the original dictionary page scan.
hyastanamf(ī-)n. hesternal, belonging to or produced or occurred yesterday View this entry on the original dictionary page scan.
hyastanadinan. the day just past, yesterday View this entry on the original dictionary page scan.
idamtanamfn. being now, living in this time commentator or commentary on View this entry on the original dictionary page scan.
idānīṃtanamf(ī-)n. present, modern, momentary, of the present moment View this entry on the original dictionary page scan.
idānīṃtanatvan. the being momentary commentator or commentary on View this entry on the original dictionary page scan.
indrāyatanamfn. depending on indra- View this entry on the original dictionary page scan.
indriyāyatanan. the residence of the senses View this entry on the original dictionary page scan.
indriyāyatanan. the body View this entry on the original dictionary page scan.
jahnutanaf. idem or 'f. (hnoḥ k- )' View this entry on the original dictionary page scan.
jaināyatanan. a jaina- monastery View this entry on the original dictionary page scan.
jalapattanan. a water-down (forming an island), Sil. View this entry on the original dictionary page scan.
jalayantraniketanan. equals -gṛha- View this entry on the original dictionary page scan.
janakatanaf. " janaka-'s daughter", sitā- View this entry on the original dictionary page scan.
tanaṣṭamfn. (no sooner) appeared (than) disappeared View this entry on the original dictionary page scan.
jhaṣaketanam. equals -dhvaja- , View this entry on the original dictionary page scan.
jhaṣaketanam. "the god of love"and"the sea" View this entry on the original dictionary page scan.
jñātanandanam. "son of the jñāta- family", mahā-vīra- View this entry on the original dictionary page scan.
jvalitanayanamfn. idem or 'mfn. fiery-eyed, looking angrily or fiercely ' View this entry on the original dictionary page scan.
kailāsaniketanam. "having his abode on the kailāsa-", Name of śiva- View this entry on the original dictionary page scan.
kalindatanaf. idem or 'f. Name (also title or epithet) of the river yamunā-, ' View this entry on the original dictionary page scan.
kālītanayam. "son (or favourite) of durgā-", a buffalo (see haṃsakālī-t-.) View this entry on the original dictionary page scan.
kanīyaḥstanamfn. having fewer teats, View this entry on the original dictionary page scan.
kapiketanam. "having a monkey as symbol", Name of arjuna- (the third son of pāṇḍu-) View this entry on the original dictionary page scan.
kapītanam. Spondias Mangifera View this entry on the original dictionary page scan.
kapītanam. Thespesia Populnea View this entry on the original dictionary page scan.
kapītanam. Acacia Sirisa View this entry on the original dictionary page scan.
kapītanam. Ficus Religiosa View this entry on the original dictionary page scan.
kapītanam. Areca Faufel View this entry on the original dictionary page scan.
kapītanam. Aegle Marmelos View this entry on the original dictionary page scan.
karketanam. idem or 'm. a species of quartz ' View this entry on the original dictionary page scan.
kartanan. the act of cutting off, excision etc. View this entry on the original dictionary page scan.
kartanan. the act of extinguishing, extinction View this entry on the original dictionary page scan.
kartanan. (2. kṛt-), the act of spinning cotton or thread View this entry on the original dictionary page scan.
kartanabhānḍan. idem or 'n. (2. kṛt-), the act of spinning cotton or thread ', lexicographers (i.e. a word or meaning which although give in native lexicons, has not yet been met with in any published text) View this entry on the original dictionary page scan.
kartanasādhanan. a spindle View this entry on the original dictionary page scan.
kaṭapūtanamf(ā-) a kind of preta- (q.v) or demon (a form assumed by the deceased spirit of a kṣatriya- who when alive neglected his duties)
kāyamānikaniketanan. idem or 'n. a hut made of grass or thatch ' , View this entry on the original dictionary page scan.
keliniketanan. equals -gṛha- View this entry on the original dictionary page scan.
kenipātanan. idem or 'm. idem or 'm. the helm, rudder, large oar used as a rudder ' ' View this entry on the original dictionary page scan.
ketanan. a summons, invitation View this entry on the original dictionary page scan.
ketanan. a house, abode View this entry on the original dictionary page scan.
ketanan. "abode of the soul", the body (in fine compositi or 'at the end of a compound' f(ā-).) View this entry on the original dictionary page scan.
ketanan. place, site View this entry on the original dictionary page scan.
ketanan. sign, mark, symbol (of a deity), ensign (of a warrior), flag or banner (e gaRa vānara-k-,"one who has a monkey as his ensign or arms" ;See also makara-k-,etc.) View this entry on the original dictionary page scan.
ketanan. business, indispensable act View this entry on the original dictionary page scan.
ketana taya-, etc. See k/eta-. View this entry on the original dictionary page scan.
khadyotanam. "sky-illuminator", the sun View this entry on the original dictionary page scan.
kharaghātanam. "destroying asses", Mesua ferrea View this entry on the original dictionary page scan.
kharāṃśutanayam. "son of the sun", the planet Saturn. View this entry on the original dictionary page scan.
khātanamfn. See bhitti-kh-. View this entry on the original dictionary page scan.
kīrtanan. mentioning, repeating, saying, telling etc. View this entry on the original dictionary page scan.
kīrtanaa monument, View this entry on the original dictionary page scan.
kīrtanaa temple, View this entry on the original dictionary page scan.
klītanakan. a variety of the sweet root plant View this entry on the original dictionary page scan.
kḷptanakhamfn. having the nails cut or arranged View this entry on the original dictionary page scan.
kravyaghātanam. "killed for its flesh (see ) ", a deer, antelope View this entry on the original dictionary page scan.
krīḍāketanan. a pleasure-house View this entry on the original dictionary page scan.
kṛntanan. cutting, cutting off, dividing (see tantu--, śiraḥ--.) View this entry on the original dictionary page scan.
kṛṣṇakīrtanan. "praise of kṛṣṇa-", Name of a work. View this entry on the original dictionary page scan.
kṛtanakhamfn. one who has cleaned his nails View this entry on the original dictionary page scan.
kṛtanandanam. Name of a prince View this entry on the original dictionary page scan.
kṛtavetanamfn. one who receives wages (as a hired servant or labourer) View this entry on the original dictionary page scan.
kṣamātanayam. "son of the earth", the planet Mars View this entry on the original dictionary page scan.
kṣīrābdhitanaf. equals -- View this entry on the original dictionary page scan.
kṣīrodatanaf. (equals --) Name of lakṣmī- (in compound -pati-,"the husband of lakṣmī-", i.e. viṣṇu-) View this entry on the original dictionary page scan.
kṣititanayam. (equals -ja-) Name of the planet Mars View this entry on the original dictionary page scan.
kṣititanaf. "daughter of the earth", Name of sitā- View this entry on the original dictionary page scan.
kṣititanayadinan. Tuesday View this entry on the original dictionary page scan.
kṣititanayadivasavāram. idem or 'n. Tuesday ' View this entry on the original dictionary page scan.
kulapatanan. decay or disgrace of a family View this entry on the original dictionary page scan.
kutanayam. a degenerate son
kutanayaSee 1. ku-. View this entry on the original dictionary page scan.
laghucintanan. Name of work View this entry on the original dictionary page scan.
laghupatanakam. "quickly flying", Name of a crow View this entry on the original dictionary page scan.
lakṣmīniketanan. the bathing with fragrant myrobalan powder View this entry on the original dictionary page scan.
lohitanayanamfn. red-eyed, having eyes reddened with anger or passion View this entry on the original dictionary page scan.
lokavartanan. the means by which the world subsists View this entry on the original dictionary page scan.
lokāyatana(l) m. a materialist View this entry on the original dictionary page scan.
lomasātanan. "hair-remover", a depilatory View this entry on the original dictionary page scan.
lomasātana wrong reading for śātana- above View this entry on the original dictionary page scan.
madhusūdanāyatanan. a temple of viṣṇu- View this entry on the original dictionary page scan.
madirāyatanayanāf. a mistress with fascinating and lovely eyes View this entry on the original dictionary page scan.
mahākīrtanan. a house View this entry on the original dictionary page scan.
mahāmaheśvarāyatanan. a particular region of the gods View this entry on the original dictionary page scan.
mahāvartanan. high wages, large pay or allowance View this entry on the original dictionary page scan.
mahāyantrapravartanan. the engaging in or erecting great mechanical works View this entry on the original dictionary page scan.
mahīpatanan. prostration on the ground, humble obeisance View this entry on the original dictionary page scan.
makaraketanam. "having the makara- for an emblem"or"having a fish on his banner", Name of kāma-deva- View this entry on the original dictionary page scan.
makaravibhūṣaṇaketanam. "having the makara- for a characteristic ornament", Name of kāma-deva- View this entry on the original dictionary page scan.
maṇiniryātanan. the restitution of a jewel View this entry on the original dictionary page scan.
mañjupattanan. Name of a town built by mañju-śrī- View this entry on the original dictionary page scan.
manmathāyatanan. "love's abode", pudendum muliebre View this entry on the original dictionary page scan.
manujottanam. best of men View this entry on the original dictionary page scan.
marīcipattanan. Name of a town View this entry on the original dictionary page scan.
maruprapatanan. the act of throwing one's self from a rock (printed marut-pr-). View this entry on the original dictionary page scan.
maruttanayam. "son of the Wind", Name of hanumat- View this entry on the original dictionary page scan.
maruttanayam. of bhīma- View this entry on the original dictionary page scan.
maṭhāyatanan. a monastery, college View this entry on the original dictionary page scan.
mātṛkārthacintana(rth-) n. View this entry on the original dictionary page scan.
mithyāvadhyānukīrtanan. the proclaiming that any one has been unjustly sentenced to death View this entry on the original dictionary page scan.
mrātanan. Cyperus Rotundus View this entry on the original dictionary page scan.
mṛgaketanam. the moon, View this entry on the original dictionary page scan.
mṛgāṅkatanayam. Name of the planet Mercury commentator or commentary View this entry on the original dictionary page scan.
mṛtanandanam. a kind of hall with 58 pillars View this entry on the original dictionary page scan.
mūḍhacetana mfn. bewildered in mind, foolish, silly View this entry on the original dictionary page scan.
mugdhakāntāstanam. the bosom of a young mistress View this entry on the original dictionary page scan.
muhustanaisind. at repeated intervals, repeatedly, constantly
mukulitanayanamf(ā-)n. having half-closed eyes View this entry on the original dictionary page scan.
mūlanikṛntanamf(ī-)n. "cutting away the roots", utterly destroying View this entry on the original dictionary page scan.
mūlāyatanan. an original residence View this entry on the original dictionary page scan.
mūlotpātanan. the digging up of roots View this entry on the original dictionary page scan.
mūlotpātanajīvim. one who lives by digging for roots View this entry on the original dictionary page scan.
munitanaf. a muni-'s daughter View this entry on the original dictionary page scan.
muracīpattanan. Name of a town in the Dekhan (also called marīci-pattana-). View this entry on the original dictionary page scan.
muṣṭipraśnacintanan. Name of work View this entry on the original dictionary page scan.
mūtrapatanam. the civet cat View this entry on the original dictionary page scan.
nabhaḥketanam. "sky-banner", the sun View this entry on the original dictionary page scan.
nābhikṛntanan. the cutting of the navel-string View this entry on the original dictionary page scan.
naivasaṃjñānāsaṃjñānāyatanan. a place where there is no thinking and no not-thinking View this entry on the original dictionary page scan.
nakhanikṛntanam. or n. nail-scissors View this entry on the original dictionary page scan.
nakraketanam. Name of the god of love (see makara-k-). View this entry on the original dictionary page scan.
nāmakīrtanan. mentioning the name of (genitive case) View this entry on the original dictionary page scan.
nāmakīrtanan. (especially) incessant repetition of the name of a god View this entry on the original dictionary page scan.
nāmakīrtanamāhātmyan. Name of work View this entry on the original dictionary page scan.
nāmasaṃkīrtanan. the glorification or incessant repetition of the name of a god View this entry on the original dictionary page scan.
nāmasaṃkīrtanan. Name of chapter of View this entry on the original dictionary page scan.
nandinītanayam. metron. of vyāḍi- (see above) . View this entry on the original dictionary page scan.
nārīpattanan. Name of a town View this entry on the original dictionary page scan.
nartanam. (initial n-not changeable to - gaRa kṣubhnādi-) dancer View this entry on the original dictionary page scan.
nartanan. dancing, acting (metric. also f(ā-).; see -gṛha-,below). View this entry on the original dictionary page scan.
nartananirṇayam. Name of work View this entry on the original dictionary page scan.
nartanapriyam. "fond of dancing", a peacock View this entry on the original dictionary page scan.
nartanaśālāf. dancing-room View this entry on the original dictionary page scan.
nartanasthānan. dancing-place. View this entry on the original dictionary page scan.
naṣṭacetanamfn. one who has lost consciousness, insensible View this entry on the original dictionary page scan.
nautanamfn. (fr. and) equals nūtana- View this entry on the original dictionary page scan.
nīcaistanamfn. low, View this entry on the original dictionary page scan.
nihitanayanamf(ā-)n. having the eyes fixed or directed upon (locative case) View this entry on the original dictionary page scan.
nikartanamfn. cutting away, robbing, impoverishing () View this entry on the original dictionary page scan.
nikartanan. cutting down or off View this entry on the original dictionary page scan.
nikartanan. plucking, impoverishing (See above) . View this entry on the original dictionary page scan.
niketanan. a house, mansion, habitation, temple, etc. View this entry on the original dictionary page scan.
niketanam. an onion View this entry on the original dictionary page scan.
nikṛntanamf(ī-)n. cutting down or off, destroying (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
nikṛntanam. Name of a hell View this entry on the original dictionary page scan.
nikṛntanan. cutting, cutting off (hair, the neck etc.) View this entry on the original dictionary page scan.
nikṛntanan. massacring, destruction (of enemies) View this entry on the original dictionary page scan.
nikṛntanan. an instrument for cutting (see nakha--). View this entry on the original dictionary page scan.
nimīlitanakṣatramfn. having the stars obscured (as the sky) View this entry on the original dictionary page scan.
nimittanaimittikan. dual number cause and effect View this entry on the original dictionary page scan.
nipatanan. falling down, falling, descending View this entry on the original dictionary page scan.
nipatanan. (garbhiṇyāgarbhasya-) the lying-in of a pregnant woman View this entry on the original dictionary page scan.
nipatanan. flying View this entry on the original dictionary page scan.
nipātanamfn. (fr. Causal) throwing down, killing, destroying, knocking out (an eye)
nipātanan. causing to descend or fall, throwing down, letting drop or sink (see daṇḍa-n-) View this entry on the original dictionary page scan.
nipātanan. putting on, applying (as a knife), touching with (compound) View this entry on the original dictionary page scan.
nipātanan. overthrowing, destroying, killing View this entry on the original dictionary page scan.
nipātanan. (in gram.) accidental mention or use of a word, putting down as an irregularity View this entry on the original dictionary page scan.
nipātanan. an irregular form or exception View this entry on the original dictionary page scan.
nipātanan. equals ni-patana-, falling down (of a fire-brand) View this entry on the original dictionary page scan.
nipātanan. alighting (said of a bird) View this entry on the original dictionary page scan.
nirapavartanamfn. not to be divided by a common divisor View this entry on the original dictionary page scan.
nirghātanan. forcing out, bringing out View this entry on the original dictionary page scan.
nirvartanan. completion, execution View this entry on the original dictionary page scan.
nirvartanan. varia lectio for niv-. View this entry on the original dictionary page scan.
nirvetanamfn. unsalaried View this entry on the original dictionary page scan.
niryātanan. giving back, returning, restoring, delivery of a deposit, replacing anything lost, payment of a debt (with genitive case or compound; see vaira--) etc. View this entry on the original dictionary page scan.
niryātanan. gift, donation View this entry on the original dictionary page scan.
niryātanan. revenge, killing, slaughter View this entry on the original dictionary page scan.
niścetanamfn. unconscious, unreasonable etc. View this entry on the original dictionary page scan.
niścetanaf. View this entry on the original dictionary page scan.
niṣpatanan. rushing out, issuing quickly View this entry on the original dictionary page scan.
nivartanamfn. causing to turn back View this entry on the original dictionary page scan.
nivartanan. turning back, returning, turning the back id est retreating, fleeing etc. (mṛtyuṃ kṛtvā nivartanam-,making retreat equivalent to death id est desisting from fighting only in death ; wrong reading kṛtvā mṛtyu-niv-) View this entry on the original dictionary page scan.
nivartanan. ceasing, not happening or occurring, being prevented etc. View this entry on the original dictionary page scan.
nivartanan. desisting or abstaining from (ablative) View this entry on the original dictionary page scan.
nivartanan. desisting from work, inactivity (opp. to pra-vartana-) View this entry on the original dictionary page scan.
nivartanan. causing to return, bringing back (especially the shooting off and bringing back of weapons) View this entry on the original dictionary page scan.
nivartanan. turning back (the hair) View this entry on the original dictionary page scan.
nivartanan. a means of returning View this entry on the original dictionary page scan.
nivartanan. averting or keeping back from (ablative) View this entry on the original dictionary page scan.
nivartanan. reforming, repenting View this entry on the original dictionary page scan.
nivartanan. a measure of land (20 rods or 200 cubits or 40,000 hasta-s square) View this entry on the original dictionary page scan.
nivartanastūpam. Name of a stūpa- erected at the spot where the charioteer of buddha- returned. View this entry on the original dictionary page scan.
niyātana wrong reading for ni-pātana-. View this entry on the original dictionary page scan.
tanamf(ā-)n. (fr. 1. n/u-,or n/ū-), belonging to"now"or the present day, new, novel, recent, modern, young, fresh (opp. to pūrva-, purāṇa-etc.) etc. View this entry on the original dictionary page scan.
tanan. (with vayas- n.youth, juvenility ) View this entry on the original dictionary page scan.
tanamf(ā-)n. new id est curious, strange View this entry on the original dictionary page scan.
tanagajārohaprakāram. Name of work View this entry on the original dictionary page scan.
tanamūrtipratiṣṭhāf. Name of work View this entry on the original dictionary page scan.
tanapratiṣṭhāprayogam. Name of work View this entry on the original dictionary page scan.
tanaśrutigītāvyākhyāf. Name of work View this entry on the original dictionary page scan.
tanaf. View this entry on the original dictionary page scan.
tanatarif. Name of commentator or commentary on the rasa-taraṃgiṇī-, View this entry on the original dictionary page scan.
tanatvan. newness, novelty View this entry on the original dictionary page scan.
tanayaNom. P. yati-, to make new, renew View this entry on the original dictionary page scan.
tanayauvanamfn. young, fresh View this entry on the original dictionary page scan.
pādapatanan. falling or bowing to another's feet, View this entry on the original dictionary page scan.
padmaketanam. Name of a son of garuḍa- View this entry on the original dictionary page scan.
palāśaśātanam. an instrument for lopping foliage View this entry on the original dictionary page scan.
pallīpatanan. (prob.) prognostication by observing the falling of house-lizards View this entry on the original dictionary page scan.
pallīpatanakārikāf. Name of work View this entry on the original dictionary page scan.
pallīpatanaphalan. Name of work View this entry on the original dictionary page scan.
pallīpatanaśāntif. Name of work View this entry on the original dictionary page scan.
pallīpatanavicāram. Name of work View this entry on the original dictionary page scan.
