Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
     Amarakosha Search  
Results for is
adhobhuvanamNeuterSingularpātālam, balisadma, rasātalam, nāgalokaḥa festival
andhakāraḥMasculineSingulartamisram, timiram, tamaḥ, dhvāntamperforated, or full of holes
anucaraḥ2.8.73MasculineSingularabhisaraḥ, anuplavaḥ, ‍sahāyaḥ
āranālaḥ2.9.38NeuterSingularabhiṣutam, avantisomam, dhānyāmlam, kuñjalam, sauvīram, kāñjikam, kulmāṣam
ārāt3.3.250MasculineSingularkhedaḥ, anukampā, santoṣaḥ, vismayaḥ, āmantraṇam
asuraḥ1.1.12MasculineSingularditisutaḥ, indrāriḥ, daityaḥ, suradviṣ, śukraśiṣyaḥ, danujaḥ, pūrvadevaḥ, dānavaḥ, daiteyaḥgiant
bāḍham3.3.50NeuterSingularbalisutaḥ, śaraḥ
bhāvaḥ3.3.215MasculineSingularjanmahetuḥ, ādyopalabdhisthānam
durodaraḥ3.3.179NeuterSingularcamūjaghanam, hastasūtram, pratisaraḥ
dviguṇākṛtam2.9.9MasculineSingulardvitīyākṛtam, dvihalyam, dvisītyam, ‍śambākṛtam
gaṃgā1.10.31FeminineSingularbhāgīrathī, tripathagā, trisrotā, viṣṇupadī, bhīṣmasūḥ, jahnutanayā, suranimnagāganges(river)
huṃ3.3.260MasculineSingularvistāraḥ, aṅgīkṛtiḥ
indraḥ1.1.45MasculineSingularmarutvān, pākaśāsanaḥ, puruhūtaḥ, lekharṣabhaḥ, divaspatiḥ, vajrī, vṛṣā, balārātiḥ, harihayaḥ, saṅkrandanaḥ, meghavāhanaḥ, ṛbhukṣāḥ, maghavā, vṛddhaśravāḥ, purandaraḥ, śakraḥ, sutrāmā, vāsavaḥ, vāstoṣpatiḥ, śacīpatiḥ, svārāṭ, duścyavanaḥ, ākhaṇḍalaḥ, viḍaujāḥ, sunāsīraḥ, jiṣṇuḥ, śatamanyuḥ, gotrabhid, vṛtrahā, surapatiḥ, jambhabhedī, namucisūdanaḥ, turāṣāṭ, sahasrākṣaḥindra, the king of the gods
khaḍgaḥ2.8.90MasculineSingularkṛpāṇaḥ, asiḥ, riṣṭiḥ, kaukṣethakaḥ, maṇḍalāgraḥ, nistriṃśaḥ, karavālaḥ, candrahāsaḥ
kṛtāntaḥ3.3.71MasculineSingularlatā, vistāraḥ
mliṣṭamMasculineSingularavispaṣṭaman indistinct speech
mṛṇālaḥMasculineSingularbisamthe fibers in stalk of lotus
nalinīFeminineSingularbisinī, padminīan assemblage of lotus flowers
nimitam3.3.83NeuterSingularnistalam, padyam, caritram, atītam, dṛḍham
odanam2.9.49MasculineSingulardīdiviḥ, ‍bhis, ‍bhaktam, andhaḥ, annam
oghaḥ3.3.32MasculineSingularviparyāsaḥ, vistaraḥ
padmam1.10.39-40MasculineSingularpaṅkeruham, kamalam, aravindam, rājīvam, sārasam, kuśeśayam, sahasrapattram, nalinam, ambhoruham, bisaprasūnam, tāmarasam, śatapattram, mahotpalam, puṣkaram, sarasīruhama lotus
paraidhitā2.10.17MasculineSingular‍‍parācitaḥ, pariskandaḥ, parajātaḥ
pāṭhīMasculineSingularcitrakaḥ, vahnisañjñakaḥ
pragāḍham3.3.50NeuterSingularatisūkṣmam, dhānyaṃśam
praveṇī2.8.43FeminineSingularvarṇaḥ, paristomaḥ, ‍kuthaḥ, āstaraṇam
pṛthuromāMasculineSingularvisāraḥ, jhaṣaḥ, śakalī, matsyaḥ, mīnaḥ, vaisāriṇaḥ, aṇḍajaḥa fish
rajatam3.3.86MasculineSingularyuktaḥ, atisaṃskṛtaḥ, marṣī
śabdaḥ1.2.24MasculineSingularnisvānaḥ, nirghoṣaḥ, ravaḥ, ninadaḥ, virāvaḥ, āravaḥ, nādaḥ, svānaḥ, dhvānaḥ, ninādaḥ, saṃrāvaḥ, nisvanaḥ, nirhrādaḥ, svanaḥ, dhvaniḥ, ārāvaḥsound
śāleyaḥMasculineSingularśītaśivaḥ, chatrā, madhurikā, misiḥ, miśreyaḥ
samayā3.3.260MasculineSingularvistāraḥ, aṅgīkṛtiḥ
saṃsiddhiḥ1.7.37FeminineSingularnisargaḥ, prakṛtiḥ, svarūpam, svabhāvaḥthe natural state
samūhaḥ2.5.41MasculineSingularvyūhaḥ, vrajaḥ, nikaraḥ, saṅghātaḥ, samudayaḥ, gaṇaḥ, nikurambam, sandohaḥ, stomaḥ, vrātaḥ, sañcayaḥ, samavāyaḥ, saṃhatiḥ, kadambakam, nivahaḥ, visaraḥ, oghaḥ, vāraḥ, samudāyaḥ, kṣayaḥ, vṛndam
śatapuṣpāFeminineSingularmadhurā, misiḥ, avākpuṣpī, kāravī, sitacchatrā, aticchatrā
sūraḥ1.3.28-30MasculineSingularsahasrāṃśuḥ, raviḥ, chāyānāthaḥ, jagaccakṣuḥ, pradyotanaḥ, lokabāndhavaḥ, aryamā, dhāmanidhiḥ, divākaraḥ, braghnaḥ, bhāsvān, haridaśvaḥ, arkaḥ, aruṇaḥ, taraṇiḥ, virocanaḥ, tviṣāṃpatiḥ, haṃsaḥ, savitā, tejasāṃrāśiḥ, karmasākṣī, trayītanuḥ, khadyotaḥ, sūryaḥ, bhagaḥ, dvādaśātmā, abjinīpatiḥ, ahaskaraḥ, vibhākaraḥ, saptāśvaḥ, vikartanaḥ, mihiraḥ, dyumaṇiḥ, citrabhānuḥ, grahapatiḥ, bhānuḥ, tapanaḥ, padmākṣaḥ, tamisrahā, lokabandhuḥ, dinamaṇiḥ, inaḥ, ādityaḥ, aṃśumālī, bhāskaraḥ, prabhākaraḥ, vivasvān, uṣṇaraśmiḥ, mārtaṇḍaḥ, pūṣā, mitraḥ, vibhāvasuḥ, aharpatiḥ(53)the sun
tapasvinīFeminineSingularjaṭilā, lomaśā, misī, jaṭā, māṃsī
tindukaḥ2.4.38MasculineSingularkālaskandhaḥ, śitisārakaḥ, sphūrjakaḥ
triguṇākṛtam2.9.8MasculineSingulartṛtīyākṛtam, trihalyam, trisītyam
tyāgaḥ2.7.31MasculineSingularaṃhatiḥ, prādeśanam, vitaraṇam, utsarjanam, apavarjanam, pratipādanam, viśrāṇanam, dānam, nirvapaṇam, sparśanam, visarjanam, vihāyitam
ucchritaḥ3.3.91MasculineSingularsambaddhārthaḥ, hitam, śaktisthaḥ
vāhinī3.3.119FeminineSingularkratuḥ, vistāraḥ, tucchakaḥ
vaiśya2.9.1MasculineSingularviṭ, ūravyaḥ, ūrujaḥ, aryaḥ, bhūmispṛk
vaṃśaḥMasculineSingulartejanaḥ, yavaphalaḥ, tvacisāraḥ, maskaraḥ, śataparvā, karmāraḥ, veṇuḥ, tṛṇadhvajaḥ, tvaksāraḥ
vartulam3.1.68MasculineSingularnistalam, vṛttam
visṛtam3.1.85MasculineSingularvistṛtam, tatam
visṛtvaraḥ3.1.30MasculineSingularvisṛmaraḥ, prasārī, visārī
yuddham2.8.107NeuterSingularāyodhanam, pravidāraṇam, saṃkhyam, ‍samaraḥ, kalahaḥ, abhisaṃpātaḥ, saṃyogaḥ, saṃgrāmaḥ, ‍saṃyat, samit, janyam, mṛdham, samīkam, a‍nīkaḥ, ‍vigrahaḥ, kaṃliḥ, abhyāmardaḥ, āhavaḥ, ‍samitiḥ, yut, pradhanam, āskandanam, ‍sāṃparāthikam, raṇaḥ, saṃprahāraḥ, saṃsphoṭaḥ, ‍samāghātaḥ, samudāyaḥ, ājiḥ