pañcakālapravartanan. Name of work View this entry on the original dictionary page scan.
pañcāyatanan. Name of a particular ceremony (at which 5 symbols are used) View this entry on the original dictionary page scan.
pañcāyatanapaddhatif. Name of work View this entry on the original dictionary page scan.
pañcāyatanapratiṣṭhāpaddhatif. Name of work View this entry on the original dictionary page scan.
paracchandānuvartanan. paracchanda
parāghātanan. ( han-, Causal) place of execution, slaughter-house View this entry on the original dictionary page scan.
parāvartanan. turning back or round View this entry on the original dictionary page scan.
paricartanaSee pari-cṛt-. View this entry on the original dictionary page scan.
paricartanan. plural the part of a horse's harness from the girth to the breast and the tail View this entry on the original dictionary page scan.
parighātanan. idem or 'm. a club, an iron bludgeon ' View this entry on the original dictionary page scan.
parikartanamfn. cutting up or to pieces View this entry on the original dictionary page scan.
parikartanan. cutting, cutting off or out, a circular incision View this entry on the original dictionary page scan.
parikartanan. equals next View this entry on the original dictionary page scan.
parikīrtanan. proclaiming, announcing, talking of, boasting, naming, calling View this entry on the original dictionary page scan.
parinartanan. ( nṛt-) gaRa kṣubhnādi-. View this entry on the original dictionary page scan.
paripatanan. flying round or about View this entry on the original dictionary page scan.
parivartanamf(ī-)n. causing to turn round View this entry on the original dictionary page scan.
parivartanan. turning or whirling round, moving to and fro (trans. and intrans.) View this entry on the original dictionary page scan.
parivartanan. rolling about or wallowing on (compound) View this entry on the original dictionary page scan.
parivartanan. revolution, end of a period of time View this entry on the original dictionary page scan.
parivartanan. barter, exchange View this entry on the original dictionary page scan.
parivartanan. cutting or clipping the hair View this entry on the original dictionary page scan.
parivartanan. protecting, defending View this entry on the original dictionary page scan.
parivartanan. equals preraṇa- View this entry on the original dictionary page scan.
parivartanan. inverting, taking or putting anything in a wrong direction View this entry on the original dictionary page scan.
parivartanan. requital, return View this entry on the original dictionary page scan.
pārśvaparivartanan. "turning round", Name of a festival on the 11th day of the light half of the month bhādra- (on which viṣṇu- is supposed to turn upon the other side in his sleep) View this entry on the original dictionary page scan.
pārvatīpravartanan. Name of work View this entry on the original dictionary page scan.
paryāptanayanamfn. having a sufficient number of eyes View this entry on the original dictionary page scan.
paryāvartanam. Name of a hell View this entry on the original dictionary page scan.
paryāvartanan. coming back, returning View this entry on the original dictionary page scan.
patanamfn. who or what flies or falls View this entry on the original dictionary page scan.
patanam. Name of a rākṣasa- View this entry on the original dictionary page scan.
patanan. the act of flying or coming down, alighting, descending, throwing one's self down at or into (locative case or compound) etc. View this entry on the original dictionary page scan.
patanan. setting (as the sun) View this entry on the original dictionary page scan.
patanan. going down (to hell) View this entry on the original dictionary page scan.
patanan. hanging down, becoming flaccid (said of the breasts) View this entry on the original dictionary page scan.
patanan. fall, decline, ruin, death View this entry on the original dictionary page scan.
patanan. loss of caste, apostacy View this entry on the original dictionary page scan.
patanan. (with garbhasya-) miscarriage View this entry on the original dictionary page scan.
patanan. (in arithmetic) subtraction View this entry on the original dictionary page scan.
patanan. (in astronomy) the latitude of a planet View this entry on the original dictionary page scan.
tanamf(ī-)n. (fr. Causal) causing to fall, felling, laying low, striking off or down (with genitive case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
tanan. the act of causing to fall etc. View this entry on the original dictionary page scan.
tanan. lowering, humbling View this entry on the original dictionary page scan.
tanan. the act of casting (as dice or a glance of the eyes) (see akṣa--) View this entry on the original dictionary page scan.
tanan. (with daṇḍasya-) causing the rod to fall, chastising, punishing View this entry on the original dictionary page scan.
tanan. (with garbhasya-) causing the fall of the fetus or abortion View this entry on the original dictionary page scan.
tanan. (with jalaukasām-) application of leeches View this entry on the original dictionary page scan.
tanan. removing, bringing away View this entry on the original dictionary page scan.
tanan. causing to fall asunder, dividing View this entry on the original dictionary page scan.
tanan. Name of a particular process to which minerals (especially quicksilver) are subjected View this entry on the original dictionary page scan.
patanadharminmfn. what is likely to fall out or off ( patanadharmitva mi-tva- n.) View this entry on the original dictionary page scan.
patanadharmitvan. patanadharmin
patanasīlamfn. accustomed to fall down View this entry on the original dictionary page scan.
patatriketanamfn. "characterised by a bird", (with deva-) Name of viṣṇu- View this entry on the original dictionary page scan.
pattanam. plural Name of a people View this entry on the original dictionary page scan.
pattanan. (in fine compositi or 'at the end of a compound' f(ā-).) a town, city (see dharma--and paṭṭana-). View this entry on the original dictionary page scan.
pattanavaṇijm. a town-tradesman View this entry on the original dictionary page scan.
pautanam. (fr. pūtanā-?) Name of a country or people (Scholiast or Commentator equals mathurā-pradeśa-). View this entry on the original dictionary page scan.
pavanatanayam. equals -ja- View this entry on the original dictionary page scan.
pavanatanayam. Name of bhīmasena- View this entry on the original dictionary page scan.
phalapātanan. knocking down or gathering fruit View this entry on the original dictionary page scan.
phalastanavatīf. (a female) having fruits for breasts View this entry on the original dictionary page scan.
pīnastanam. the full breast (of a woman) View this entry on the original dictionary page scan.
piśācacātanamfn. driving away piśāca-s View this entry on the original dictionary page scan.
tanam. a species of tree (Spondias Mangifera Pentaptera Tomentosa or Ficus Infectoria) View this entry on the original dictionary page scan.
tanan. orpiment View this entry on the original dictionary page scan.
tanan. saffron View this entry on the original dictionary page scan.
tanan. Pinus Deodora View this entry on the original dictionary page scan.
tanakam. Spondias Mangifera View this entry on the original dictionary page scan.
potanan. Name of a town View this entry on the original dictionary page scan.
pracetanamfn. illumining, illustrating View this entry on the original dictionary page scan.
pracetanaetc. See pra-cit-. View this entry on the original dictionary page scan.
pradattanayanotsavamfn. pradatta
pradyotanam. the sun View this entry on the original dictionary page scan.
pradyotanam. Name of a prince of ujjayinī- View this entry on the original dictionary page scan.
pradyotanam. (with bhaṭṭācārya-) Name of an author View this entry on the original dictionary page scan.
pradyotanam. (plural) of a dynasty View this entry on the original dictionary page scan.
pradyotanan. blazing, shining, light View this entry on the original dictionary page scan.
pragetanamfn. () matutinal, early
pragetanamfn. relating to the next day, future View this entry on the original dictionary page scan.
prāhṇetanamfn. relating to the forenoon, happening in the morning, matutinal View this entry on the original dictionary page scan.
prakaṭaraktāntanayanamfn. having the eye-corners visibly red View this entry on the original dictionary page scan.
praketanan. appearance, apparition (used to explain prec.) View this entry on the original dictionary page scan.
prakīrtanan. announcing, proclaiming, extolling, praising View this entry on the original dictionary page scan.
prāktanamf(ī-)n. former, prior, previous, preceding, old, ancient (opp. to idānīntana-) View this entry on the original dictionary page scan.
prāktanajanmann. a former birth View this entry on the original dictionary page scan.
prāktanakarmann. any act formerly done or done in a former state of existence View this entry on the original dictionary page scan.
prāktanakarmann. fate destiny View this entry on the original dictionary page scan.
prāktanayam. a former pupil (varia lectio prāpta-naya-). View this entry on the original dictionary page scan.
pranighātanan. (fr. pra-nihan-) killing, slaughter, murder View this entry on the original dictionary page scan.
praṇipatanan. throwing one's self down before, falling at a person's feet View this entry on the original dictionary page scan.
prapatanan. flying forth or away (see haṃsa--) View this entry on the original dictionary page scan.
prapatanan. flying or falling down, falling from (ablative or compound) or into (locative case or compound) etc. View this entry on the original dictionary page scan.
prapatanan. a steep rock, precipice View this entry on the original dictionary page scan.
prapatanan. death, destruction View this entry on the original dictionary page scan.
prapātanan. (fr. Causal) causing to fall, throwing down View this entry on the original dictionary page scan.
prapātanan. throwing, casting (akṣa-p-,"casting-dice") View this entry on the original dictionary page scan.
prāsādānukīrtanan. Name of work View this entry on the original dictionary page scan.
praścotanan. trickling, dripping View this entry on the original dictionary page scan.
prastārapattanan. Name of work View this entry on the original dictionary page scan.
pratanamf(ī-)n. (fr. 1. pra-) ancient, old Va1rtt. 7 (see pra-tna-). View this entry on the original dictionary page scan.
prātastanamf(ī-)n. relating to the morning, matutinal View this entry on the original dictionary page scan.
prātastanan. early morning (one of the 5 parts of the day;the other 4 being saṃgava-or morning, midday, afternoon, and evening) View this entry on the original dictionary page scan.
praticintanan. thinking repeatedly, considering View this entry on the original dictionary page scan.
pratighātanan. warding off, repulsing View this entry on the original dictionary page scan.
pratighātanan. killing, slaughter View this entry on the original dictionary page scan.
pratiniryātanan. giving back, returning View this entry on the original dictionary page scan.
pratiniryātanan. rewarding, retaliation View this entry on the original dictionary page scan.
pratinivartanan. returning, coming back (See punaḥ-pr-). View this entry on the original dictionary page scan.
prativartanan. return, reappearance (a-prativ-) View this entry on the original dictionary page scan.
pratiyātanan. requital, retaliation (vaira-pr-,"taking revenge") View this entry on the original dictionary page scan.
pratyakcetanamfn. one whose thoughts are turned inwards or upon himself View this entry on the original dictionary page scan.
pratyāvartanan. coming back, returning View this entry on the original dictionary page scan.
pravartanamf(ī-)n. being in motion, flowing (Calcutta edition vartin-) View this entry on the original dictionary page scan.
pravartanan. advance, forward movement, rolling or flowing forth View this entry on the original dictionary page scan.
pravartanan. walking, roaming, wandering View this entry on the original dictionary page scan.
pravartanan. activity, procedure, engaging in, dealing with (instrumental case or locative case) etc. View this entry on the original dictionary page scan.
pravartanan. going on, coming off, happening, occurrence etc. View this entry on the original dictionary page scan.
pravartanan. conduct, behaviour View this entry on the original dictionary page scan.
pravartanan. bringing near, fetching View this entry on the original dictionary page scan.
pravartanan. erection, construction View this entry on the original dictionary page scan.
pravartanan. causing to appear, bringing about, advancing, promoting, introducing, employing, using etc. View this entry on the original dictionary page scan.
pravartanan. informing View this entry on the original dictionary page scan.
pravicetanan. (4. cit-) comprehending, understanding View this entry on the original dictionary page scan.
prāyaścetanan. atonement, expiation View this entry on the original dictionary page scan.
prayatanan. effort, endeavour (used to explain pra-yatna-) View this entry on the original dictionary page scan.
premapātanan. rheum View this entry on the original dictionary page scan.
premapātanan. tears (of joy) View this entry on the original dictionary page scan.
pretanaf. river of the dead (equals vaitaraṇī-, q.v) View this entry on the original dictionary page scan.
pretanaram. a dead man, a ghost View this entry on the original dictionary page scan.
priyatanayamfn. loving a son View this entry on the original dictionary page scan.
pṛtanan. an army or a hostile encounter View this entry on the original dictionary page scan.
pulomatanaf. equals -ja- View this entry on the original dictionary page scan.
punaḥpratinivartanan. coming back again, return View this entry on the original dictionary page scan.
punarāvartanaSee a-punar-āv-. View this entry on the original dictionary page scan.
punarāvartanandāf. Name of a sacred bathing. place View this entry on the original dictionary page scan.
purātanamf(ī-)n. belonging to the past, former, old, ancient ( purātane ne- ind.formerly, in olden times) etc. View this entry on the original dictionary page scan.
purātanamf(ī-)n. used-up, worn out View this entry on the original dictionary page scan.
purātanam. plural the ancients View this entry on the original dictionary page scan.
purātanan. an ancient story, old legend View this entry on the original dictionary page scan.
purātanan. a purāṇa- View this entry on the original dictionary page scan.
purātanayogasaṃgraham. Name of work View this entry on the original dictionary page scan.
purucetanamfn. visible to many, very conspicuous View this entry on the original dictionary page scan.
pūrvacintanan. former cares or trouble View this entry on the original dictionary page scan.
pūrvāhṇatanamfn. belonging or relating to the forenoon () View this entry on the original dictionary page scan.
pūrvāhṇetanamfn. belonging or relating to the forenoon () View this entry on the original dictionary page scan.
pūrvatanamfn. former, earlier View this entry on the original dictionary page scan.
puṣpaketanam. "characterized by flower", the god of love View this entry on the original dictionary page scan.
tanam. a particular class of demons or spirits (also equals vetāla-), View this entry on the original dictionary page scan.
racitanatimfn. one who has made his obeisance View this entry on the original dictionary page scan.
rādhātanayam. " rādhā-'s son", Name of karṇa- View this entry on the original dictionary page scan.
raghutanayam. "son of raghu-", Name of rāma- View this entry on the original dictionary page scan.
rājatanayam. "a kings's son", prince View this entry on the original dictionary page scan.
rājatanaf. a princess View this entry on the original dictionary page scan.
rajjuvartanan. the twisting of rope View this entry on the original dictionary page scan.
raktanayanamfn. red-eyed View this entry on the original dictionary page scan.
raktanayanam. Perdix Rufa View this entry on the original dictionary page scan.
raktapatanan. a flow of blood View this entry on the original dictionary page scan.
rāmagovindakirtanan. Name of a stotra- View this entry on the original dictionary page scan.
rāmakāntatanayam. Name of an author View this entry on the original dictionary page scan.
ravitanayam. "son of the sun", Name of the planet Saturn View this entry on the original dictionary page scan.
ravitanayam. of yama- View this entry on the original dictionary page scan.
reṇukātanayam. "son of reṇukā-" patronymic of paraśu-rāma- ( reṇukātanayatā -- f.) View this entry on the original dictionary page scan.
reṇukātanayatāf. reṇukātanaya
retanan. semen virile
rodhaḥpatanakaluṣamfn. (rendered) muddy by the falling in of a bank View this entry on the original dictionary page scan.
rogāyatanan. abode or seat of disease, the body View this entry on the original dictionary page scan.
rohiṇītanayam. the son of rohiṇī- id est bala-rāma- View this entry on the original dictionary page scan.
romakapattana n. the city of Rome View this entry on the original dictionary page scan.
romaśātanan. a depilatory for removing the hair View this entry on the original dictionary page scan.
ṛṣipatanam. Name of a forest near Benares View this entry on the original dictionary page scan.
ṛśyaketana m. Name of a-niruddha- View this entry on the original dictionary page scan.
rucirātanayam. N. metron. of kakṣīvat- View this entry on the original dictionary page scan.
rudratanayam. " rudra-'s son", Name of Punishment View this entry on the original dictionary page scan.
rudratanayam. of a sword View this entry on the original dictionary page scan.
rudratanayam. (with jaina-s) of the third black vāsudeva- View this entry on the original dictionary page scan.
rudrāyatanan. a temple dedicated to rudra- View this entry on the original dictionary page scan.
ruṅnivartanan. cessation of disease, recovery of health View this entry on the original dictionary page scan.
rūpasanātanam. Name of an author View this entry on the original dictionary page scan.
rūpāyatanan. (with Buddhists) form as one of the 12 āyatana-s (or organs and objects of sense) View this entry on the original dictionary page scan.
śabalacetanamfn. disturbed in mind View this entry on the original dictionary page scan.
sacetanamfn. having reason or consciousness or feeling, sentient, sensible, animate, rational View this entry on the original dictionary page scan.
sadācāracintanan. Name of work View this entry on the original dictionary page scan.
sadānvacatanamfn. scaring them away View this entry on the original dictionary page scan.
sadātanamfn. continual, perpetual ( sadātanatva -tva- n.) View this entry on the original dictionary page scan.
sadātanam. equals aja- Name of viṣṇu- View this entry on the original dictionary page scan.
sadātanatvan. sadātana
ṣaḍāyatanan. the seats of the six organs (or senses) View this entry on the original dictionary page scan.
ṣaḍāyatanamfn. consisting of the six āyatana-s (viz. vijñāna-,earth, air, fire, and water, and rūpa-) View this entry on the original dictionary page scan.
ṣaḍāyatanabhedakam. Name of a buddha- View this entry on the original dictionary page scan.
sadyastanamf(ī-)n. fresh, instantaneous View this entry on the original dictionary page scan.
sahanartanan. the act of dancing together View this entry on the original dictionary page scan.
sahasraraśmitanayam. "son of the sun", the planet Saturn View this entry on the original dictionary page scan.
sahāyatanamfn. with the fire-shrine View this entry on the original dictionary page scan.
śailādhirājatanaf. "daughter of himālaya-", Name of pārvati- View this entry on the original dictionary page scan.
śailatanaf. equals -kanya- View this entry on the original dictionary page scan.
śailatanayātātam. "father of pārvatī-", the himālaya- View this entry on the original dictionary page scan.
sāketanan. the city of Saketa View this entry on the original dictionary page scan.
salilacaraketanam. "fish-bannered", the god of love View this entry on the original dictionary page scan.
śalyakartanaName of a place View this entry on the original dictionary page scan.
śalyakīrtanaName of places View this entry on the original dictionary page scan.
samanukīrtanan. praising highly, high praise
samāvartanan. returning, (especially) the return home of a Brahman student as above (also"the saṃskāra- ceremony performed on the above occasion"; see saṃskāra-) () View this entry on the original dictionary page scan.
samāvartanakarmann. Name of work View this entry on the original dictionary page scan.
samāvartanaprayogam. Name of work View this entry on the original dictionary page scan.
samāvartanavidhim. Name of work View this entry on the original dictionary page scan.
śambhutanayam. " śiva-'s son", Name of skanda- and gaṇeśa- View this entry on the original dictionary page scan.
saṃcintanan. careful consideration or reflection, anxiety View this entry on the original dictionary page scan.
saṃghātanan. killing, destroying View this entry on the original dictionary page scan.
saṃketaketanan. a place of assignation, place appointed for meeting (a lover etc.), rendezvous View this entry on the original dictionary page scan.
saṃketaketanan. idem or 'm. an agreement, appointment, rendezvous ' View this entry on the original dictionary page scan.
saṃketaniketanan. () equals -ketana-. View this entry on the original dictionary page scan.
saṃkīrtanan. the act of mentioning fully etc. View this entry on the original dictionary page scan.
saṃkīrtanan. praise, celebration, glorification View this entry on the original dictionary page scan.
saṃnipātanan. (fr. Causal) causing to fall together View this entry on the original dictionary page scan.
saṃnivartanaetc. See saṃ-nivṛt-, column 3. View this entry on the original dictionary page scan.
saṃnivartanan. (also plural) turning back, return View this entry on the original dictionary page scan.
sampravartanan. moving or hurrying about View this entry on the original dictionary page scan.
sampravartanan. the act of setting in motion or action, undertaking View this entry on the original dictionary page scan.
saṃraktanayanamfn. having the eyes reddened (with passion or fury). () View this entry on the original dictionary page scan.
saṃsāraparivartanan. the turning round or revolution of the world View this entry on the original dictionary page scan.