trisandhyamNeuterSingularperiods of the day
tamis1.4.5FeminineSingulara dark night
visramMasculineSingulara smell that like of raw meat
vismayaḥMasculineSingularadbhutam, āścaryam, citramsurprise
pratisīrā2.6.121FeminineSingularjavanikā, tiraskariṇī
sarvābhisāraḥ2.8.96MasculineSingularsarvaughaḥ, sarvasaṃnahanam
visṛtvaraḥ3.1.30MasculineSingularvisṛmaraḥ, prasārī, visārī
visṛtam3.1.85MasculineSingularvistṛtam, tatam
vistāraḥ2.4.22MasculineSingularvigrahaḥ, vyāsaḥ
abhisaṅgaḥ3.3.29MasculineSingularprādhānyam, sānu
Results for is3312 results for is
isind. an interjection of anger or pain or sorrow View this entry on the original dictionary page scan.
isind. (according to is-Ved. equals nis- see iṣ-kṛ-above.) View this entry on the original dictionary page scan.
abdhisāram. a gem. View this entry on the original dictionary page scan.
abhinistānam. equals abhi-niṣṭāna- View this entry on the original dictionary page scan.
abhinisyand(or -ṣyand-), to trickle upon View this entry on the original dictionary page scan.
abhisacSee abhi-ṣac-. View this entry on the original dictionary page scan.
abhisamāgamto approach together ; to come to (accusative) View this entry on the original dictionary page scan.
abhisamāhitamfn. ( dhā-), fastened to, connected with (instrumental case) View this entry on the original dictionary page scan.
abhisamāhṛto scrape up or together View this entry on the original dictionary page scan.
abhisamāpadA1. (perf. -pede-) to enter upon (accusative) View this entry on the original dictionary page scan.
abhisamāruh(imperfect tense 3. plural -/arohan-) to enter upon (the sacrificial fire-place) for a purpose (accusative) View this entry on the original dictionary page scan.
abhisamasto put together, group, collect View this entry on the original dictionary page scan.
abhisamāsicto pour together View this entry on the original dictionary page scan.
abhisamavāyam. ( i-), union, association View this entry on the original dictionary page scan.
abhisamāvṛtVed. (3. plural -/āvartante-and imperfect tense -āvartanta-; future p. -vartsyamāna-) to return home View this entry on the original dictionary page scan.
abhisamayaSee abhi-sam-i-. View this entry on the original dictionary page scan.
abhisamāyāto approach together View this entry on the original dictionary page scan.
abhisamayam. agreement View this entry on the original dictionary page scan.
abhisamayam. clear understanding View this entry on the original dictionary page scan.
abhisamāyam -y/acchati-, to fasten to (accusative) View this entry on the original dictionary page scan.
abhisamāyuktamfn. connected or endowed with (instrumental case) View this entry on the original dictionary page scan.
abhisambaddhamfn. connected, (an-- negative) View this entry on the original dictionary page scan.
abhisambādhamfn. pressed together, crowded View this entry on the original dictionary page scan.
abhisambandh -badhnāti-, to refer to (accusative), mean by commentator or commentary on : Passive voice -badhyate-,"to be referred to", belong to, require to be connected with (instrumental case [ ]or accusative [ etc.]) . View this entry on the original dictionary page scan.
abhisambandham. connection with, relation to (instrumental case) View this entry on the original dictionary page scan.
abhisambandham. being connected with, belonging to View this entry on the original dictionary page scan.
abhisambandham. sexual connection View this entry on the original dictionary page scan.
abhisambhagnamfn. broken, crashed View this entry on the original dictionary page scan.
abhisambhavam. attainment, View this entry on the original dictionary page scan.
abhisambhavana n. attainment, View this entry on the original dictionary page scan.
abhisambhṛtamfn. endowed with (in compound) (varia lectio abhi-saṃ-vṛta-). View this entry on the original dictionary page scan.
abhisambhū Vedic or Veda (perf. 2. sg. -babhūtha-) to reach, come to, arrive at ; to obtain the shape of (accusative), be changed into : Causal to salute View this entry on the original dictionary page scan.
abhisambodhanan. attaining the bodhi- View this entry on the original dictionary page scan.
abhisambuddhamfn. deeply versed in View this entry on the original dictionary page scan.
abhisambuddhamfn. having attained the bodhi- View this entry on the original dictionary page scan.
abhisambudh(with samyak-- sambodhin-), to obtain the highest perfect knowledge, Sukh, i. View this entry on the original dictionary page scan.
abhisaṃcar(3. plural -caranti- pr. p. f. dual number -c/arantī-) to go up to, seek for View this entry on the original dictionary page scan.
abhisaṃcārinmfn. "moving in every direction", inconstant, changeable View this entry on the original dictionary page scan.
abhisaṃciA1. -cinute-, (Opt. 1. sg. -cinvīya-) to pile up (the sacrificial fire) for the benefit of (one's self, ātm/ānam-)
abhisaṃcint(ind.p. -cintya-) to remember View this entry on the original dictionary page scan.
abhisaṃcūrṇto grind, pulverize, View this entry on the original dictionary page scan.
abhisaṃdaṣṭa(abh/is/aṃdaṣṭa-) mfn. ( daṃś-), compressed or tightened together View this entry on the original dictionary page scan.
abhisaṃdehan. organ of generation, (dual number accusative he-) (varia lectio abhisaṃdoha-). View this entry on the original dictionary page scan.
abhisaṃdhā(3. dual number -dhattas-;Imper. 2. sg. -dhehi-; Aorist -adhāt-) to snap at (accusative) for devouring ; to take aim at (dative case or accusative) etc. ; to aim at, have in view (with accusative;rarely dative case) ; to acknowledge unanimously, (perf. 3. plural -dadh/uḥ-) ; to overcome, master etc. ; to win (as by presents) ; to ally, associate with (instrumental case) View this entry on the original dictionary page scan.
abhisaṃdhāf. "speech, declaration"(only in fine compositi or 'at the end of a compound' see anṛtābhisandha-and satyābhisandha-). View this entry on the original dictionary page scan.
abhisaṃdham(1. sg. -dhamāmi-) to blow at View this entry on the original dictionary page scan.
abhisaṃdhānan. the being allied or connected, connection between (in compound) View this entry on the original dictionary page scan.
abhisaṃdhānan. "speech, deliberate declaration"(only in fine compositi or 'at the end of a compound' see satyābh-) View this entry on the original dictionary page scan.