śāṃtanavamf(ī-)n. written or composed by śaṃtanu- View this entry on the original dictionary page scan.
śāṃtanavam. patronymic of bhīṣma- (as son of king śaṃtanu-, the reputed great uncle of the pāṇḍava-s) View this entry on the original dictionary page scan.
śāṃtanavam. Name of a son of medhātithi- View this entry on the original dictionary page scan.
śāṃtanavam. of various writers (especially of the author of the phiṭsūtra-s; see cārya-) View this entry on the original dictionary page scan.
śāṃtanavan. Name of the dvīpa- ruled by śāṃtanava- View this entry on the original dictionary page scan.
śāṃtanavācāryam. the author of the phiṭ-sūtra-s (on accentuation). View this entry on the original dictionary page scan.
śāṃtanavaṣaṭsūtran. Name of a vedānta- work View this entry on the original dictionary page scan.
śāṃtanaf. (scilicet ṭīkā-) the commentator or commentary composed by śaṃtanu- View this entry on the original dictionary page scan.
saṃtatāśrunipātanan. continuous shedding of tears View this entry on the original dictionary page scan.
samutpatanan. the act of flying up together, rising, ascending View this entry on the original dictionary page scan.
samutpatanan. making effort, energy, exertion View this entry on the original dictionary page scan.
saṃvartanamf(ī-)n. issuing in, leading to (compound) View this entry on the original dictionary page scan.
saṃvartanan. a particular mythical weapon View this entry on the original dictionary page scan.
sanātanamf(ī-,m. Calcutta edition also ā-)n. eternal, perpetual, permanent, everlasting, primeval, ancient etc. View this entry on the original dictionary page scan.
sanātanam. Name of brahmā- View this entry on the original dictionary page scan.
sanātanam. of viṣṇu- View this entry on the original dictionary page scan.
sanātanam. of śiva- View this entry on the original dictionary page scan.
sanātanam. a guest of deceased ancestors, one who must always be fed whenever he attends śrāddha-s View this entry on the original dictionary page scan.
sanātanam. Name of a ṛṣi- (in and later "a mind-born son of brahmā-") etc. View this entry on the original dictionary page scan.
sanātanam. of a king View this entry on the original dictionary page scan.
sanātanam. (with śarman-and go-svāmin-) of two authors View this entry on the original dictionary page scan.
sanātanam. plural Name of particular worlds View this entry on the original dictionary page scan.
sanātanasiddhāntam. Name of work View this entry on the original dictionary page scan.
sanātanatamam. "most eternal or ancient", Name of viṣṇu- View this entry on the original dictionary page scan.
sapatnacātanamfn. scaring away rivals View this entry on the original dictionary page scan.
sapattanamfn. possessing towns or cities View this entry on the original dictionary page scan.
saprayoganivartanamfn. along with the (secret spells for) using and restraining (certain weapons) View this entry on the original dictionary page scan.
saptanaf. bird-lime View this entry on the original dictionary page scan.
saptanavatamfn. the 97th View this entry on the original dictionary page scan.
saptanavatamfn. chapter of View this entry on the original dictionary page scan.
saptanavatif. 97 View this entry on the original dictionary page scan.
saptanavatitamamfn. the 97th, chapter of View this entry on the original dictionary page scan.
śāradātanayam. Name of an author View this entry on the original dictionary page scan.
saraṭapatanapraśāntif. Name of work (on removing the evil consequences of a lizard falling on one's head). View this entry on the original dictionary page scan.
śarīrapatanan. equals -pāta- View this entry on the original dictionary page scan.
sarpārikstanam. Name of kṛṣṇa- View this entry on the original dictionary page scan.
śaśāṅkatanayam. "the moon's son", the planet Mercury View this entry on the original dictionary page scan.
śaśitanaya() m. "moon's son", the planet Mercury. View this entry on the original dictionary page scan.
śastranipātanan. "stroke of the knife", a surgical operation View this entry on the original dictionary page scan.
śatanan. (for śātana-,2, śad-) cutting down, felling View this entry on the original dictionary page scan.
śātanan. the act of sharpening or wetting View this entry on the original dictionary page scan.
śātanan. sharpness, thinness View this entry on the original dictionary page scan.
śātanamf(ī-)n. causing to fall or decay, felling, destroying, hewing or cutting off View this entry on the original dictionary page scan.
śātanan. the act of causing to fall etc. View this entry on the original dictionary page scan.
śātanan. cutting or plucking off View this entry on the original dictionary page scan.
śātanan. destroying, ruining View this entry on the original dictionary page scan.
śātanan. polishing, planing View this entry on the original dictionary page scan.
śātanan. a means of removing or destroying (see garbha-ś-).
savitṛtanayam. Name of the planet Saturn View this entry on the original dictionary page scan.
sāyantanamf(ī-)n. relating to evening, vespertine, View this entry on the original dictionary page scan.
sāyantanamallikāf. evening jasmine View this entry on the original dictionary page scan.
sāyantanasamayam. eventide
sāyatanamfn. together with the place of abode etc. View this entry on the original dictionary page scan.
śayyāprāntavivartanan. rolling from one side to another of a couch View this entry on the original dictionary page scan.
ścotanan. the act of oozing or flowing, exudation (See pra-śc-) View this entry on the original dictionary page scan.
siddhāntanaiyāyikamatan. Name of work View this entry on the original dictionary page scan.
śīghracetanamfn. having quick intellect, very sagacious (as a dog) View this entry on the original dictionary page scan.
śīghracetanam. a dog View this entry on the original dictionary page scan.
siṃhikātanayam. "son of siṃhikā-", metron, of rāhu- View this entry on the original dictionary page scan.
siṃhikātanayam. plural Name of certain asura-s View this entry on the original dictionary page scan.
śiraḥkṛntanan. cutting off the head, decapitation View this entry on the original dictionary page scan.
śīrṣavartanan. submission to punishment (if an accused person clears himself in an ordeal;See under śiras-) View this entry on the original dictionary page scan.
śītagutanayam. "son of the moon", the planet Mercury View this entry on the original dictionary page scan.
sītārāmasaṃkīrtanan. Name of work View this entry on the original dictionary page scan.
śivakīrtanam. " śaṃkara--praiser", Name of bhṛṅgi- or bhṛṅgarīṭa- (one of skanda-'s attendants) View this entry on the original dictionary page scan.
śivakīrtanam. Name of viṣṇu- View this entry on the original dictionary page scan.
śivakīrtanan. the act of praising or celebrating śaṃkara- View this entry on the original dictionary page scan.
śivāyatanan. a śiva- temple View this entry on the original dictionary page scan.
somanāthapattanan. Name of a town on the western coast of India (commonly called Somnath Pattan in Kathiawar, celebrated for the śiva- temple above described) View this entry on the original dictionary page scan.
sopārakapattanan. Name of a town View this entry on the original dictionary page scan.
sphoṭitanayanamfn. having the eyes put out View this entry on the original dictionary page scan.
śrīniketanam. "dwelling with śrī-", Name of viṣṇu- View this entry on the original dictionary page scan.
śrīniketanan. equals prec. n. View this entry on the original dictionary page scan.
śrīpattanan. Name of a town View this entry on the original dictionary page scan.
śrīraṅgapattanan. " viṣṇu-'s city", the city of Seringapatam (situated in Mysore on an island an a channel of the kāverī-, said to have been founded by an ancient king who called it after himself, or by a devotee who dedicated it to viṣṇu-; see above ) View this entry on the original dictionary page scan.
srotanadībhavan. antimony View this entry on the original dictionary page scan.
sṛṣṭipattanan. a particular magical power View this entry on the original dictionary page scan.
stanam. (or n. gaRa ardharcādi- in fine compositi or 'at the end of a compound' ā-or ī-;derivation doubtful, but prob. connected with stan-,from the hollow resonance of the human breast), the female breast (either human or animal) , teat, dug, udder etc. View this entry on the original dictionary page scan.
stanam. the nipple (of the female or the male breast) View this entry on the original dictionary page scan.
stanam. a kind of pin or peg on a vessel shaped like a teat View this entry on the original dictionary page scan.
stanabālam. plural Name of a people View this entry on the original dictionary page scan.
stanabharam. "breast-weight", a swelling bosom View this entry on the original dictionary page scan.
stanabharam. a man with a breast like a woman's View this entry on the original dictionary page scan.
stanabhavamfn. being on the breast View this entry on the original dictionary page scan.
stanabhavam. a particular posture in sexual union View this entry on the original dictionary page scan.
stanacūcukan. the nipple of the breast View this entry on the original dictionary page scan.
stanadātrīf. giving the breast, suckling View this entry on the original dictionary page scan.
stanadveṣinmfn. rejecting the breast View this entry on the original dictionary page scan.
stanagraham. the sucking or drawing of the breast View this entry on the original dictionary page scan.
stanakalaśam. a jar-like breast View this entry on the original dictionary page scan.
stanakalaśam. Name of a bard (wrong reading lasa-) View this entry on the original dictionary page scan.
stanakesavatīf. having breasts and long hair. View this entry on the original dictionary page scan.
stanakorakam. n. a budlike breast View this entry on the original dictionary page scan.
stanakoṭif. the nipple of the breast View this entry on the original dictionary page scan.
stanakuḍmalan. "breast-bud", a woman's breast View this entry on the original dictionary page scan.
stanakumbham. equals -kalaśa- above View this entry on the original dictionary page scan.
stanakuṇḍan. (sg. or plural) Name of a tīrtha- View this entry on the original dictionary page scan.
stanamadhyam. a nipple View this entry on the original dictionary page scan.
stanamadhyan. the space between the breast View this entry on the original dictionary page scan.
stanamaṇḍalan. "breast-orb" equals -taṭa- View this entry on the original dictionary page scan.
stanaṃdhamfn. equals --dhaya- View this entry on the original dictionary page scan.
stanaṃdhamamfn. View this entry on the original dictionary page scan.
stanaṃdhayamf(ī-or[ ] ā-)n. sucking the breast View this entry on the original dictionary page scan.
stanaṃdhayam. a suckling, infant etc. View this entry on the original dictionary page scan.
stanaṃdhayam. a calf View this entry on the original dictionary page scan.
stanamukham. (?) n. a nipple View this entry on the original dictionary page scan.
stanamūlan. "root of the breast", the lower part of the female breast View this entry on the original dictionary page scan.
stananan. the sound of a hollow cough View this entry on the original dictionary page scan.
stananan. sounding, sound, noise View this entry on the original dictionary page scan.
stananan. the rumbling of clouds View this entry on the original dictionary page scan.
stananan. equals kunthana-, kunthita- View this entry on the original dictionary page scan.
stananan. groaning, breathing hard View this entry on the original dictionary page scan.
stanapamf(ā-)n. drinking or sucking the breast View this entry on the original dictionary page scan.
stanapamf(ā-)n. a suckling View this entry on the original dictionary page scan.
stanamfn. equals -pa- View this entry on the original dictionary page scan.
stanapānan. the drinking or sucking of the breast View this entry on the original dictionary page scan.
stanapatanan. flaccidity of the breast View this entry on the original dictionary page scan.
stanapātṛmfn. sucking the breast of (compound) , View this entry on the original dictionary page scan.
stanapāyakamfn. equals -pa- View this entry on the original dictionary page scan.
stanapāyikam. plural varia lectio for -poṣika- View this entry on the original dictionary page scan.
stanapāyikāf. a female child still unweaned View this entry on the original dictionary page scan.
stanapāyinmfn. equals -pa- View this entry on the original dictionary page scan.
stanapoṣikam. plural Name of a people (varia lectio -yoṣika-etc.) View this entry on the original dictionary page scan.
stanarogam. a disease of the female breast View this entry on the original dictionary page scan.
stanarohitam. n. a particular part of the female breast View this entry on the original dictionary page scan.
stanaśikhāf. "breast-point", a nipple View this entry on the original dictionary page scan.
stanasyumfn. sucking the breast, a suckling View this entry on the original dictionary page scan.
stanataṭam. n. the projection of the female breast View this entry on the original dictionary page scan.
stanatham. roar (of a lion) View this entry on the original dictionary page scan.
stanatham. thunder View this entry on the original dictionary page scan.
stanathum. roar (of a lion) View this entry on the original dictionary page scan.
stanatyāgam. "leaving the mother's breast", weaning View this entry on the original dictionary page scan.
stanavatīf. possessing teats View this entry on the original dictionary page scan.
stanavatīf. a woman View this entry on the original dictionary page scan.
stanavepathum. the heaving of the breast View this entry on the original dictionary page scan.
stanavṛntan. "breast-stalk", a nipple View this entry on the original dictionary page scan.
stanayadamamfn. (see 1. ama-) having a roaring onset (said of the marut-s) View this entry on the original dictionary page scan.
stanayitnum. (sg. or plural) thunder (plural personified as children of vidyota-, "Lightning") etc. View this entry on the original dictionary page scan.
stanayitnum. a thunder-cloud View this entry on the original dictionary page scan.
stanayitnum. lightning View this entry on the original dictionary page scan.
stanayitnum. sickness View this entry on the original dictionary page scan.
stanayitnum. death View this entry on the original dictionary page scan.
stanayitnum. a kind of grass (equals mustaka-) View this entry on the original dictionary page scan.
stanayitnughoṣamfn. loud as thunder View this entry on the original dictionary page scan.
stanayitnumator (wrong reading) View this entry on the original dictionary page scan.
stanayitnusanimfn. bringing thunder View this entry on the original dictionary page scan.
stanayitnuvatmfn. connected with thunder View this entry on the original dictionary page scan.
stanayodhika() () m. plural Name of a people (varia lectio -poṣika-). View this entry on the original dictionary page scan.
stanayoṣika() m. plural Name of a people (varia lectio -poṣika-).
sthalapattanan. a town situated on dry land (opp. to jala-p-), View this entry on the original dictionary page scan.
stimitanayanamfn. having the eyes intently fixed (see stabdhadṛṣṭi-) View this entry on the original dictionary page scan.
subhagātanayam. the son of a beloved wife or of an honoured mother View this entry on the original dictionary page scan.
sucetanamfn. very notable, distinguished View this entry on the original dictionary page scan.
sucintanan. the act of thinking well, deliberate consideration View this entry on the original dictionary page scan.
sugandhimūtrapatanam. a civet cat View this entry on the original dictionary page scan.
sugatāyatanan. a Buddhist temple or monastery View this entry on the original dictionary page scan.
suketanam. Name of a son of sunītha- View this entry on the original dictionary page scan.
sukhaikāyatanan. sole abode of joy View this entry on the original dictionary page scan.
śūlaghātanan. "pain-destroying", iron rust View this entry on the original dictionary page scan.
sumitrātanayam. "son of sumitrā-", Name of lakṣmaṇa- View this entry on the original dictionary page scan.
suparṇītanayam. "son of su-parṇī-", garuḍa- View this entry on the original dictionary page scan.
supatanamfn. flying well (equals -parṇ/a-) View this entry on the original dictionary page scan.
surabhitanayam. "son of surabhi-", a bull View this entry on the original dictionary page scan.
surabhitanaf. a cow View this entry on the original dictionary page scan.
surapatitanayam. " indra-'s son", Name of arjuna- View this entry on the original dictionary page scan.
sūryādipañcāyatanapratiṣṭhāpaddhatif. Name of work View this entry on the original dictionary page scan.
sūryatanayam. "son of the Sun", Name of manu- View this entry on the original dictionary page scan.
sūryatanayam. of the planet Saturn View this entry on the original dictionary page scan.
sūryatanayam. of karṇa- View this entry on the original dictionary page scan.
sūryatanayam. of su-grīva- View this entry on the original dictionary page scan.
sūryatanaf. "daughter of the Sun", the river yamunā- View this entry on the original dictionary page scan.
tanandanam. "son of sūta-", Name of ugra-śravas- View this entry on the original dictionary page scan.
sutanayamfn. (id est 5. su-+ tan-) having beautiful children View this entry on the original dictionary page scan.
sūtatanayam. "son (id est adopted son) of the sūta- (Adhiratha)", Name of karṇa-
svapnaniketanan. equals -gṛha- View this entry on the original dictionary page scan.
svarapattanan. "abode of accents", Name of the sāmaveda-. View this entry on the original dictionary page scan.
śvastanamf(ī-)n. relating or belonging to the morrow (ne 'hani-,"on the morrow") ([ confer, compare Latin crastinus]) View this entry on the original dictionary page scan.
śvastanan. to-morrow, next day, the future (see a-śv-). View this entry on the original dictionary page scan.
śvastanavatmfn. having a future View this entry on the original dictionary page scan.
tadānīṃtanamfn. then living View this entry on the original dictionary page scan.
tālitanagaran. Name of a town. 1. View this entry on the original dictionary page scan.
tantukṛntanan. cutting off the propagation of a family View this entry on the original dictionary page scan.
tapanatanayam. "Sun-son", karṇa- View this entry on the original dictionary page scan.
tapanatanaf. equals -sutā- View this entry on the original dictionary page scan.
tapanatanayaf. equals pantī- View this entry on the original dictionary page scan.
tapanatanayaf. equals pasvīṣṭā- View this entry on the original dictionary page scan.
tapanatanayeṣṭāf. idem or 'f. equals pasvīṣṭā- ' View this entry on the original dictionary page scan.
taraṇitanaf. "sun-daughter", the river yamunā- View this entry on the original dictionary page scan.
tārapatanan. the falling of a meteor View this entry on the original dictionary page scan.
tanam. a wagtail View this entry on the original dictionary page scan.
tigmayātanamfn. causing acute pain or agony (a hell) View this entry on the original dictionary page scan.
tīkṣṇāṃśutanayam. "sun-son", Saturn View this entry on the original dictionary page scan.
tiryakpātanan. a kind of process applied especially to mercury. View this entry on the original dictionary page scan.
traitanam. Name of a deity (connected with trita-; = Zend Thraetaona, Persian Feridun) View this entry on the original dictionary page scan.
tristanamfn. milked from 3 nipples View this entry on the original dictionary page scan.
tristanaf. (a cow) having 3 nipples View this entry on the original dictionary page scan.
trivargacintanan. Name of a chapter of View this entry on the original dictionary page scan.
tuṣārapatanan. snow-fall View this entry on the original dictionary page scan.
ubhayavetanamfn. "receiving wages from both", a spy who seemingly enters the enemy's service View this entry on the original dictionary page scan.
ubhayavetanamfn. a perfidious or treacherous servant View this entry on the original dictionary page scan.
ubhayavetanatvan. the state of receiving wages from both View this entry on the original dictionary page scan.
uccaistanamfn. high, lofty, View this entry on the original dictionary page scan.
udadhānāyatanan. the place for a water-reservoir, View this entry on the original dictionary page scan.
udāvartanan. retention, retarding View this entry on the original dictionary page scan.
uddyotanan. the act of enlightening, illumination. View this entry on the original dictionary page scan.
uddyotanasūrim. Name of a teacher () View this entry on the original dictionary page scan.
udghātanan. a bucket for drawing (water) View this entry on the original dictionary page scan.
udvartanamfn. causing to burst View this entry on the original dictionary page scan.
udvartanan. the act of rising, going up, ascending, jumping up View this entry on the original dictionary page scan.
udvartanan. the springing up of plants or grain etc. View this entry on the original dictionary page scan.
udvartanan. swelling up, overflowing View this entry on the original dictionary page scan.
udvartanan. drawing out metal, laminating View this entry on the original dictionary page scan.
udvartanan. grinding, pounding View this entry on the original dictionary page scan.
udvartanan. rubbing or kneading the body, rubbing and cleansing it with fragrant unguents View this entry on the original dictionary page scan.
udvartanan. the unguents used for that purpose (or to relieve pains in the limbs etc.) etc. View this entry on the original dictionary page scan.
udvartanan. bad behaviour, bad conduct View this entry on the original dictionary page scan.
upāṃśvāyatanamfn. having a silent abode, kept inaudible (as the breath) View this entry on the original dictionary page scan.
upanipātanan. occurring or taking place suddenly commentator or commentary on View this entry on the original dictionary page scan.
uparitanamf(ī-)n. upper (opposed to adhastana-) commentator or commentary on and View this entry on the original dictionary page scan.
uparitanamf(ī-)n. following, further on, subsequent (in a book) commentator or commentary on ., on View this entry on the original dictionary page scan.
upavartanan. (fr. the Causal) , the act of bringing near View this entry on the original dictionary page scan.
upavartanan. a place for exercise View this entry on the original dictionary page scan.
upavartanan. a country (inhabited or not) View this entry on the original dictionary page scan.
upāvartanaetc. See column 3. View this entry on the original dictionary page scan.
upāvartanan. the act of coming back, return View this entry on the original dictionary page scan.
uragāriketanam. "having garuḍa- as symbol", Name of viṣṇu- View this entry on the original dictionary page scan.