abhisaṃdhānan. attachment or interest in any object View this entry on the original dictionary page scan.
abhisaṃdhānan. special agreement View this entry on the original dictionary page scan.
abhisaṃdhānan. overcoming, deceiving View this entry on the original dictionary page scan.
abhisaṃdhānan. making peace or alliance View this entry on the original dictionary page scan.
abhisaṃdhāya ind.p. aiming at, having in view View this entry on the original dictionary page scan.
abhisaṃdhāyacoming to an agreement regarding (accusative) View this entry on the original dictionary page scan.
abhisaṃdhāyaovercoming etc. View this entry on the original dictionary page scan.
abhisaṃdhāyabringing in contact with (as an arrow with a bow), place upon (instrumental case) View this entry on the original dictionary page scan.
abhisaṃdhim. speaking or declaring deliberately, purpose, intention, object, meaning View this entry on the original dictionary page scan.
abhisaṃdhim. special agreement View this entry on the original dictionary page scan.
abhisaṃdhim. cheating, deceiving View this entry on the original dictionary page scan.
abhisaṃdhim. making peace or alliance View this entry on the original dictionary page scan.
abhisaṃdhim. joint, junction View this entry on the original dictionary page scan.
abhisaṃdhikṛtamfn. done intentionally. View this entry on the original dictionary page scan.
abhisaṃdhipūrvamfn. that which has been intended, aimed at View this entry on the original dictionary page scan.
abhisaṃdhipūrvakamind. with some intention, purposely View this entry on the original dictionary page scan.
abhisame( -ā-i-), Ved. (Imper. abh/i-... sam-/aitu-[ ] or -.. abh/i s/am-etu-[ ]) to join in coming near (accusative), approach together. View this entry on the original dictionary page scan.
abhisametamfn. assembled View this entry on the original dictionary page scan.
abhisaṃgam(ind.p. -g/atya- , or -gamya- ) to approach together (Aorist A1.3. plural -agmata-), etc. ; to join in welcoming ; to meet with View this entry on the original dictionary page scan.
abhisaṃgatamfn. together with (in comp.) View this entry on the original dictionary page scan.
abhisaṃgṝto promise View this entry on the original dictionary page scan.
abhisaṃgrahto grasp at once with several fingers View this entry on the original dictionary page scan.
abhisaṃguptamfn. guarded, protected View this entry on the original dictionary page scan.
abhisaṃhan(ind.p. -hatya-) to combine, confederate View this entry on the original dictionary page scan.
abhisaṃhatamfn. attacked, assailed View this entry on the original dictionary page scan.
abhisaṃhitaSee -saṃ-dhā-. View this entry on the original dictionary page scan.
abhisaṃhitamfn. aimed at View this entry on the original dictionary page scan.
abhisaṃhitamfn. agreed upon View this entry on the original dictionary page scan.
abhisaṃhitamfn. acknowledged by (in compound) View this entry on the original dictionary page scan.
abhisaṃhitamfn. overcome View this entry on the original dictionary page scan.
abhisaṃhitamfn. (in fine compositi or 'at the end of a compound') connected with, attached to View this entry on the original dictionary page scan.
abhisaṃhṛtyaind. conjointly, View this entry on the original dictionary page scan.
abhisami -eti- (3. plural -yanti-,Imper. -yantu-), Ved. to approach together, come together or meet at (accusative) etc. ; (Opt. 3. plural -īy/uḥ-) to invade View this entry on the original dictionary page scan.
abhisamīkṣya ind.p. ( īkṣ-), seeing, viewing View this entry on the original dictionary page scan.
abhisamīkṣyaind. noticing, perceiving, learning from View this entry on the original dictionary page scan.
abhisamīkṣyaind. considering, with reference to View this entry on the original dictionary page scan.
abhisamindhto set on fire, kindle View this entry on the original dictionary page scan.
abhisamīrCaus. (perf. Passive voice p. -īrita-) to put in motion View this entry on the original dictionary page scan.
abhisaṃjātamfn. ( jan-), produced (as joy, harṣa-) View this entry on the original dictionary page scan.
abhisaṃjñā(3. plural -jānate- subjunctive -jān/āntai- imperfect tense -ajānata-) to agree, allow, concede anything (dative case) to (accusative) View this entry on the original dictionary page scan.
abhisaṃjñitamfn. (fr. 2. saṃjñā- see saṃjñita-), called, named View this entry on the original dictionary page scan.
abhisaṃjvarto envy, regard with spite View this entry on the original dictionary page scan.
abhisaṃkhyā(perf. Passive voice p. -khyāta-) to enumerate View this entry on the original dictionary page scan.
abhisaṃkhyamfn. inferable, clearly ascertainable View this entry on the original dictionary page scan.
abhisaṃkhyāf. number View this entry on the original dictionary page scan.
abhisaṃkhyeyamfn. to be enumerated View this entry on the original dictionary page scan.
abhisaṃkruddhamfn. angry with (accusative) View this entry on the original dictionary page scan.
abhisaṃkruddhamfn. (genitive case) View this entry on the original dictionary page scan.
abhisaṃkrudh(pr. p. -krudhyat-) to be angry with (accusative) View this entry on the original dictionary page scan.
abhisaṃkruś(ind.p. -kruśya-) to call out to View this entry on the original dictionary page scan.
abhisaṃkṣepam. compressing View this entry on the original dictionary page scan.
abhisaṃkṣip(ind.p. -kṣipya-) to compress, render quite small (the body by magical power) View this entry on the original dictionary page scan.
abhisaṃkṣiptamfn. one who has compressed his body so as to render it small View this entry on the original dictionary page scan.
abhisammatamfn. honoured, esteemed View this entry on the original dictionary page scan.
abhisammūḍhamfn. entirely confused View this entry on the original dictionary page scan.
abhisammukhamf(ā-)n. looking respectfully towards (accusative) View this entry on the original dictionary page scan.
abhisammūrch(parasmE-pada -mūrchat-) to assume a solid form with regard to or in connection with (accusative) View this entry on the original dictionary page scan.
abhisaṃnaddhamfn. armed View this entry on the original dictionary page scan.
abhisaṃnah(3. plural -nahyanti-) to bind or string together : A1. (imperfect tense 3. dual number -anahyetām-) to arm one's self against (accusative)
abhisaṃnam(Opt. -namet-) to alter, modify View this entry on the original dictionary page scan.
abhisaṃnīto lead to or upon (locative case) View this entry on the original dictionary page scan.
abhisaṃniviṣṭamfn. ( viś-), being united or combined in commentator or commentary on View this entry on the original dictionary page scan.
abhisaṃnuA1. (3. plural -navante-; Aorist 3. plural -anūṣata-) to rejoice or cheer together at or towards (accusative) View this entry on the original dictionary page scan.
abhisampac Passive voice (3. pl -pacyante-) to become ripe up to a certain time (accusative) View this entry on the original dictionary page scan.
abhisampadVed. -padyate-, to become ; to become similar to, be changed to (accusative) etc. ; to come to, arrive at, obtain : Causal -pādayati-, to make equal to, change into (accusative) View this entry on the original dictionary page scan.
abhisampadf. idem or 'f. becoming anything, becoming similar or equal to ' View this entry on the original dictionary page scan.
abhisampannamfn. becoming similar to, being changed to (accusative) View this entry on the original dictionary page scan.
abhisampannamfn. being in accordance with, agreeing with (instrumental case) View this entry on the original dictionary page scan.
abhisamparāyam. ( i-), futurity View this entry on the original dictionary page scan.
abhisampat(p. -patat-; perf. 3. plural -petuḥ-) to fly to, hasten to (accusative) View this entry on the original dictionary page scan.
abhisampātam. concourse, war, battle
abhisampattif. becoming anything, becoming similar or equal to View this entry on the original dictionary page scan.
abhisamplavam. fluctuation, View this entry on the original dictionary page scan.