ūrdhvapātanan. the act of causing (mercury) to rise, sublimation (of mercury) View this entry on the original dictionary page scan.
ūrdhvapātanayantran. an apparatus for sublimation (of mercury). View this entry on the original dictionary page scan.
ūrdhvastanamf(ī-)n. high-breasted View this entry on the original dictionary page scan.
utathyatanayam. "a descendant of utathya-", Name of gautama- View this entry on the original dictionary page scan.
utkartanaetc. See 1. ut-kṛt-. View this entry on the original dictionary page scan.
utkartanan. cutting up, cutting to pieces, cutting off View this entry on the original dictionary page scan.
utketanan. a raised flag, View this entry on the original dictionary page scan.
utkīrtanaetc. See ut-kṝt-. View this entry on the original dictionary page scan.
utkīrtanan. crying out, proclaiming View this entry on the original dictionary page scan.
utkīrtanan. reporting, promulgating View this entry on the original dictionary page scan.
utkīrtanan. praising, celebrating. View this entry on the original dictionary page scan.
utkīrtanan. (in dramatic language) awakening of the remembrance of former events, View this entry on the original dictionary page scan.
utpatanamf(ī-)n. flying upwards, (utpatanī vidyā-,a spell by means of which one is able to fly upwards or to rise ) View this entry on the original dictionary page scan.
utpatanan. flying or jumping up, rising, ascending, going up View this entry on the original dictionary page scan.
utpatanan. birth, production View this entry on the original dictionary page scan.
utpattiketanan. birth-place View this entry on the original dictionary page scan.
utstanamf(ī-)n. having prominent breasts
vahnipatanan. "entering the fire", self-immolation View this entry on the original dictionary page scan.
vaikartanamfn. (fr. vi-kartana-) relating or belonging to the sun View this entry on the original dictionary page scan.
vaikartanam. Name of karṇa- (as son of the sun) View this entry on the original dictionary page scan.
vaikartanam. patronymic of su-grīva- View this entry on the original dictionary page scan.
vaikartanakulan. the solar race View this entry on the original dictionary page scan.
vairaniryātanan. requital of enmity, revenge View this entry on the original dictionary page scan.
vairapratiyātanan. the requital of enmity, taking vengeance View this entry on the original dictionary page scan.
vairayātanan. vairayātanā
vairocananiketanan. "abode of bali-", the lower regions View this entry on the original dictionary page scan.
vajrapatanan. the fall or stroke of a thunderbolt View this entry on the original dictionary page scan.
vajrapātanan. the hurling of a thunderbolt View this entry on the original dictionary page scan.
vaṃśānukīrtanan. the recounting or proclaiming a family or a genealogy View this entry on the original dictionary page scan.
vānaraketanam. "monkey-bannered", Name of arjuna- View this entry on the original dictionary page scan.
vandhyātanayam. equals -putra- View this entry on the original dictionary page scan.
vartanamfn. (also fr. Causal) abiding, staying etc. (= vartiṣṇu-) View this entry on the original dictionary page scan.
vartanamfn. setting in motion, quickening, causing to live or be (also applied to viṣṇu-) View this entry on the original dictionary page scan.
vartanam. a dwarf. View this entry on the original dictionary page scan.
vartanan. the act of turning or rolling or rolling on or moving forward or about (trans. and intrans.) etc. (alsof(ā-). ) View this entry on the original dictionary page scan.
vartanan. twisting (a rope) View this entry on the original dictionary page scan.
vartanan. staying, abiding in (locative case) View this entry on the original dictionary page scan.
vartanan. living on (instrumental case), livelihood, subsistence, occupation, earnings, wages View this entry on the original dictionary page scan.
vartanan. commerce, intercourse with (saha-) View this entry on the original dictionary page scan.
vartanan. proceeding, conduct, behaviour View this entry on the original dictionary page scan.
vartanan. (in fine compositi or 'at the end of a compound') application of. View this entry on the original dictionary page scan.
vartanan. a distaff or spindle View this entry on the original dictionary page scan.
vartanan. a globe or ball View this entry on the original dictionary page scan.
vartanan. an often told word View this entry on the original dictionary page scan.
vartanan. a place where a horse rolls View this entry on the original dictionary page scan.
vartanan. decoction View this entry on the original dictionary page scan.
vārtanamfn. equals vartanīṣu bhavaḥ- View this entry on the original dictionary page scan.
vartanadānan. the gift of means of subsistence or wages View this entry on the original dictionary page scan.
vartanaviniyogam. appointment of means of subsistence, salary, wages View this entry on the original dictionary page scan.
vartmapātanan. waylaying View this entry on the original dictionary page scan.
vātāhatanauf. vātāhata
vatsapattanan. " vatsa- town", Name of a city in the north of India (also called kauśāmbī-) View this entry on the original dictionary page scan.
vāyutanayam. equals -putra- View this entry on the original dictionary page scan.
vedāntanayanabhūṣaṇan. Name of work View this entry on the original dictionary page scan.
vedāntanayanācāryam. Name of authors View this entry on the original dictionary page scan.
vetanan. (according to to fr. -,but rather connected with vṛt-; see vartana-) wages, hire, salary, subsistence, livelihood etc. View this entry on the original dictionary page scan.
vetanan. price View this entry on the original dictionary page scan.
vetanan. silver View this entry on the original dictionary page scan.
vetanabhujm. "earning wages", a servant View this entry on the original dictionary page scan.
vetanadānan. the paying of wages, hiring View this entry on the original dictionary page scan.
vetanajīvinmfn. subsisting by wages, stipendiary View this entry on the original dictionary page scan.
vibhrāntanayanamfn. one who rolls the eyes or casts side glances View this entry on the original dictionary page scan.
vicetanamf(ā-)n. (for 2.See under vi-cit-) senseless, unconscious, absent-minded etc. View this entry on the original dictionary page scan.
vicetanamf(ā-)n. inanimate, dead View this entry on the original dictionary page scan.
vicetanamf(ā-)n. foolish, stupid View this entry on the original dictionary page scan.
vicetanaSee a-vicetan/a-. 2. View this entry on the original dictionary page scan.
vicetana vi-cetas- etc. See under vi-- 4. cit-, column 1. View this entry on the original dictionary page scan.
vicintanan. thinking, thought View this entry on the original dictionary page scan.
vidarbhatanaf. "daughter of the vidarbha- king", Name of damayantī- View this entry on the original dictionary page scan.
vidhvastanagarāśramamfn. containing ruined cities and hermitages View this entry on the original dictionary page scan.
vidyotanamfn. idem or 'mfn. irradiating, illuminating, illustrating ' View this entry on the original dictionary page scan.
vidyotanan. lightning View this entry on the original dictionary page scan.
vidyutprapatanan. a stroke of lightning View this entry on the original dictionary page scan.
vigatanayanamfn. eyeless, blind View this entry on the original dictionary page scan.
vighātanamfn. warding off, averting View this entry on the original dictionary page scan.
vighātanan. impeding, interrupting, disturbing View this entry on the original dictionary page scan.
vighātanasiddhif. the settling or removal of obstacles or impediments View this entry on the original dictionary page scan.
vihvalacetana() mfn. distressed in mind, low-spirited View this entry on the original dictionary page scan.
vijñānāntyāyatanan. (with Buddhists) Name of a world View this entry on the original dictionary page scan.
vikartanamfn. cutting asunder, dividing View this entry on the original dictionary page scan.
vikartanam. the sun (prob. as the"divider of clouds") View this entry on the original dictionary page scan.
vikartanam. a son who has usurped his father's kingdom View this entry on the original dictionary page scan.
vikartanan. the act of cutting asunder or dividing View this entry on the original dictionary page scan.
vikasitanayanavadanakamalamfn. opening (her) lotus-like eyes and mouth View this entry on the original dictionary page scan.
vinatātanaf. "daughter of veda-", metr. of su-mati- View this entry on the original dictionary page scan.
vinikṛntanamfn. cutting in pieces, hewing down View this entry on the original dictionary page scan.
vinipātanan. causing miscarriage View this entry on the original dictionary page scan.
vinivartanan. turning back, return etc. View this entry on the original dictionary page scan.
vinivartanan. coming to an end, cessation View this entry on the original dictionary page scan.
viparivartanamf(ī-)n. causing to turn round or to return View this entry on the original dictionary page scan.
viparivartanan. turning round View this entry on the original dictionary page scan.
viparivartanan. rolling about, wallowing View this entry on the original dictionary page scan.
vipātanan. (fr. Causal) melting, liquefying View this entry on the original dictionary page scan.
viśātanamf(ī-)n. (2. śad-, Causal) causing to fall to pieces, destroying View this entry on the original dictionary page scan.
viśātanamf(ī-)n. setting free, delivering View this entry on the original dictionary page scan.
viśātanam. Name of viṣṇu- (equals saṃhartṛ- ) View this entry on the original dictionary page scan.
viśātanan. cutting off View this entry on the original dictionary page scan.
viśātanan. hewing in pieces, destroying View this entry on the original dictionary page scan.
viśveśvarapattanan. Name of Benares View this entry on the original dictionary page scan.
vitanaSee āhara-vitanā-. View this entry on the original dictionary page scan.
tanam. dual number (possibly fr. vi-+ tan-) the sides or cartilages of the larynx or throat View this entry on the original dictionary page scan.
vitteśapatanan. kubera-'s town View this entry on the original dictionary page scan.
vivartanamfn. turning round, revolving View this entry on the original dictionary page scan.
vivartanamfn. changing, transforming View this entry on the original dictionary page scan.
vivartanan. (in fine compositi or 'at the end of a compound' f(ā-).) rolling (of a horse) View this entry on the original dictionary page scan.
vivartanan. rolling or tossing about, struggling (alsof(ā-). ) View this entry on the original dictionary page scan.
vivartanan. moving or wandering to and fro View this entry on the original dictionary page scan.
vivartanan. turning round View this entry on the original dictionary page scan.
vivartanan. turning, turn, change View this entry on the original dictionary page scan.
vivartanan. turning away or back View this entry on the original dictionary page scan.
vivartanan. returning, return View this entry on the original dictionary page scan.
vivartanan. a kind of dance (also vivartananṛtya -nṛtya- n.) View this entry on the original dictionary page scan.
vivartanan. transformation View this entry on the original dictionary page scan.
vivartanan. existing, being, abiding View this entry on the original dictionary page scan.
vivartanan. going round, circumambulating (an altar etc.) View this entry on the original dictionary page scan.
vivartanan. reverential salutation View this entry on the original dictionary page scan.
vivartanan. causing to turn or to change, overturning View this entry on the original dictionary page scan.
vivartananṛtyan. vivartana
vṛkṣamūlaniketanamfn. dwelling at the roots of trees View this entry on the original dictionary page scan.
vṛṣaketanam. "having a bull for a sign", Name of śiva- View this entry on the original dictionary page scan.
vṛṣapūtana(?) m. letting loose a black bull (see vṛṣotsarga-). View this entry on the original dictionary page scan.
vṛṣarājaketanam. "having the king of bulls for a sign", Name of śiva- View this entry on the original dictionary page scan.
vyākhyātanamfn. explained, fully detailed related, told etc. View this entry on the original dictionary page scan.
vyākhyātanamfn. conquered, overcome (?) View this entry on the original dictionary page scan.
vyākulitacetanamfn. agitated or perplexed in mind, alarmed, bewildered, frightened. View this entry on the original dictionary page scan.
vyāvartanamf(ī-)n. averting, removing (see vigraha-vyāvartanī-) View this entry on the original dictionary page scan.
vyāvartanamf(ī-)n. excluding View this entry on the original dictionary page scan.
vyāvartanan. turn (of a road) View this entry on the original dictionary page scan.
vyāvartanan. coil (of a snake) View this entry on the original dictionary page scan.
vyāvartanan. turning away View this entry on the original dictionary page scan.
vyāvartanan. turning round, revolving, encompassing, surrounding View this entry on the original dictionary page scan.
vyavasthātivartanan. id View this entry on the original dictionary page scan.
yajamānāyatanan. the place of a yajamāna- View this entry on the original dictionary page scan.
yajñāyatanan. a place for sacrifice View this entry on the original dictionary page scan.
yakṣāyatanan. a temple dedicated to the yakṣa-s View this entry on the original dictionary page scan.
yamakoṭipattanan. yamakoṭi
yamakoṭipattanan. yamakoṭī
yatanan. making effort or exertion View this entry on the original dictionary page scan.
tanan. (2. yat-) requital, retaliation, return (with vairasya-,revenge, vengeance) View this entry on the original dictionary page scan.
yathāyatanamind. (thāy-) each in his own place or abode View this entry on the original dictionary page scan.
yātucātanamfn. driving away yātu-s View this entry on the original dictionary page scan.
yayātipatanan. "fall of yayāti-", Name of a place of pilgrimage View this entry on the original dictionary page scan.
Apte Search
148 results
tana तनः Ved. A descendant. -ना, -नम् Offspring, posterity; आ वो मक्षू तनाय कम् Rv.1.39.7.
tanas तनस् m. Ved. Offspring, posterity; मा शेषसा मा तनसा Rv.5.7.4.
tanayaḥ तनयः [तनोति कुलं, तन्-कयन्] 1 A son; Ms.3.16; सुदक्षिणायां तनयं ययाचे R.2.64. -2 A male descendant. -3 (In astrol.) N. of the fifth lunar mansion. -या A daughter; Ms.11.171. ˚भवनम् The 5th lunar mansion; Bṛi S.14.27. गिरि˚, कलिन्द˚ &c. -यौ (dual) A son and a daughter. -यम् Posterity, family, offspring. -तनयीकृत a. made a son; मातामहस्य यो मात्रा दौहित्रस्तनयी- कृतः Rāj. T.4.8.
tanayitnu तनयित्नु a. Ved. Roaring, thundering.
akartana अकर्तन a. [कृत्-भावे ल्युट्, न. त.] 1 Not cutting. -2 Dwarfish.
acetana अचेतन a. [न. ब.] Inanimate, not sentient, irrational; चेतन ˚नेषु Me.5; ˚नं ब्रह्म inanimate Brahman; ˚नं नाम गुणं न लक्षयेत् Ś.6.13 destitute of life, lifeless (object &c.); ˚नेष्वपि चेतनावदुपचारः Mbh. -2 Not conscious, insensible; senseless; निराशा निहते पुत्रे दत्ता श्राद्ध- मचेतना Rām.6.92.55. बुद्धिशतमचेतने नष्टम् H.2.14.
atanam अतनम् [अत्-ल्युट्] Going, wandering. -नः A wanderer, a passer-by.
atipatanam अतिपतनम् Flying past or beyond; omission, neglect, missing, transgressing; exceeding, going beyond due bounds.
ativartanam अतिवर्तनम् a. Pardonable offence; दशातिवर्तनान्याहुः Ms.8.29.
ativartanam अतिवर्तनम् A pardonable offence or misdemeanour; exemption from punishment; ten cases are mentioned in Ms.8.29 (यानस्य चैव यातुश्च यानस्वाभिन एव च । दशातिः- वर्तनान्याहुः शेषे दण्डो विधीयते ॥)
adyatana अद्यतन a. (-नी f. [अद्य भवः; अद्य दयु तुडागमश्च] 1 Pertaining or referring to, extending over, to-day; ˚दिवस, ˚काल &c. आ न्याय्यादुत्थानादा न्याय्याच्च संवेशनात् । एषो$द्यतनः कालः । अपरे पुनराहुरुभयतो$र्द्धरात्रं अद्यतनः कालः । Kāśi., कलोपसर्जनेच तुल्यम्. -2 Current, now-a-days, prevalent at present, modern. -नः The current or this day, period of the current day (Kāśi. on P.I.2.57); See अनद्यतन also. -नी (scil. वृत्तिः) A name given to the Aorist tense, as it denotes an action done to-day or on the same day (= ˚भूतः).
adhastana अधस्तन a. (-नी f.) [अधोभवः अधस्-टयु तुट् च] 1 Lower, situated beneath. -2 Prior, previous.
adhivikartanam अधिविकर्तनम् The act of cutting off or cutting through.
adhunātana अधुनातन a. (-नी f.) [अधुना भवार्ये टयुल् तुट्च] Belonging to the present times, modern.
anadyatana अनद्यतन a. (-नी f.) [न. त.] Not pertaining to this or the current day; a term used by Pāṇini to denote the sense of the Imperfect or the Periphrastic future P.III.2.III,III.3.15; ˚भूते लङ्-अपचत्; ˚ने भविष्यति लुट्-पक्ता; परोक्षानद्यतने लिट्-पपाच. -नः Not the current day; अतीतायाः रात्रेः पश्चार्धेन आगामिन्या रात्रेः पूर्वार्धेन सहितो दिवसो$- द्यतनः Sk., तद्भिन्नः कालः.
anivartana अनिवर्तन a. 1 Not turning away, firm, steadfast. -2 Right, not fit to be abandoned.
anukīrtanam अनुकीर्तनम् Act of proclaiming or publishing. असदा- चरिते मार्गे कथं स्यादनुकीर्तनम् Mb.3.233.1.
anupatanam अनुपतनम् पातः 1 Falling upon, alighting upon in succession. -2 Following, going after, pursuit; उपवनपवनानुपातदक्षैः Śi.7.27. -3 Going or proceeding in order or as a consequence. -4 [अनुरूपः त्रैराशिकेन पातः] Proportion. -5 Rule of three. -6 A degree of latitude, opposite to one given. -तम् ind. (regarded as ending in ṇamul from पत्) Following in succession, going after; लतानुपातं कुसुमान्यगृह्णात् Bk.2.11 (लतां लताममुपात्य going to creeper after creeper, or after bending the creepers.)
anuvartanam अनुवर्तनम् 1 Following (fig. also); attending, compliance, obedience, conformity; प्रकृतस्यानुवर्तने Ak.; इदमाश्चर्यमथवा लोकस्थित्यनुवर्तनम् Mv.7.4; दाक्षिण्य˚ Dk.161. -2 Gratifying, obliging. -3 Approval of, concurrence in. -4 Continuance; result, consequence. -5 Supplying from a preceding Sūtra.
anvāyatana अन्वायतन a. Latitudinal. -नम् ind. In the house.
apavartanam अपवर्तनम् 1 Removal, transferring from one place to another; स्थान˚. -2 Taking away, depriving one of; न त्यागो$स्ति द्विषन्त्याश्च न च दायापवर्तनम् Ms.9.79. -3 Abridging, abbreviation. -4 Reducing a fraction to its lowest terms; division without remainder, or the divisor itself.
apravartanam अप्रवर्तनम् Not engaging in, not exciting to any action.
abhiniṣpatanam अभिनिष्पतनम् Sallying, issuing.
abhipatanam अभिपतनम् 1 Approaching. -2 Falling upon, assault, attack. -3 Going forth, departure.
abhipravartanam अभिप्रवर्तनम् 1 Advancing up to. -2 Proceeding, acting. -3 Flowing, coming forth, as of sweat.
abhivartanam अभिवर्तनम् Going towards, approching, attacking &c.
abhyutpatanam अभ्युत्पतनम् Springing or leaping against, sudden spring or leap, assault; अलक्षिताभ्युत्पतनो नृपेण R.2.27.
artana अर्तन a. [ऋत्-ल्युट्] 1 Blaming, reviling; प्रतिश्रुत्काया$- अर्तनम् Vāj.3.19. -2 Sorry, grieved. -नम् Censure, reproach, abuse.