abhisamplu(ind.p. -plutya-) to bathe (an-- negative) View this entry on the original dictionary page scan.
abhisamplutamfn. poured upon, overflowed with View this entry on the original dictionary page scan.
abhisamplutamfn. deeply engaged in (in compound) View this entry on the original dictionary page scan.
abhisamprahā(only ind.p. - haya-), to forsake, View this entry on the original dictionary page scan.
abhisamprāp( āp-) to reach, come to, arrive at, obtain View this entry on the original dictionary page scan.
abhisamprapad -padyate- (equals abhi-sam-pad-) to be changed to, assume or obtain the shape of (accusative) View this entry on the original dictionary page scan.
abhisampravṛtCaus. to change (?as a battle-field, raṇājir/am-) View this entry on the original dictionary page scan.
abhisampravṛttamfn. having begun View this entry on the original dictionary page scan.
abhisamprayā(ind.p. -yāya-) to go towards (varia lectio abhi-vārayitvā-) View this entry on the original dictionary page scan.
abhisamprekṣ( īkṣ-), (ind.p. -prekṣya-) to look at, perceive View this entry on the original dictionary page scan.
abhisampū -pavate-, to blow along over or towards (accusative) View this entry on the original dictionary page scan.
abhisampūj(generally ind.p. -pūjya-) to honour, revere greatly View this entry on the original dictionary page scan.
abhisamṛA1. (Aorist Opt. -arīta-) to reach, seize View this entry on the original dictionary page scan.
abhisaṃrabdhamfn. excited, furious View this entry on the original dictionary page scan.
abhisaṃrabhA1. (3. plural -rabhante-;Opt. 1. plural -rabhemahi-) to take hold of (for support) View this entry on the original dictionary page scan.
abhisaṃrādhanan. pacifying, conciliating View this entry on the original dictionary page scan.
abhisaṃraktamfn. ( rañj-), intensely attached to (in compound) View this entry on the original dictionary page scan.
abhisaṃrambham. fury, rage View this entry on the original dictionary page scan.
abhisaṃsāramind. running near in crowds
abhisaṃśīnamfn. ( śyai-), coagulated, congealed View this entry on the original dictionary page scan.
abhisaṃskāram. "the being formed", development (as of seeds) View this entry on the original dictionary page scan.
abhisaṃskāram. preparation View this entry on the original dictionary page scan.
abhisaṃskāram. conception, idea View this entry on the original dictionary page scan.
abhisaṃskṛ -s-karoti-, to shape, form : A1. (subjunctive 1. sg. -s-kar/avai-) to render or make one's self (ātmānam-) anything (wished to be accusative) View this entry on the original dictionary page scan.
abhisaṃskṛtamfn. consecrated View this entry on the original dictionary page scan.
abhisaṃśliṣ(ind.p. -śliṣya-) to cling to each other View this entry on the original dictionary page scan.
abhisaṃsmṛto recollect (with accusative) View this entry on the original dictionary page scan.
abhisaṃspṛśto wash one's self ; to seize View this entry on the original dictionary page scan.
abhisaṃsṛ(ind.p. -sṛtya-) to run against or assail each other View this entry on the original dictionary page scan.
abhisaṃśrayam. refuge , connection View this entry on the original dictionary page scan.
abhisaṃśriP. to resort to (for refuge), have recourse to (accusative) etc. ; to give way to, devote one's self to (accusative) ; to attain, (Passive voice -śrīyate-) View this entry on the original dictionary page scan.
abhisaṃśritamfn. who has resorted to any one (for refuge) View this entry on the original dictionary page scan.
abhisaṃśritamfn. (for a visit) View this entry on the original dictionary page scan.
abhisaṃsṛtamfn. one who has come near View this entry on the original dictionary page scan.
abhisaṃśru(ind.p. -śrutya-) to hear, learn View this entry on the original dictionary page scan.
abhisaṃsruto unite in flowing into (accusative) View this entry on the original dictionary page scan.