ātanam आतनम् 1 Spreading, penetrating, expanding. -2 Sight, view.
āpatanam आपतनम् 1 Approaching, coming, assailing &c. -2 Happening, occurrence. -3 Descending, alighting. -4 Obtaining. -5 Knowledge; क्वचित् प्राकरणिकादर्थादप्राकरणिक- स्यार्थस्यापतनम् S. D.1. -6 Natural sequence, necessarily following.
āyatanam आयतनम् [आयतन्ते$त्र, यत् आधारे ल्युट्] 1 Place, abode, house, resting-place; भूमेर्महदायतनं वृष्णीष्व Kaṭh.1.1.23. (fig. also); शूलायतनाः Mu.7 hangmen; स्नेहस्तदेकायतनं जगाम Ku.7.5 was centred in her; R.3.36; सर्वा- विनयानामेकैकमप्येषामायतनम् K.13; ˚मृगेण 13 domestic deer; Chāṇ.32; (hence) a receptacle, home, support, seat. -2 The place of the sacred fire, altar, shed for sacrifices. -3 A sanctuary, sacred place; as in देवायतनम्, मठायतनम् &c. यथाक्रमविशेषेण सर्वाण्यायतनानि च । दर्शितानि Mb.13.156.11; विजने वायतने गिरौ वने वा । Bu. Ch. 5.19. -4 The site of a house, ground-plot. -5 A barn; Y.2.154. -6 An inner seat (with Buddhists who consider the five senses with manas as the six Āyatanas). -7 The cause of disease.
āyatanatvam आयतनत्वम् State of being an altar or seat.
āyatanavat आयतनवत् a. Having a certain seat or home. m. N. of the fourth foot of Brahmā; य एकमेवं विद्वाँश्चतुष्कलं पादं ब्रह्मण आयतनवानित्युपास्ते Ch. Up.4.8.4.
āvartana आवर्तन a. 1 Turning round or towards. -2 Revolving. -नम् 1 Turning round; returning, revolution. -2 Circular motion, gyration. -3 Churning or stirring up anything in fusion. -4 Melting together, fusion, alligation (said of metals). -5 Mid-day, the time when shadows are cast in an opposite direction. -6 Repeating, doing over and over again. -7 Study, practising. -8 A year; आवर्तनानि चत्वारि Mb.13.17.25. -नः 1 Viṣṇu. -2 N. of an उपद्वीप in the जन्बुद्वीप. -नी 1 a crucible. -2 a spoon, ladle. -3 magic art; विद्यामावर्तनीं पुण्यामावर्तयति स द्विजः Rām.7.88.2. (सांग्रहणी विद्या.)
āghātanam आघातनम् 1 Striking, killing. -2 A slaughter-house. आहव āhava आहाव āhāva आहवन āhavana आहव आहाव आहवन &c., See under आहु and आह्वे.
idaṃtana इदंतन a. (-नी f.) Of this time, present; momentary.
idānīṃtana इदानींतन a. (-नी f.) Present, momentary, of the present moment.
utkartanam उत्कर्तनम् 1 Cutting off, tearing out, cutting to pieces. -2 Rooting out, eradication.
utkīrtanam उत्कीर्तनम् 1 Crying out, proclaiming. -2 Praising, celebrating, extolling; S. D.495.
utpatanam उत्पतनम् 1 Flying up, a leap, spring. -2 Rising or going up, ascending. -3 Throwing up. -4 Birth, production.
uddyotanam उद्द्योतनम् The act of enlightening, illumination.
udvartanam उद्वर्तनम् 1 Going up, rising. -2 Springing up, growth (of plants, grain &c.) -3 Prosperity, elevation. -4 Turning from side to side; springing up, popping the head; चटुलशफरोद्वर्तनप्रेक्षितानि Me.42. -5 Grinding, pounding. -6 Drawing out metal, wire-drawing. -7 Anointing, smearing; करोद्वर्तनार्थे चन्दनं समर्पयामि; cf. also सायण's commentary on the Śatapaṭha Brāhmaṇa 12.8.3.16. - सर्वसुरभिचन्दनादि उन्मर्दनं उद्वर्तनं यजमानस्य भवति । -8 Particularly, rubbing and cleaning the body with perfumes or fragrant unguents, or the unguents used for this purpose or to relieve pain; नाक्रामेद्रक्तविण्मूत्रष्ठीवनोद्वर्तनादि च Y.1.152; Ms.4.132 (अभ्य- ङ्गमलापकर्षणपिष्टकादि Kull.). In this connection the meaning 'vomiting' seems appropriate, along with other filthy objects; cf. उद्वृत्त = vomited. -9 Bad behaviour or conduct, rudeness.
upavartanam उपवर्तनम् 1 A place for exercise. -2 A place whether inhabited or not. -3 A district or Pargaṇā. -4 A kingdom (राज्य) उपवर्तनमाहर्तुमुद्यतो$स्म्यहमञ्जसा Śiva. B.31.11. -5 A bog, marshy place.
upāvartanam उपावर्तनम् 1 Coming or turning back, return; त्वदुपावर्तनशङ्कि मे मनः (करोति) R.8.53. -2 Revolving, turning round. -3 Approaching. -4 Ceasing.
etana एतनः 1 Breath. -2 A species of fish. (Silurus Pebrius)
kapītana कपीतनः N. of several plants:-- such as the holy fig-tree, the betel-nut tree &c. कपुच्छलम् kapucchalam कपुष्टिका kapuṣṭikā कपुच्छलम् कपुष्टिका 1 The ceremony of tonsure (of a child). -2 A patch of hair on each side of the head.
karketana कर्केतनः नम् A kind of gem or precious stone.
kartana कर्तन a. Cutting. -नम् 1 Cutting, lopping off; Y.2.229,286. -2 Spinning cotton or thread (तर्कुः कर्तनसाधनम्).
kīrtanam कीर्तनम् [कत्-ल्युट्] 1 Telling, narrating. -2 Praising, celebrating; सा तस्य वचनं श्रुत्वा रामकीर्तनहर्षिता Rām.5.33.14. -3 A temple; any work of art, a building; न कीर्तनैरलङ्कृता मेदिनी K.28;119. शंभोर्यो द्वादशानि व्यरचयदचिरात् कीर्तनानि ... । (Ind. Ant. Vol.IX. p.34.) -ना 1 Narration, recital. -2 Fame, glory.
kṛntanam कृन्तनम् Cutting, cutting off, dividing, tearing asunder; नातः परं कर्मनिबन्धकृन्तनम् Bhāg.6.2.46. कृन्तनिका; -नी 1 A small knife. -2 The sharp edge of a knife.
ketanam केतनम् [कित्-ल्युट्] 1 A house, an abode; अकलित- महिमानः केतनं मङ्गलानाम् Māl.2.9; मम मरणमेव वरमतिवितथके- तना Gīt.7. -2 An invitation, summons; Mb.13.23.12- 16. -3 Place, site; सौवर्णभित्ति संकेतकेतनं संपदामिव Ks.26.44. -4 A flag, banner; भग्नं भीमेन मरुता भवतो रथकेतनम् Ve.2. 23; Śi.14.28; R.9.39. -5 A sign, symbol; as in मकरकेतन. -6 An indispensable act (also religious); निवापाञ्जलिदानेन केतनैः श्राद्धकर्मभिः । तस्योपकारे शक्तस्त्वं किं जीवन् किमुतान्यथा Ve.3.16. -7 A spot, mark. -8 The body; तस्यां तु वानरो दिव्यः सिंहशार्दूलकेतनः Mb.1.225.15; Bhāg. 4.24.68; Gīt.7.5.
ghātana घातन [इन् णिच् भावे ल्युट्] A killer, murderer. -नम् 1 Striking, killing, slaughter. -2 Killing (as an animal at a sacrifice), immolatting; स्वपुत्रघातनं कृत्वा प्राप्तं तन्मांसभक्षणम् Ks.2.214.
tana चातन a. Driving away, removing. -नम् 1 Tormenting, afflicting. -2 Removing, scaring away.
cartana चर्तन a. Ved. Stringing together. -नम् A hook, or pin.
cetana चेतन a. (-नी f.) [चित् -ल्यु] 1 Animate, alive, living, sentient, feeling; चेतनाचेतनेषु Me.5 animate and inanimate. -2 Visible, conspicuous, distinguished. -नः 1 A sentient being, a man. -2 Soul, mind. -3 The supreme soul. -4 An animal in general. -ना 1 Sense, consciousness; चुलुकयति मदीयां चेतनां चञ्चरीकः R. G.; U.3.31; Māl.9.12; R.12.74; चेतनां प्रतिपद्यते regains one's consciousness. -2 Understanding, intelligence; पश्चिमाद्यामिनीयामात्प्रसादमिव चेतना R.17.1; ... शास्ताखानो$ल्प- चेतनः Śiva. B.29.9. -3 Life, vitality, animation; Bg.13.6. -4 Wisdom, reflection. -नम् Appearance. -2 The thinking principle, the mind; अच्युतचेतनः Bhāg.9.15.41.
cintanam चिन्तनम् ना [चिन्त्-भावे ल्युट्] 1 Thinking, thinking of, having an idea of; मनसा$निष्टचिन्तनम् Ms.12.5. -2 Thought, reflection. -3 Anxious thought.
ciraṃtana चिरंतन a. (-नी f.) [चिरं भवार्थे ट्युल् तुट् च] Of long standing, old, ancient; स्वहस्तदत्ते मुनिमासनं मुनिश्चिरंतन- स्तावदभिन्यवीविशत् Śi.1.15; चिरंतनः सुहृद् &c.
tadānīṃtana तदानींतन a. Belonging to that time, contemporary of that time; एषो$स्मि कार्यवशादायोध्यिकस्तदानींतनश्च संवृत्तः U.1.
tana तातनः The Khañjana or wagtail.
divātana दिवातन a. (-नी f.) [दिवा भवः टथु तुद् च] Of or belonging to the day; शशिन इव दिवातनस्य लेखा Ku.4.46; Bk.5.65.
doṣātana दोषातन a. (-नी f.) Nightly, nocturnal; दोषातनं बुध- बृहस्पतियोगदृश्यः (तारापतिः) R.13.76.
dyotana द्योतन a. [द्युत्-युच्] 1 Bright, shining; विलोक्य द्योतनं चन्द्रं लक्ष्मणं शोचनो$वदत् Bk.7.15. -2 Illuminating. -3 Explaining, elucidating. -नः A lamp. -नम् 1 Shining. -2 Illuminating. -3 Explaining. -4 Sight, seeing. -5 Light. -6 Dawn.
nartana नर्तनः [नृत्-ल्युट्] A dancer; Mb.12 63.4. -नम् Gesticulation, dancing, dance. -Comp. -गृहम्, -शाला a dancing hall. -प्रियः 1 an epithet of Śiva. -2 a peacock.
nikartanam निकर्तनम् See under निकृत्.
nikartanam निकर्तनम् 1 Cutting down or off, tearing; निकर्तनमिवा- त्युग्रं लाङ्गूलस्य महाहरिः Mb.7.17.25. -2 Annihilation, wiping out completely; उत्सादनममित्राणां परसेनानिकर्तनम् Mb.3.167.55.
nikṛntana निकृन्तन a. (-नी f.) Cutting down, destroying; विरहि- निकृन्तनकुन्तमुखाकृतिकेतकिदन्तुरिताशे (वसन्ते) Gīt.11. -नम् 1 Cutting, cutting off, destruction. -2 An instrument for cutting; एकेन नखनिकृन्तनेन सर्वं कार्ष्णायसं विज्ञातं स्यात् Ś. B. -3 N. of a hell.
niketana निकेतनः An onion. -नम् 1 A mansion, house, abode; सिञ्जाना मञ्जुमञ्जीरं प्रविवेश निकेतनम् Gīt.11; Ms.6.26;11. 129; Ki.1.16. -2 A temple.
nipatanam निपतनम् 1 Falling down, descending, alighting. -2 Flying down.
nipātana निपातन a. Killing, destroying. -नम् 1 Throwing down, beating or knocking down; अवगूर्य चरेत् कृच्छ्रमति- कृच्छ्रं निपातने Ms.11.29. -2 Overthrowing, destroying, killing; माषकस्तु भवेद्दण्डः श्वसूकरनिपातने Ms.8.298. -3 Touching with. -4 Putting down as irregular or exceptional. -5 An irregular form of a word, irregularity, exception; यल्लक्षणेनानुत्पन्नं तत् सर्वं निपातनात् सिद्धम् Mbh. -6 Falling or flying down.
niyātana नियातन See निपातन.
nirghātanam निर्घातनम् Forcing out, bringing out.
niryātanam निर्यातनम् 1 Returning, restoring, delivering, restitution (as of a deposit). -2 Payment of a debt. -3 Gift, donation, -4 Retaliation, requital, revenge (as in वैरनिर्यातन); न ह्यन्यस्य भवेच्छक्तिः वैरनिर्यातनं प्रति Hariv. -5 Killing, slaughter.
nirvartanam निर्वर्तनम् 1 Accomplishment, completion, execution. -2 Desisting.
nivartana निवर्तन a. 1 Causing to return. -2 Turning back, ceasing. -नम् 1 Returning, turning or coming back, return; इह हि पततां नास्त्यालम्बो न चापि निवर्तनम् Śānti.3.2. -2 Not happening, ceasing. -3 Desisting or abstaining from (with abl.) -4 Desisting from work, inactivity (opp. प्रवर्तन); Kām.1.28. -5 Bringing back; Amaru. 84. -6 Repenting, a desire to improve. -7 A measure of land (2 rods). -8 Averting, keeping back from (with abl.) विनिपातनिवर्तनक्षमम् Ki.2.13.
niṣkartanam निष्कर्तनम् Cutting off, tearing away.
niṣpatanam निष्पतनम् Rushing out, issuing quickly.
tana नूतन नूत्न a. [नव एव स्वार्थे तनप् नुरादेशश्च] 1 New; नूतनो राजा समाज्ञापयति U.1.; R.8.15; नूतनजलधररुचये Bhāṣā P.; सालावृकाणां स्त्रीणां च स्वैरिणीनां सुरद्विषः । सख्यान्याहुर- नित्यानि नूत्नं नूत्नं विचिन्वताम् ॥ Bhāg.8.9.1. -2 Fresh, young. -3 Present. -4 Instantaneous. -5 Recent, modern. -6 Curious, strange. -नम् Youth, juvenility. -Comp. -वयस् (नूत्नवयस्) in the bloom of youth, in the spring of life.
tanayati नूतनयति Den. P. To make new, renew.
patanam पतनम् [पत्-भावे ल्युट्] 1 The act of flying or coming down, alighting, descending, throwing oneself down at. -2 Setting (as of the sun). -3 Going down to hell; निरये चैव पतनम् Ms.6.61. -4 Apostacy. -5 Falling from dignity, virtue &c. अनिग्रहाच्चेन्द्रियाणां नरः पतन- मृच्छति Y.3.219. -6 Fall, decline, ruin, adversity (opp. उदय or उच्छ्राय); ग्रहाधीना नरेन्द्राणामुच्छ्रायाः पतनानि च Y.1.38. -7 Death. -8 Hanging down, becoming flaccid (as breasts). -9 Miscarriage. -1 (In arith.) Subtraction. -11 The latitude of a planet. -Comp. -धर्मिन् a. subject to the law of decay, perishable. -शील a. accustomed to fall down.
pattanam पत्तनम् 1 A town, city (opp. ग्राम); पत्तने विद्यमाने$पि ग्रामे रत्नपरीक्षा M.1; एको वासः पत्तने वा वने वा Bh.3.12. -2 A musical instrument, मृदङ्ग.
parikartanam परिकर्तनम् 1 Cutting, cutting off. -2 A circular incision. -3 Cutting out. -4 A shooting pain.
parikīrtanam परिकीर्तनम् 1 Proclaiming, saying, talking of. -2 Boasting. -3 Naming.
paricintanam परिचिन्तनम् Thinking of, remembering.
paripatanam परिपतनम् Flying round or about.
parivartanam परिवर्तनम् 1 Moving to and fro, turning about, rolling about (as on the lap, bed &c.); महार्हशय्या- परिवर्तनच्युतैः स्वकेशपुष्पैरपि या स्म दूयते Ku.5.12; R.9.13; Śi.4.47. -2 Turning round, revolving, whirling round. -3 Revolution, end of a period or time. -4 Change; वेषपरिवर्तनं विधाय Pt.3. -5 Exchange, barter......परि- हापणमुपभोगः परिवर्तनमपहारश्चेति कोशक्षयः Kau. A.2.7.26. also राजद्रव्याणामन्यद्रव्येणादानं परिवर्तनम् -6 Inverting. -7 Requital, return.
tana पातन a. [पत्-णिच् ल्यु ल्युट् वा] Felling, cutting down. -नम् 1 Causing to fall down, bringing or throwing down, knocking down. -2 Throwing, casting. -3 Humbling, lowering. -4 Removing. -5 N. of a particular process to which minerals (esp. quicksilver) are subjected. N. B. पातनम् may have different meanings according to the noun with which it is used; e. g. दण़्डस्य पातनम् 'causing the rod to fall', i. e. chastising; गर्भस्य पातनम्' causing the fœtus to fall', causing an abortion.
tana पीतनः 1 A species of fig-tree (waved-leaf). -2 The hog-plum tree. -नम् 1 Yellow orpiment -2 Saffron. -3 The Sarala tree.
purātana पुरातन a. (-नी f.) 1 Old, ancient; बहिर्विकारं प्रकृतेः परं विदुः पुरातनं त्वां पुरुषं पुराविदः Śi.12.6; स एवायं मया ते$द्य योगः प्रोक्तः पुरातनः Bg.4.3. -2 Aged, primeval; त्वां न वेद्मि पुरुषं पुरातनम् R.11.85; Ku.6.9. -3 Worn out, decayed. -नः 1 An epithet of Viṣṇu. -2 (pl.) The ancients. (-नम्) 1 An ancient story. -2 A Purāṇa.
tana पूतनः A dead body in a cemetery. -ना 1 N. of a female demon who, while attempting to kill Kṛiṣṇa, when but an infant, was herself crushed by him. -2 A demoness, or Rākṣasī in general; मा पूतनात्वमुपगाः शिवतातिरेधि Māl.9.5. -3 Terminalia chebula (हरीतकी); 'पूतना राक्षसीभेदे हरीतक्यां च पूतना' Viśva. -Comp. -अरिः, -सूदनः, -हन् m. epithets of Kṛiṣṇa.
pūrvatana पूर्वतन a. Former, old, ancient.
pṛtanam पृतनम् Ved. 1 A hostile encounter. -2 An army.
potana पोतन a. 1 Sacred, holy. -2 Purifying.
prakīrtanam प्रकीर्तनम् 1 Proclaiming, announcing. -2 Praising, extolling, lauding. -ना Mentioning, naming.
pratana प्रतन a. (-नी f.) Old, ancient; प्रतनेनानुबन्धेन निजामोप- चिकीर्षया Śiva. B.8.8; ...... नयवर्त्म प्रतनं प्रवर्तयत् Śiva B.32.1. -Comp. -हविस् Old ghee to be used as an oblation.
pratighātanam प्रतिघातनम् 1 Repulsing, warding off. -2 Killing, slaughter.
praticintanam प्रतिचिन्तनम् Meditating upon.
pratiniryātanam प्रतिनिर्यातनम् 1 Retribution, retaliation. -2 Returning, giving back.
pratinivartanam प्रतिनिवर्तनम् Returning, return. -2 Turning away from.
pratiyātanam प्रतियातनम् Requital, retaliation; as in वैरप्रतियातनम्; अयं हि कालो$स्य दुरात्मनो वै पार्थस्य वैरप्रतियातनाय Mb.8.9.14.
prativartanam प्रतिवर्तनम् Returning.
pradyotanam प्रद्योतनम् 1 Blazing, shining. -2 Light. -नः 1 The sun. -2 N. of a prince of Ujjayinī.
pranighātanam प्रनिघातनम् Killing, slaughter.
prapatanam प्रपतनम् 1 Flying forth or away. -2 Throwing oneself into, falling down. -3 Alighting. -4 Death, destruction. -5 A precipice, a steep crag. -6 Assualt; लीयन्ते यत्र शत्रुप्रपतनविवशाः कोटिशः शूरकीटाः Mv.6.32.
prapātanam प्रपातनम् Causing to fall, throwing down (on the ground).
prayatanam प्रयतनम् Effort, endeavour; see प्रयत्न; तद्दैवस्यानुगुण्यात् प्रयतनविभवैश्चाद्य राज्ये$भिषिच्य Mv.7.38.
pravicetanam प्रविचेतनम् Understanding.
pravartanam प्रवर्तनम् 1 Going on, moving forward. -2 Beginning, commencement. -3 Setting on foot, founding, establishing, instituting. -4 Prompting, urging, simulating, inciting. -5 Engaging in, applying oneself to. -6 Happening, coming to pass. -7 Activity, action. -8 Behaviour, conduct, procedure. -9 Directing, superintending. -1 Employment. -11 Exhortation. -ना Inciting or prompting to action; अस्ति प्रवर्तनारूपमनुरूपं चतुर्ष्वपि Bh.
prāktana प्राक्तन a. (-नी f.) 1 Former, previous, antecedent; प्रपेदिरे प्राक्तनजन्मविद्याः Ku.1.3. -2 Old, ancient, early. -3 Relating to a former life or acts in a former life; संस्काराः प्राक्तना इव R.1.2; Ku.6.1. -नम् (or प्राक्तन- कर्मन्) n. Fate, destiny. -Comp. -कर्मन् n. any act formerly done, or done in a former state of existence. -जन्मन् n. a former birth.
prātastana प्रातस्तन a. (-नी f.) Relating to the morning; matutinal. -नम् early morning.
prāyaścetanam प्रायश्चेतनम् Atonement, expiation; प्रायश्चेतनमादिशन्तु गुरवो रामेण दान्तस्य मे Mv.4.25.
prāhṇetana प्राह्णेतन a. (-नी f.) Relating to, or happening in, the forenoon; P.IV.3.23. प्राह्णेतराम् prāhṇētarām तमाम् tamām प्राह्णेतराम् तमाम् ind. Very early in the morning.
mrātanam म्रातनम् Cyperus Rotundus (Mar. बिंबली नागरमोथा).
yatanam यतनम् Exertion, effort.
tanam यातनम् 1 Return, requital, recompense, retaliation; as in वैरयातनम्. -2 Vengeance, revenge. -ना 1 Requital, recompense, return. -2 Torment, acute pain, anguish. -3 The torments inflicted by Yama upon sinners, the tortures of hell (pl.) ˚अर्थीय destined to suffer the torments of hell; शरीरं यातनार्थीयम् Ms.12.16. ˚गृहः torture-chamber.
retanam रेतनम् Semen.
vartana वर्तन a. [वृत्-ल्यु ल्युट् वा] 1 Abiding, living, staying, being &c. -2 Stationary. -नः A dwarf. -नी 1 A road, way. -2 Living, life. -3 Pounding, grinding. -4 Sending off, despatching. -5 A spindle. -नम् 1 Living, being. -2 Staying, abiding, residing. -3 Action, movement, mode or manner of living; स्मरसि च तदुपान्तेष्वावयो- र्वर्तनानि U.1.26; (the word may here mean 'abode or residence', also). -4 Living on, subsisting (at the end of comp.). -5 Livelihood, maintenance, subsistence; तैरेवास्य कलेः कलेवरपुषोव दैनंदिनं वर्तनम् Bv.1.13. -6 Turning round, revolving. -7 Rolling on, moving about. -8 Appointing. -9 A means of subsistence, profession, occupation. -1 Conduct, behaviour, proceeding. -11 Wages, salary, hire. -12 Commerce, traffic. -13 A spindle. -14 A globe, ball. -15 Application of; colouring; निहितमलक्तवर्तनाभिताम्रम् Ki.1.42. -16 An oftentold word. -17 Decoction. -Comp. -विनियोगः salary, wages.
vikartana विकर्तनः 1 The sun; U.5. -2 The Arka plant. -3 A son who has usurped his father's kingdom.
vicetana विचेतन a. 1 Senseless, lifeless, unconscious, dead. -2 Inanimate; प्रमदाः पतिवर्त्मगा इति प्रतिपन्नं हि विचेतनैरपि Ku.4.33. -3 Perplexed, confounded; एकमुक्तः स मुनिना महीपालो विचेतनः प्रत्याख्यानाय चाशक्तः Mb.3.97.3. -4 Ignorant, foolish.
vidyotana विद्योतन a. (-नी f.) 1 Illuminating, irradiating. -2 Illustrating, elucidating. -नम् Lightning.
vinipātanam विनिपातनम् Causing miscarriage.
viparivartanam विपरिवर्तनम् Turning about, rolling. -Comp. -विद्या a magical formula for causing a person to return; Ks.
vivartanam विवर्तनम् 1 Revolving, revolution, whirling round. -2 Rolling about, turning round; शय्याप्रान्तविवर्तनै- र्विगमयत्युन्निद्र एव क्षपाः Ś.6.5; Ve.2.8;5.4; Mv.7.5. -3 Rolling back, returning; लाङ्गूलचालनं क्ष्वेडा प्रतिवाचो विवर्तनम् Mb.5.72.71; वप्रान्तस्खलितविवर्तनं पयोभिः Ki.7.11. -4 Rolling down, descending. -5 Existing, abiding. -6 Reverential salutation. -7 Passing through various states or existences. -8 An altered condition; पुनरकाण्ड- विवर्तनदारुणो प्रविशिनष्टि विधिर्मनसो रुजम् U.4.15; Māl.4.7. -9 Moving or wandering to and fro; तामिस्रादिषु चोग्रेषु नरकेषु विवर्तनम् Ms.12.75. -1 Transformation. -11 Circumambulating (प्रदक्षिणा)
viśātanam विशातनम् 1 Rending asunder, cutting off, destroying; नमस्ते देवदेवेश सनातन विशातन Mb.7.83.18. -2 Setting free, delivering, releasing.
tanau वीतनौ (m. dual) The sides of the larynx or throat.
vetanam वेतनम् [अज्-तनन् वीभावः Uṇ.3.15] 1 Hire, wages, salary, pay, stipend; किं मुधा वेतनदानेन M.1; R.17.66; Ms.8.5. -2 Livelihood, subsistence. -3 Silver. -Comp. -अदानम्, -अनपाकर्मन् n., -अनपक्रिया 1 non-payment of wages; एष धर्मो$खिलेनोक्तो वेतनादानकर्मणः Ms.8.218. -2 an action for non-payment of wages. -जीविन् m. a stipendiary. -दानम् hiring. -भुज् a servant.
vaikartana वैकर्तनः N. of Karṇa; हतो वैकर्तनः कर्णो दिवाकरसमद्युतिः Mb.12.5.14. -Comp. -कुलम् the solar race.
vyapavartanam व्यपवर्तनम् Return.
vyāvartanam व्यावर्तनम् 1 Surrounding, encompassing. -2 Revolving, turning round; व्यावर्तनैरहिपतेरयमाहिताङ्कः Ki.5.3. -3 A fold, band. -4 Coil (of a snake). -5 A turn (of a road).
śatanam शतनम् Cutting down, felling.
śātanam शातनम् 1 Whetting, sharpening. -2 Cutting down, destroyer; as in पर्वतपक्षातनम् R.3.42. -3 Causing to fall or perish. -4 Causing to decay or wither. -5 Becoming thin or small, thinness. -6 Withering, decaying; वसन्ते सर्वशस्यानां जायते पत्रशातनम् Adhikaraṇamālā. -7 Polishing, planing.
śāntanavaḥ शान्तनवः 'The son of Śantanu', N. of Bhīṣma.
śvastana श्वस्तन a. (-नी f.), -श्वस्त्य a. Relating to the morrow, future. -नम् The future.
saṃkīrtanam संकीर्तनम् ना 1 Praising, applauding, extolling. -2 Glorification (of a deity) -3 Repeating the name of a deity as a pious or devotional act.
saṃketanam संकेतनम् 1 Appointment, agreement. -2 A rendezvous.
sacetana सचेतन a. 1 Sentient, animate, rational. -2 Conscious, sensible.
saṃcintanam संचिन्तनम् Consideration, reflection.
satanam सतनम् A variety of sandal, red and smelling like earth; सतनं सक्तं भूमिगन्धि Kau. A.2.11.
sadātana सदातन a. Incessant, perpetual, eternal. -नः An epithet of Viṣṇu.
sanātana सनातन a. (-नी f.) 1 Perpetual, constant, eternal, permanent; ज्वलन्मणिव्योमसदां सनातनम् Ki.8.1; एष धर्मः सनातनः. -2 Firm, fixed, settled; एष धर्मः सनातनः U.5. 22. -3 Primeval, ancient. -तः 1 The primeval being, Viṣṇu; सनातनः पितरमुपागमत् स्वयम् Bk.1.1. -2 N. of Śiva. -3 Of Brahman. -4 A guest of the Manes. -5 N. of one of the sons of Brahman. -6 An ancient sage; द्विजाति- चरितो धर्मः शास्त्रे दृष्टः सनातनैः Rām.2.61.23. -नी 1 N. of Lakṣmī. -2 Of Durgā or Pārvatī. -3 Of Sarasvatī.
samāvartanam समावर्तनम् 1 Return. -2 Especially, a pupil's return home after finishing his course of holy study.
samutpatanam समुत्पतनम् 1 Flying, ascending. -2 Effort, exertion.
saṃpravartanam संप्रवर्तनम् Undertaking, beginning.
sāyaṃtana सायंतन a. (-नी f.) Belonging to the evening, evening; सायंतने सवनकर्मणि संप्रवृत्ते Ś3.27; अलिनारमतालिनी शिलीन्ध्रे सह सायंतनदीपपाटलाभे Śi.6.72. -Comp. -मल्लिका evening Jasmine. -समयः eventide.
stana स्तनः [स्तन्-अच्] 1 The female breast; स्तनौ मांसग्रन्थी कनककलशावित्युपमितौ Bh.3.2; (दरिद्राणां मनोरथाः) हृदयेष्वेव लीयन्ते विधवास्त्रीस्तनाविवं Pt.2.91. -2 The nipple of the breast. -3 The breast, udder, or dug of any female animal; अर्धपीतस्तनं मातुरामर्दक्लिष्टकेशरम् Ś.7.14. -Comp. -अंशुकम् a cloth covering the breasts or bosom, breastmantle. -अग्रः a nipple. -अङ्गरागः a paint or pigment smeared on the breasts of women. -अन्तरम् 1 the heart. -2 the space between the breasts; (न) मृणालसूत्रं रचितं स्तनान्तरे Ś.6.17; R.1.62. -3 a mark on the breast (said to indicate future widowhood). -आभुज a. feeding with the udder (said of cows). -आभोगः 1 fulness or expanding of the breasts. -2 the circumference or orb of the breast. -3 a man with large breasts like those of a woman. -आवरणम् a breast-cloth. -उपपीडम् pressing the breast. -कलशः a jar-like breast. -कुड्मलम् a woman's breast. -कोटिः the nipple of the breast. -ग्रहः the sucking or drawing of the breast. -चूचुकम् the nipple of the breast. -तटः, -टम् the slope or projection of the breast; cf. तट. -त्यागः weaning. -प, -पा, -पायक, -पायिन् a. sucking the breast, suckling. -पतनम् flaccidity of the breast. -पानम् sucking of the breast. -भरः 1 the weight or heaviness of breasts; पादाग्रस्थितया मुहुः स्तनभरेणानीतया नम्रताम् Ratn.1.1. -2 a man having breasts like those of a woman. -भवः a particular position in sexual union. -मध्यः a nipple. (-ध्यम्) the space between the breasts. -मुखम्, -वृन्तम्, -शिखा a nipple. -रोहितः, -तम् a particular part of the female breast. -वेपथुः the having of the breast; अद्यापि स्तनवेपथुं जनयति श्वासः प्रमाणाधिकः &Sacute.1.29.
stanathaḥ स्तनथः Ved. Thunder.
stananam स्तननम् [स्तन्-ल्युट्] 1 Sounding, a sound, noise. -2 Roaring, thundering, rumbling (of clouds). -3 Groaning. -4 Breathing hard. -5 The sound of a hollow cough; Suśr.
stanayitnuḥ स्तनयित्नुः [स्तन्-इत्नु] 1 Thundering, thunder, the muttering of clouds; मौर्वीघोषस्तनयित्नुः पृषत्कपृषतो महान् Mb.6.14.27; Bhāg.1.14.15. -2 A cloud; स्तनयित्नो- र्मयूरीव चकितोत्कण्ठितं स्थिता U.3.7;5.8. -3 Lightning. -4 Sickness. -5 Death. -6 A kind of grass.
hyastana ह्यस्तन a. (-नी f.) Belonging to yesterday; as in ह्यस्तनी वृत्तिः, ह्यस्तनेन च कोपेन शक्तिं वै प्राहिणोन्मयी Mb.5. 184.4. -Comp. -दिनम् yesterday, the previous day.
Macdonell Vedic Search
6 results
tanaya tán-aya, n. descendant, ii. 33, 14 [tan extend].
dyotana dyót-ana, a. shining, viii. 29, 2 [dyut shine].
tana nú̄-tana, a. present, i. 1, 2 [nú̄ now].
stanatha stan-átha, m. thunder, v. 83, 3.
stanayant stanáyant, pr. pt. thundering, v. 83, 2; x. 168, 1.
stanayitnu stanayi-tnú, m. thunder, v. 83, 6.
Macdonell Search
78 results
tanaya a. continuing a family; belonging to one's own family; m. son; â, f. daughter; n. progeny; race, family; child.
tanayīkṛta pp. made a son.
akīrtana n. lack of mention.
acetana a. senseless; unconscious, inanimate; thoughtless; -tâ, f. -ness.
ajagalastana m. dew-lap on the neck of the goat.
adyatana a. (î) of to-day, present, contemporary; -tanîya, a. id.
adhiketanam ad. on the banner.
anadyatana m. not to-day; not the same day; a. not containing to-day.
anukīrtana n. proclaiming, men tioning; blazing abroad; -kîrtya, fp. to be proclaimed.
anucintana n. reflexion; -â, f. id.
apakartana n. cutting in pieces; -kartri, m. injurer; -karman, n. delivery; -karsha, m. removal; decrease; deterioration; low position; annulment; anticipation (gr.); -karshaka, a. diminishing, detracting; -kar shana, a. id.; n. removal; degradation; -kar shin, a. drawing away; -kalmasha, a. free from sin; -kâra, m., -tâ, f. hurt, injury; -kârin, a. injurious; offensive; mischievous; -kîrtya, fp. dishonourable.
abhipatana n. swoop.
aśvastana a. having nothing for to-morrow: i-ka, a. id.
āpatana n. sudden appearance.
āyatana n. place, abode, seat (-tva, n. abst. n.); fire-place; sacred pre cinct, temple; barn.
idānīntana a. present, now living.
idantana a. present, now living.
utpatana a. (î) flying up; n. leap ing up.
udvartana a. bursting (--°ree;); n. leap ing up; rising; unction; unguent.
upāvartana n. return.
kartana n. cutting off; -ari, -kâ, f. cutting instrument, scissors; -arî, f. id.
kutanaya m. bad son.
kulapatana n. fall --, degradation of the family; -pati, m. head of the family; -parvata, m. chief mtn. or mtn.-range; -p&asharp;, m. f. head of the family or community; -pâms anî, f. disgrace to her family; -pâlikâ, f. N.; -putra, m. son of a good family; virtuous youth: -ka, m. id.; -purusha, m. man of good family; virtuous man; -pratishthâ, f. support of the race; -prasûta, pp. born of a noble race; -bhava, a.coming of a noble race; -bhavana, n. chief residence; -bhûta, pp. being the head of the guild; -bhûbhrit, m. chief mtn. or mtn.-range; model of a prince; -mârga, m. ancestral path; -mitra, n. friend of the family.
kīrtana n. mention, report; enu meration; narration; -anîya, fp. to be men tioned or praised.
kṛṇotana V. 2 pl. impv. of √ kri, do.
kṛntana n. cutting up or off.
ketana n. invitation; shelter; place; body; sign, token, banner; business.
gostana m. cow's udder; *pearl necklace with four strings; -svâmin, m. owner of cows.
tana cs. a. driving away (--°ree;).
cirantana a. old, ancient.
cetana a. (&isharp;) manifest, distinguished; sentient, animate, conscious; m. intelligent being; n. perception, appearance; â, f. con sciousness, intelligence, mind.
divātana a. (î) diurnal.
devyāyatana n. temple of Durgâ.
doṣātana a. belonging to the evening, nocturnal.
dyotana a. flashing; illu minating; n. shining; showing, displaying.
dhūmaketana m. (smoke-ban nered), fire; (á)-ketu, a. smoke-betokened, smoke-bannered; m. fire; Agni; comet; N. of a Yaksha; (á)-gandhi, a. smelling of smoke; -graha, m. Râhu; -gâla, m. film of smoke; -dhvaga, m. fire; -pa, a. smoking (a pipe); imbibing only smoke (i. e. subsist ing on nothing else); -pallava, m. streak of smoke; -pâta, m. wreath of smoke; -pâna, n. inhalation of smoke or vapour; -maya, a. (î) consisting entirely of smoke or vapour.
nartana m. dancer; n. dance: -sâlâ, f. dancing-room.
naṣṭacetana a. having lost con sciousness; -keshta, a. motionless; -dhî, a. having lost the remembrance of an injury; -nidra, a. deprived of one's sleep; -rûpa, a. invisible, unrecognised; -samgña, a. whose consciousness is impaired.
nipatana n. falling; flying, flight; -pâta, m. fall; descent; cast (of a look); fall ing from (ab.) on (--°ree;); alighting (of a bird); fall (fig.); assault, attack; death; incidental mention; irregularity (gr.); particle (gr.); -pâtana, n. causing to fall or descend; falling down; flying down (of a bird); beating, striking; destroying, killing; incidental men tion, esp. of an irregular or rare form (gr.): -pratîkâra, m. repelling of assaults; -pâtin, a. falling down; dropping; alighting, on (--°ree;); striking down, destroying, consuming; -pâdá, m. lowland, valley; -pâna, n. drinking; trough; trench, tank, pool: -vat, a. abound ing in pools, -saras, n.drinking-pool.
niścetana a. unconscious; inani mate; irrational, senseless; -ketas, a. irra tional, senseless, foolish; -keshta, a. motion less.
tana a. new; young; fresh; youth ful (age); recent; present; novel, strange; -tna, a. id.; future.
patana n. flying, flight; flying or falling down, descent, fall, from (ab.), into (lc. or --°ree;); casting oneself (into, --°ree;), prostra tion (at, --°ree;); hanging down, flaccidity (of the breasts); fall, ruin; getting into (lc.): -sîla, a. accustomed to fall down.
pattana n. town.
parāvartana n. turning round; -vritti, f. return; failure; exchange.
tana a. felling; n. causing to fall, throwing down, casting (dice); striking off or down; dandasya --, infliction of the rod, chastisement; garbhasya -, causing a mis carriage; î-ya, fp. to be cast or shot at (lc.).
purātana a. (î) belonging to the olden time, bygone, former, ancient, old: lc. formerly, in olden times, in bygone ages; m. pl. the ancients.
tana m. kind of demon, spectre: â, f. N. of a female demon causing a certain disease in children, and killed by Krishna; i-kâ, f. id.
pṛtana n. hostile host; â, f. contest, battle; hostile host; army; sp. division of an army (consisting of 243 elephants, 243 cha riots, 729 cavalry, and 1215 infantry).
prakīrtana n. proclaiming, announcing: â, f. mention; -kîrti, f. celebration, praise; -kuñka, m. a measure of capacity equal to about a handful; -krita, pp. √ kri: -tva, n. state of being in question.
praścotana n. dripping, sprink ling.
prāktana a. (î) anterior, former, previous; ancient; -tanaya, m. former pu pil; -tarâm, ad. farther east; -tûla, a. having the tufts directed eastwards: -tâ, f. eastward direction (of sacrificial utensils);-pada, n. first member of a compound (gr.); -pravana, a. sloping towards the east.
prātastana a. matutinal; n. early morning (one of the five parts of the day; the other four being forenoon, midday, after noon, and evening); -tya, a. matutinal, morn ing.
mūḍhacetana a. stupid, foolish; -ketas, a. id.; -tâ, f., -tva, n. bewilderment, stupefaction, infatuation; stupidity, foolish ness; -drishti, a. having a dull look, stupid, silly; -dhî, a. dull-witted, stupid, foolish; -prabhu, m. chief of fools, great blockhead; -buddhi, -mati, a. confused in mind, dull witted, stupid, foolish; -½âtman, a. uncon scious.
tana n. requital: â, f. id.; punishment; fine; sg. & pl. anguish, tor ment; tortures of hell: -m dâ, requite any one; -griha, m. torture chamber; -½arthîya, a. destined for torments (body).
rājatanaya m. king's son, prince: â, f. princess; -taramginî, f. Stream (= continuous history) of Kings, T. of various chronicles of Cashmere; N.; -tâ, f. kingship, royalty.
vartana a. [√ vrit] setting in motion, quickening (rare); n. staying or sojourn in (lc.); living on (in.), subsistence, livelihood, occupation (ord. mg.); wages; association with (saha); proceeding, conduct; applica tion of (--°ree;).
vikartana a. dividing; m. sun; n. cutting up; dividing; -kartri, m. trans former; insulter; -karma-krit, a. following unlawful occupations; -karma-kriyâ, f. per formance of unlawful actions; -karman,n. unlawful act or occupation; -karma-stha, a. following an unlawful occupation; -kar sha, m. pulling asunder; separation of semi-vowel combinations, etc.; distance, interval; -karsha- na, n. pulling asunder; drawing (of a bow); searching out, investigation.
vicetana a. unconscious; not hav ing all one's senses about one, absent-minded; lifeless, dead; senseless, stupid; -ketayitri, a. making visible, distinguishing; -ketavya, fp. to be sought; -searched through; -ex amined; -found out (means); (ví)-ketas, a. clearly seen (waters; RV.); discerning, wise (RV.); confounded (C.); senseless, stu pid (C.); -keya, fp. 1. to be distinguished or counted (=few, of stars); 2. to be looked for; -searched through; n. investigation; -kesh- ta, a. motionless; -keshtana, n. kicking, roll ing (on the ground, of horses); -keshtâ, f. behaviour, conduct; -keshtita, (pp.) n. motion (of the body, eyes); gesture, action, working; conduct.
vetana n. wages; price (rare).
vaikartana a. relating or belonging to the sun (vikartana): -kula, n. solar race.
vairaniryātana n. requital of enmity, revenge.
śāṃtanava a. (î) composed by Samtanu; m. pat. of Bhîshma.
śātana a. (î) causing to fall; cut ting off, clipping (wings); destroying, wear ing out (the body); n. causing to fall off, clipping, plucking; destruction; means of removing (hair etc.).
śvastana a. relating to the morrow: e&zip;hani, on the morrow; î, f. the suffix -tri as characteristic of the future, future tense.
sadātana a. everlasting; -dâna, a. 1. perpetually giving; 2. perpetually dis charging temple-juice.
saptana f. bird-lime.
saptanavata a. ninety-seventh; -pattra, a. seven-leaved; yoked with seven horses; m. a tree (Alstonia scholaris; = -kkhada); (á)-pad, a. (-î) taking seven steps (with which an alliance or marriage is con cluded); concluded, confirmed; (á)-pada, a. taking seven steps (with which an alliance or marriage is concluded); consisting of seven Pâdas: î, f. seven steps: -karana, n. ratification of a marriage by the seven steps taken by the bride; -parna, m. (seven leaved) a tree (Alstonia scholaris = -kkhada); -palâsa, a. consisting of seven leaves; -bha&ndot; g&ibrevcirc;-naya, m. method of the seven formulas beginning with &open;perhaps&close; (syât) in the scep tical dialectics of the Jains; -bhûmika, a. id.
sanātana a. (î) everlasting, eternal, perpetual, permanent; m. N. of a Rishi (a spiritual son of Brahman).
samāvartana n. return home (of a pupil after the completion of his reli gious studies); -vaha, a. bringing, producing (--°ree;); -(â)vâya, m. metr. for -(a)vâya; -vâ sa, m. abode, habitation; -vritti,f.=-âvar tana; -vesa, m. entering; absorption in (--°ree;); simultaneous occurrence, co-existence (ord. mg.); agreement with (--°ree;); -sraya, m. con nexion with (--°ree;); shelter, refuge, asylum (ord. mg.); dwelling-place, habitation; re lation, reference (rare); resorting to (--°ree;): ab. in consequence of, owing to; a. (--°ree;) dwelling or situated in; relating to; -sraya- na, n. resorting or attaching oneself to (--°ree;); -srayanîya, fp.to be sought refuge with; taken service with; m. master (opp. samâ srita, servant); -srayin, a. occupying, ob taining possession of (--°ree;); -srita, pp. √ sri; m. servant: -tva, n. having betaken oneself to (the protection of, --°ree;); -slesha, m. em brace; -svâsa, m. recovery of breath, relief, encouragement; consolation; -svâsana, n. encouraging, comforting; consolation; -svâs ya, fp. to be consoled.
sahāyatana a. together with the fire-place.
sāyantana a. (î) belonging to the evening.
stanatha m. roar of the lion (RV.1); -áthu, m. id. (AV.).
stana m. (--°ree; a., f. â, î) female breast, teat (human or animal): -kalasa, m. jar-shaped breast; N. of a bard; -kudmala, m. n. bud like breast; -kumbha, m. jar-shaped breast; -koti, f. nipple; -koraka,m. n. bud-like breast; -tata, m. n. rounded female breast.
stanavepathu m. heaving of the breast.
stanayitnu m. [fr. cs. of √ stan] thunder (sg. pl.; V., C.); thunder-cloud (C.).
stanayadama a. having a roar ing onset (Maruts; RV.1).
stanapa a., m. id.; -patana, n. flac cidity of the breasts; -pâna, n. sucking of the breast; -bhara, m. weight of breasts, swelling bosom; -mandala, n. rounded female breast; -madhya, n. space between the breasts.
stanaṃdhaya a. (î) sucking [√ 2. dhâ] the breast; m. suckling, infant; calf.
Vedic Index of
Names and Subjects
78 results7 results
tanaya n., denotes ‘ offspring,’ ‘descendants’ in the Rigveda, where also it is often used adjectivally with Toka. There seems no ground for the view that toka means 'sons,' 'children,' and tanaya 'grandchildren.'
āyatana The general sense of ‘ abode ’ or home ’ appears to be limited in one passage of the Chāndogya Upanisad to the sense of ‘ holy place,’ sanctuary/ which is found in the epic.
govikartana (Cow-butcher ’) designates the f huntsman ’ in the śatapatha Brāhmana. See Goghāta.
traitana Appears in the Rigveda as a Dāsa, an enemy of Dīrghatamas, who seems to have engaged him in single combat and defeated him. The St. Petersburg Dictionary suggests that he is rather a supernatural being allied to Trita (c/. the Avestan Thrita and Thraetaona).
dyotana Is, according to Sāyana, the name of a prince in the Rigveda. This is probably correct, though the word may also be interpreted as denoting 'glorification*; but it is not clear what relation existed between Dyotana and the other persons mentioned in the same passage, Vetasu, Daśoni, Tūtuji, and Tugra.
sanātana Is the name of a mythical Rṣi in the Taittirīya Samhitā. In the Bṛhadāraṇyaka Upaniṣad he appears in the first two Vamśas (lists of teachers) as the pupil of Sanaga and the teacher of Sanāru, both equally mythical persons.
stanayitnu Sing, and plur., denotes ‘thunder’ from the Rigveda onwards.
Bloomfield Vedic
Concordance
78 results7 results7 results
tanaye toke asmad ā SV.2.854c.
āgantana samanaso yati ṣṭha # RV.7.43.4d.
āvartana nivartanam # RV.10.19.4c,5c; AVś.6.77.2c. Cf. āvartane vi-.
juhotana vṛṣabhāya kṣitīnām # RV.7.98.1b; AVś.20.87.1b.
dadhātana draviṇaṃ citram asme # RV.10.36.13d; MS.4.14.11d: 232.9; TB.2.8.6.4d.
paretana (TS.KS.Apś. pareta) pitaraḥ somyāsaḥ (TS.Apś. somyāḥ) # TS.1.8.5.2a; MS.1.10.3a: 143.8; 1.10.19: 159.6; KS.9.6a; 36.13; Aś.2.7.9a; Apś.1.10.7; Mś.1.1.2.14,37; 1.7.6.52; 11.9.1.5. See under ā ganta pitaro.
pracetana pracetaya # ā.4.2b; Aś.6.2.9a; 3.11; Mahānāmnyaḥ 2c.
Dictionary of Sanskrit Search
"tana" has 19 results
tana(1)personal ending for त of the second person. plural Parasmaipada in the imperative in Vedic Literature e.g जुजुष्टन for जुषत confer, compare Kāśikā of Jayāditya and Vāmana. On P VII. 1.45; (2) taddhita affix. affixes टयु and टयुल् id est, that is अन which, with the augment त्, in effect becomes तन exempli gratia, for example सायंतन, चिरंतन, et cetera, and others: confer, compare P. IV. 3.23.
anadyatanaperiod of time not pertaining to the day in question; used in connection with past time, to express which the imperfect is generally used; also in connection with the future time, to express which the first future is generally used e gह्यः अपचत्, श्वः कर्ता et cetera, and others confer, compare P.III.2.111,113; III. 3.15,135: V.3.21.
anuvartanacontinuation or recurrence of a word from the preceding to the succeeding rule; the same as anuvṛtti; confer, compare अनुवर्तन्ते नाम विधयः । न चानुवर्तनादेव भवन्ति। किं तर्हि । यत्नाद्भवन्तीति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.1.3.
ādyudāttanipātanaspecific mention of a word with the accent udātta or acute on the first syllable; confer, compare आद्युदात्तनिपातनं करिष्यते M.Bh. on I.1. 56, VI.1.12.
uddyotanaprabhāname of a commentary on the 'Tantrapradipa' of Maitreya Rakṣita,which latter is a commentary on Jinendrabuddhi's Kāśikāvivaraṇapañjikā, a commentary on the Kāśikāvṛtti by Jinendrabuddhi, called Nyāsa. which itself is a commentary on Jayāditya's Kāśikā.
kumārīstanayugākṛtia phrase used in the gloss on the कातन्त्र by Durgasiṁha's Kātantra-Sūtravṛtti. to give along with the definition of र्विसर्जनीय or विसर्ग a graphic description of it as shown in script confer, compare Kāt, I.1.16 commentary
tanap'Personal ending for त of the Second Pers.. plural e. g. दधातन for धत्त. Cf Kas on P. VII. 1.45. See तन.
dyotanaconveyance of sense indirectly or by suggestion, and not directly. See द्योतक a reference to some preceding word, not necessarily on the same page..
nipātanaa word given, as it appears, without trying for its derivation,in authoritative works of ancient grammarians especially Panini;confer, compareदाण्डिनायनहास्तिनयनo P. VI.4.174, as also अचतुरविचतुरo V.4.77 et cetera, and others et cetera, and others The phrase निपातनात्सिद्धम् is very frequently used by Patanjali to show that some technical difficulties in the formation of a word are not sometimes to be taken into consideration, the word given by Panini being the correct one; confer, compare M.Bh.on I.1.4, III.1.22 et cetera, and others et cetera, and others; cf also the usual expression बाधकान्येव निपातनानि. The derivation of the word from पत् with नि causal, is suggested in the Rk Pratisakhya where it is stated that Nipatas are laid down or presented as such in manifold senses; cf Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.)XII.9; cf also घातुसाधनकालानां प्राप्त्यर्थं नियमस्य च । अनुबन्घविकाराणां रूढ्यर्थ च निपातनम् M. Bh Pradipa on P. V.1.114: confer, comparealso Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on II.1.27.
nipātanasvarathe accent, with which the Nipatana word is expressed in the Sutra, which is said to prevail over the accent which ordinarily should be possessed by the word; confer, compare स निपातनस्वरः प्रकृतिस्वरस्य बाधको भविष्यति M.Bh. on P.I.1.56 Vart. 23; confer, compare also M.Bh. on I.3.3, VI.1.123 et cetera, and others .
parivartanareversion in the order of words as found in the recital of the Veda at the time of the recital of जटा, घन and other artificial types of recitations.
prayatanathe same as प्रयत्न; see प्रयत्न.
vivartanatransformation; the word is generally used in the sense of transformation of the Padapāṭha into the Saṁhitāpāṭha.
śāntanavaan ancient scholar of grammar who wrote a treatise known as the Phit sutras on accents.
uṇādisūtravṛttia gloss on the Uṇādi Sūtras in the different versions. Out of the several glosses on the Uṇādi Sūtras, the important ones are those written by Ujjvaladatta, Govardhana, Puruṣottamadeva's Paribhāṣāvṛtti.adeva, Rāmacandra Dīkṣita and Haridatta. There is also a gloss called Uṇādisūtrodghātana by Miśra. There is a gloss by Durgasiṁha's Kātantra-Sūtravṛtti. on the Kātantra version of the Uṇādi Sūtras.
tānādikaa root of the tanadi class of roots (8th conjugation).
phiṭsūtraa small work on accents attributed to Santanava,an ancient Vedic scholar who lived before Patanjali if not before Panini, as the latter has not referred to him. There is an anonymous commentary upon it.
vikaugment वि as seen in the word दविद्युतत् given as a nipatana in the sutra दाधर्तिदर्धति ...P. VII.4.65; confer, compare दविद्युतदिति द्युतेर्यङ्लुगन्तस्य शतरि अभ्यासस्य संप्रसारणाभाव: अत्वं विक् अागमश्च निपात्यते Kāśikā of Jayāditya and Vāmana. on P.VII.4.65.
hemacandraa Jain sage and scholar of remarkable erudition in the religious works of the Jainas as also in several Shastras. He was a resident of Dhandhuka in Gujarat, who, like Sankarācārya took संन्यासदीक्षा at a very early age and wrote a very large number of original books and commentaries, the total number of which may well nigh exceed fifty, during his long life of eighty-four years ( 1088 to ll 2 ). He stayed at AnhilavalaPattana in the North Gujarat and was patronised with extreme reverence by King Kumarapala who in fact, became his devoted pupil. Besides the well-known works on the various Shastras like Kavyanusasana, Abhidhanacintamani, Desinamamla, Yogasastra, Dvyasrayakavya, Trisastisalakapurusacarita and others which are well-known, he wrote a big work on grammar called सिद्धहेमचन्द्र by him,but popularly known by the name हेमव्याकरण or हैमशब्दानुशासन The , work consists of eight books or Adhyayas, out of which the eighth book is devoted to prakrit Grammar, and can be styled as a Grammar of all the Prakrit dialects. The Sanskrit Grammar of seven chapters is based practically upon Panini's Astadhyayi, the rules or sutras referring to Vedic words or Vedic affixes or accents being entirely omittedThe wording of the Sutras is much similar to that of Panini; at some places it is even identical. The order of the treatment of the subjects in the सिद्धहैम. शब्दानुशासनमृत्र is not, however, similar to that obtaining in the Astadhyayi of Panini. It is somewhat topicwise as in the Katantra Vyakarana. The first Adhyaya and a quarter of the second are devoted to Samjna, Paribhasa and declension; the second pada of the second Adhyaya is devoted to karaka, while the third pada of it is devoted to cerebralization and the fourth to the Stripratyayas.The first two Padas of the third Adhyaya are devoted to Samasas or compound words, while the last two Padas of the third Adhyaya and the fourth Adhyaya are devoted to conjugation The fifth Adhyaya is devoted to verbal derivatives or krdanta, while the sixth and the seventh Adhyayas are devoted to formations of nouns from nouns, or taddhita words. On this Sabda nusasana, which is just like Panini's Astadhyayi, the eighth adhyaya of Hemacandra being devoted to the grammar of the Arsa language similar to Vedic grammar of Panini, Hemacandra has himself written two glosses which are named लधुवृति and वृहृदवृत्ति and the famous commentary known as the Brhannyasa. Besides these works viz the हैमशब्दानुशासन, the two Vrttis on it and the Brhannyasa, he has given an appendix viz the Lingnusasana. The Grammar of Hemacandra, in short, introduced a new system of grammar different from, yet similar to, that of Panini, which by his followers was made completely similar to the Paniniya system by writing works similar to the Siddhantakaumudi, the Dhatuvrtti, the Manorama and the Paribhasendusekhara. हेमहंसगणि a grammarian belonging to the school of Hemacandra, who lived in the fifteenth century and wrote a work on Paribhasas named न्यायसंग्रह, on which he himself wrote a commentary called न्यायार्थमञ्जूषा and another one called by the name न्यास.
Vedabase Search
1347 results
tanau in his bodySB 4.16.5
tanau whose personal appearancesSB 10.14.22
tanavaḥ features of the bodySB 7.3.32
tanavaḥ incarnationsSB 8.14.3
tanavaḥ material bodiesSB 10.16.50
tanavaḥ on whose bodies (trunks)SB 10.35.8-11
tanavaḥ parts of the bodySB 4.19.30
tanavaḥ whose bodiesCC Madhya 24.208
CC Madhya 8.276
tanave whose formsSB 4.17.29
tanaya by her sonSB 3.33.13
tanaya childrenSB 10.14.35
tana daughterSB 6.18.12-13
tana of the daughter (the Yamunā)CC Madhya 19.98
tanaya of the son (Śukadeva)SB 10.89.20
tanaya sonCC Adi 14.86
CC Adi 2.32
CC Madhya 10.52
CC Madhya 12.55
CC Madhya 15.114
tanaya sonsMM 13
tanayaḥ a sonSB 9.13.22
SB 9.21.24
SB 9.23.14
SB 9.6.30
tanayaḥ sonSB 6.6.6
SB 8.24.11
SB 9.21.30
SB 9.24.19
tanayāḥ sonsSB 10.61.18
SB 11.30.38
SB 9.22.35
SB 9.24.46
tanayaḥ TanayaSB 9.15.4
tanayaḥ the sonSB 10.1.8
SB 12.6.75
SB 8.13.32
SB 8.13.35
SB 9.12.15
SB 9.15.1
tanayāḥ the sonsSB 8.13.11
tanayāḥ who were the sonsSB 8.1.29
tanayām daughterSB 1.16.2
SB 10.56.1
SB 3.22.16
tanayam sonSB 10.72.46
SB 4.8.10
SB 4.9.44
tanayam son or discipleSB 3.1.25
tanayām the daughterSB 10.58.31
SB 10.61.24
SB 10.62.1
tanayam the sonMM 7
SB 9.18.42
tanayām unto his daughterSB 9.3.23
tanayam unto the sonSB 7.11.1
tanayān the sonsSB 9.17.15
tanayasya of a childSB 1.15.19
tanayasya of his sonSB 4.9.65
tanayau sonsSB 3.1.39
tanayau the two sons Lava and KuśaSB 9.11.15
tanaye for the sonSB 10.26.13
SB 6.14.36
tanaye on his sonSB 6.1.27
tanayebhyaḥ among his sonsSB 4.28.33
tanayeṣu unto his sonsSB 9.5.26
advaita-ācārya-tanaya the son of Advaita ĀcāryaCC Adi 10.150
ācārya-tanaya the son of Advaita ĀcāryaCC Adi 12.18
acetana unconsciousCC Adi 15.16
acetana unconsciousCC Madhya 1.167
acetana unconsciousCC Madhya 6.26
acetana unconsciousCC Madhya 6.207
acetana unconsciousCC Madhya 7.38
acetana unconsciousCC Madhya 8.22
acetana unconsciousCC Madhya 9.165
acetana unconsciousCC Madhya 10.120
acetana hañā being unconsciousCC Madhya 12.144
acetana-vat almost unconsciousCC Madhya 14.134
preme acetana unconscious in the ecstasy of loveCC Madhya 17.154
acetana unconsciousCC Madhya 18.162
acetana unconsciousCC Madhya 18.184
cetana-acetana living entities and even the stones and woodCC Madhya 24.58
haya acetana became unconsciousCC Antya 9.10
acetana deha unconscious bodyCC Antya 14.64
acetana unconsciousCC Antya 16.124
hañā acetana becoming unconsciousCC Antya 17.12
acetana unconsciousCC Antya 17.17
acetana unconsciousCC Antya 18.54
acetana unconsciousCC Antya 18.97
acetanam unintelligentSB 3.26.51
acetanam with undeveloped consciousness, foolishSB 6.2.5-6
acetanam almost unconsciousSB 6.14.60
acetanam unconsciousSB 10.25.14
acyuta-cetana being fully Kṛṣṇa consciousSB 9.15.41
āyatana-ādibhiḥ with hotels or recreation halls and so onSB 5.24.9
kīrtana-ādibhiḥ by chanting, hearing and so onSB 6.2.38
advaita-ācārya-tanaya the son of Advaita ĀcāryaCC Adi 10.150
sańkīrtana-ādyaiḥ by congregational chanting, etc.CC Adi 3.81
āilā sanātana you have come, SanātanaCC Antya 4.122
ajā-gala-stana nipples on the neck of a goatCC Adi 5.61
ajā-gala-stana-nyāya like the nipples on the neck of a goatCC Madhya 24.93
aketanam being situated without a shelterSB 3.4.6
ākrīḍa-āyatana gambling housesSB 4.25.16
āmāra tanaya my sonCC Adi 6.58-59
kīrtana-ānande in the blissful situation of chantingCC Madhya 13.49
anartha-nivartana disappearance of unwanted thingsCC Madhya 23.10
aneka yatana much endeavorCC Madhya 11.42
kari' aneka yatana with great attentionCC Antya 6.269
aniketana without shelterSB 3.24.42
anivartanam which does not bring one back again to this material worldSB 6.5.21
vigalita-stana-paṭṭika-antām the border of the sari on the breasts moved slightlySB 8.9.18
stana-antare in the middle of his chestSB 10.78.8
tīrthapada-anukīrtanam glorifying the Supreme Personality of Godhead, who is known as TīrthapadaSB 6.13.22-23
anukīrtanam constantly glorifyingSB 11.11.34-41
anukīrtanam chanting the gloriesSB 11.19.20-24
anukīrtanam the reciting in sequenceSB 12.12.21
sanātana-anusandhāne to search for Sanātana GosvāmīCC Madhya 25.208
anusańkīrtanam constantly chanting the holy nameSB 8.23.16
anuvartana-vaśāt as the effect of followingSB 12.13.2
apakṛṣṭa-cetana having degraded consciousnessSB 4.27.3
aparikīrtanam not advertisingSB 11.11.34-41
kīrtana-ārambhe in the beginning of the sańkīrtanaCC Madhya 11.218
kīrtana ārambhila began congregational chanting of the holy nameCC Antya 6.101
kīrtana ārambhilā began the congregational chantingCC Antya 7.72
stana-arthī Kṛṣṇa, who was hankering to drink His mother's milk by sucking her breastSB 10.7.6
arvāktana deviating from the eternal principles of Vedic religionSB 5.6.11
āśrama-āyatana and many hermitagesSB 5.17.13
rūpa-sanātana-āśraya shelter at the lotus feet of Rūpa Gosvāmī and Sanātana GosvāmīCC Adi 5.201
aśvastana-vidam one who does not know what is happening nextSB 4.25.38
ātma-āyatanam resting place of all living entitiesSB 4.17.30
kīrtana-āṭope by the force of congregational chantingCC Antya 10.64
avapātanaiḥ by causing to fall from the top of a mountainSB 7.5.43-44
avapātanaiḥ and throwing downSB 10.44.4
āvartana by the falling downSB 8.12.19
āvartana recitationCC Madhya 9.93
kailā āvartana analyzed fullyCC Madhya 25.53
āvartana ĀvartanaSB 5.19.29-30
āvartanam the rotatingSB 8.7.10
kīrtana-āveśe in the ecstasy of kīrtanaCC Madhya 1.126
āyatana the bodySB 2.5.32
ākrīḍa-āyatana gambling housesSB 4.25.16
āśrama-āyatana and many hermitagesSB 5.17.13
āyatana-ādibhiḥ with hotels or recreation halls and so onSB 5.24.9
āyatana housesSB 10.64.14-15
karma-āyatana by the above-mentioned working sensesSB 11.22.16
āyatana outlets of the life airSB 2.2.21
āyatana his abodeSB 4.28.13
ātma-āyatanam resting place of all living entitiesSB 4.17.30
lakṣmī-āyatanam the residence of the goddess of fortuneSB 7.4.8
āyatanam residenceSB 11.24.9
bahu yatana kariyā with great careCC Antya 12.107
beḍā-sańkīrtana chanting of the Hare Kṛṣṇa mantra all aroundCC Madhya 25.251
beḍā-sańkīrtana surrounding congregational chantingCC Antya 10.58
bhakti-pravartana inauguration of the bhakti cultCC Adi 6.27
bhojana-kīrtana eating and chantingCC Madhya 3.136
bhrū-dhanu-nartana dancing of the eyebrowsCC Madhya 21.105
kṛṣṇa-bhukta-stana-kṣīrāḥ therefore, because their breasts were sucked by Kṛṣṇa, who drank the milk flowing from their bodiesSB 10.6.34
bhūtanandaḥ BhūtanandaSB 12.1.29-31
caitanya-cintana thinking of Lord CaitanyaCC Madhya 19.131
cetana feelingSB 4.23.21
cetana the consciousnessSB 6.10.3
cetana-ujjhitāḥ devoid of lifeSB 12.10.23
cetana consciousnessCC Adi 4.251
sa-cetana spiritually cognizantCC Adi 9.33
cetana consciousCC Adi 12.24
cetana consciousnessCC Madhya 1.99
cetana consciousnessCC Madhya 6.16
cetana consciousnessCC Madhya 6.37
cetana consciousCC Madhya 8.284
cetana consciousnessCC Madhya 9.60
cetana consciousnessCC Madhya 9.61
cetana consciousnessCC Madhya 12.147
cetana consciousnessCC Madhya 12.149
karāila cetana brought him to consciousnessCC Madhya 15.124
nāhika cetana there was no consciousnessCC Madhya 16.154
cetana pāñā coming to consciousnessCC Madhya 17.221
cetana pāñā getting His senses backCC Madhya 18.73
cetana consciousnessCC Madhya 18.170
cetana-acetana living entities and even the stones and woodCC Madhya 24.58
cetana karāite to inspire to spiritual consciousnessCC Antya 5.115
cetana pāite after coming to consciousnessCC Antya 14.71
karāilā cetana brought to consciousnessCC Antya 15.59
sa-cetana conscious living beingsCC Antya 16.124
sa-cetana consciousCC Antya 16.124
cetana consciousnessCC Antya 17.19
pāilā cetana returned to consciousnessCC Antya 17.20
cetana ha-ile when there was consciousnessCC Antya 17.21
cetana consciousnessCC Antya 18.43
sa-cetana consciousCC Antya 18.97
cetana waking upCC Antya 19.73
pāñā cetana becoming consciousCC Antya 19.102
apakṛṣṭa-cetana having degraded consciousnessSB 4.27.3
śabala-cetana whose mind was bewilderedSB 7.4.39
acyuta-cetana being fully Kṛṣṇa consciousSB 9.15.41
cetana he whose consciousnessSB 10.1.41
cetana his mindSB 11.26.6
naṣṭa-cetana having lost his consciousnessSB 11.28.3
cetana by living forceSB 4.21.41
cetana with the living entitySB 4.29.74
cintana thinkingCC Adi 3.105-106
cintana thinkingCC Adi 7.31-32
cintana contemplationCC Adi 13.68
cintana considerationCC Adi 15.25
caitanya-cintana thinking of Lord CaitanyaCC Madhya 19.131
karaye cintana was contemplatingCC Madhya 25.7
karena cintana was always thinkingCC Antya 3.223
karena cintana began to thinkCC Antya 4.38
cintana thinking ofCC Antya 6.156
karena cintana began to considerCC Antya 7.109
cintana nā yāya I cannot think ofCC Antya 17.52
cintanam meditationMM 46
darśana nartana visiting the Lord and dancingCC Madhya 14.94
kīrtana-darśana visiting the kīrtana performancesCC Antya 2.79
mīnaketana rāma-dāsa Mīnaketana RāmadāsaCC Adi 11.53
acetana deha unconscious bodyCC Antya 14.64
kīrtana dekhi' seeing the performance of sańkīrtanaCC Madhya 11.219
kīrtana dekhiyā seeing the performance of kīrtanaCC Madhya 11.237
kīrtana dekhiyā by seeing the performance of sańkīrtanaCC Madhya 13.55
bhrū-dhanu-nartana dancing of the eyebrowsCC Madhya 21.105
sanātana-hāta dhari' catching the hand of Sanātana GosvāmīCC Madhya 21.111
dharma pravartana kare introduces a particular type of religious activityCC Madhya 20.341
śrī-yaśodā-stanam-dhaye sucking the breast of mother YaśodāCC Antya 7.86
sanātana-dvārā through Sanātana GosvāmīCC Antya 5.86
siṃha-dvāre patana falling down by the Siṃha-dvāra gateCC Antya 20.124
stana-dvayam her two breastsSB 6.14.53
stana-dvayam her two breastsSB 8.8.18
stana-dvayāt beginning from the breastSB 2.5.39
dvi-guṇa vartana twice the salaryCC Antya 9.106
dviguṇa vartana twice the salaryCC Antya 9.111
dyotanam illuminationSB 3.26.40
ei rūpa-ratana this beautiful, transcendental, jewellike formCC Madhya 21.103
ajā-gala-stana nipples on the neck of a goatCC Adi 5.61
ajā-gala-stana-nyāya like the nipples on the neck of a goatCC Madhya 24.93
nartana-gāna in chanting and dancingCC Madhya 17.212
su-gandhi udvartana perfumed massageCC Madhya 8.166
nartana-gāyana dancing and chantingCC Adi 7.68
ghātanam the killingSB 12.12.37
gosāñi sanātana Sanātana GosvāmīCC Madhya 1.36
sanātana-gosāñi the elder brother, Sanātana GosvāmīCC Madhya 19.13
sanātana-gosāñi Sanātana GosvāmīCC Madhya 25.185
sanātana gosāñi Sanātana GosāñiCC Madhya 25.210
sanātana-gosāñira of Sanātana GosvāmīCC Madhya 1.260
dvi-guṇa vartana twice the salaryCC Antya 9.106
cetana ha-ile when there was consciousnessCC Antya 17.21
sańkīrtana haite from the process of chanting the holy nameCC Antya 20.13
acetana hañā being unconsciousCC Madhya 12.144
hañā acetana becoming unconsciousCC Antya 17.12
hari-kīrtanam describing the glories of the LordSB 4.31.25
hari-kīrtanam chanting of the holy name of the Supreme Personality of GodheadSB 6.1.30
hari-sańkīrtana performance of sańkīrtanaCC Adi 13.102
hari-kīrtana-kolāhala the tumultuous sound of congregational chantingCC Antya 11.72
haridāsa sanātana Haridāsa ṭhākura and Sanātana GosvāmīCC Antya 4.23
sanātana-hāta dhari' catching the hand of Sanātana GosvāmīCC Madhya 21.111
haya acetana became unconsciousCC Antya 9.10
ikṣvāku-tanayaḥ the son of Mahārāja IkṣvākuSB 9.13.1
ikṣvāku-tanayaḥ a son of IkṣvākuSB 10.64.10
cetana ha-ile when there was consciousnessCC Antya 17.21
rūpa-sanātana-raghunātha-īśvara to the Lord of Rūpa Gosvāmī, Sanātana Gosvāmī and Raghunātha dāsa GosvāmīCC Antya 11.4
sanātana jānila Sanātana Gosvāmī could understandCC Madhya 20.83
prāktana-janmani in their previous birthsSB 7.10.37
sanātana kahe Sanātana Gosvāmī repliedCC Madhya 19.23
sanātana kahe Sanātana Gosvāmī saidCC Madhya 19.26
sanātana kahe Sanātana repliedCC Madhya 20.10-11
sanātana kahe Sanātana Gosvāmī saidCC Madhya 20.64
sanātana kahe Sanātana repliedCC Madhya 20.81
sanātana kahe Sanātana saidCC Madhya 20.364
sanātana kahe Sanātana Gosvāmī saidCC Antya 4.28
sanātana kahe Sanātana Gosvāmī saidCC Antya 4.84
sanātana kahe Sanātana Gosvāmī saidCC Antya 4.99
sanātana kahe Sanātana Gosvāmī repliedCC Antya 4.125
sanātana kahe Sanātana Gosvāmī repliedCC Antya 4.144
kahe sanātana Sanātana repliedCC Antya 13.53
sanātana kahe Sanātana Gosvāmī saidCC Antya 13.58
kahe kṛṣṇa-nāma-sańkīrtana chants the holy name of KṛṣṇaCC Antya 14.59
kaila sanātana Sanātana has so spokenCC Madhya 1.228
kaila sańkīrtana performed sańkīrtana, or congregational chantingCC Madhya 3.118
kailā pravartana introduced the sańkīrtana movementCC Madhya 20.340
kailā āvartana analyzed fullyCC Madhya 25.53
vartana kailā made the salaryCC Antya 9.133
kaila kīrtana chantedCC Antya 11.91-93
kara kṛṣṇa-sańkīrtana chant the holy name of the LordCC Antya 7.137
kara sańkīrtana chant the Hare Kṛṣṇa mahā-mantraCC Antya 11.26
karāila cetana brought him to consciousnessCC Madhya 15.124
karāilā kīrtana caused kīrtana to be performedCC Antya 10.65
karāilā cetana brought to consciousnessCC Antya 15.59
cetana karāite to inspire to spiritual consciousnessCC Antya 5.115
patana-kāraṇam the cause of their falling (how could it have happened all of a sudden?)SB 10.11.2
karaye cintana was contemplatingCC Madhya 25.7
karaye nartana and danceCC Madhya 25.21
karaye nartana and dancedCC Madhya 25.165
karaye nartana dancesCC Madhya 25.278
karaye kīrtana are chantingCC Antya 3.71
kare sańkīrtana but simply engages in sańkīrtanaCC Adi 7.41
kare sańkīrtana perform sańkīrtanaCC Adi 13.103
kīrtana kare performs kīrtanaCC Madhya 14.72
nāma-sańkīrtana kare performs chanting of the holy nameCC Madhya 18.80
dharma pravartana kare introduces a particular type of religious activityCC Madhya 20.341
karena yatana makes endeavorsCC Adi 6.108
karena kīrtana performed congregational chantingCC Madhya 12.218
karena nartana dancesCC Madhya 14.98
karena nartana began to danceCC Madhya 17.223
karena nartana began to danceCC Madhya 19.107
karena