abhisaṃstambh(ind.p. -stabhya-) to support, render firm View this entry on the original dictionary page scan.
abhisaṃstavam. praise View this entry on the original dictionary page scan.
abhisaṃsthā -tiṣṭhate-, to stop at, finish at (accusative) : Causal to cause to stop or finish at (accusative) View this entry on the original dictionary page scan.
abhisaṃsthamind. in regular order View this entry on the original dictionary page scan.
abhisaṃsthitamfn. stopping or standing or watching at some place View this entry on the original dictionary page scan.
abhisaṃsthitamfn. reflecting upon (locative case) View this entry on the original dictionary page scan.
abhisaṃstīrṇamfn. ( stṝ-), entirely covered with View this entry on the original dictionary page scan.
abhisaṃstu(pr. p. -stuvat-) to praise highly View this entry on the original dictionary page scan.
abhisaṃstutamfn. highly praised View this entry on the original dictionary page scan.
abhisaṃsu(3. dual number -s/aṃ-sunutas-) to press out (soma- juice) together for the sake of (accusative) View this entry on the original dictionary page scan.
abhisaṃsvañjA1. (Imper. 2 sg. -svajasva-) to embrace View this entry on the original dictionary page scan.
abhisaṃsvṛ(imperfect tense 3. plural -asvaran-[four times] or -/asvaran-[once]) to praise or call or invite unanimously View this entry on the original dictionary page scan.
abhisaṃśyānamfn. ( śyai-), coagulated, congealed View this entry on the original dictionary page scan.
abhisaṃtan(3. plural -tanvanti-) to use for bridging over or stretching across View this entry on the original dictionary page scan.
abhisaṃtap(subjunctive -tapāti-) to press hard on all sides View this entry on the original dictionary page scan.
abhisaṃtaptamfn. tormented View this entry on the original dictionary page scan.
abhisaṃtatamfn. spread over, covered with (in compound) (varia lectio abhi-saṃ-vṛta-). View this entry on the original dictionary page scan.
abhisaṃtṝto cross over towards (accusative) View this entry on the original dictionary page scan.
abhisaṃtrastamfn. ( tras-), terrified, much alarmed View this entry on the original dictionary page scan.
abhisaṃtyaj(ind.p. -tyajya-) to abandon, give up, desist from (accusative) View this entry on the original dictionary page scan.
abhisamubjto spread a covering upon (accusative) View this entry on the original dictionary page scan.
abhisamūh -ūhati-, to heap up ; to heap up and cover with (as with ashes instrumental case) View this entry on the original dictionary page scan.
abhisaṃvāñchto long for, View this entry on the original dictionary page scan.
abhisaṃvasA1. (pr. p. 1. -v/asāna-) to wrap one's self into (accusative) View this entry on the original dictionary page scan.
abhisaṃvasA1. (pr. p. 2. -v/asāna-) to settle round (accusative) together View this entry on the original dictionary page scan.
abhisaṃvid(perf. 3. plural -vid/us-) to know thoroughly View this entry on the original dictionary page scan.
abhisaṃvidA1. (pr. p. -vidān/a-) to meet each other ([ ]) ("to relate, explain"commentator or commentary) View this entry on the original dictionary page scan.
abhisaṃvīkṣ( īkṣ-) to look at in astonishment, gaze at View this entry on the original dictionary page scan.
abhisaṃviśP. A1. (Imper. 2. plural -s/aṃ-viśadhvam-) to meet round or near, surround etc. ; to enter into, dissolve in View this entry on the original dictionary page scan.
abhisaṃvṛ(imperfect tense -vṛṇot-) to cover, conceal View this entry on the original dictionary page scan.
abhisaṃvṛddhamfn. (said of a tree)"having grown a very long time" , very old View this entry on the original dictionary page scan.
abhisaṃvṛtA1. (Imper. -vartatām-) to turn one's self towards View this entry on the original dictionary page scan.
abhisaṃvṛtamfn. covered, concealed etc. View this entry on the original dictionary page scan.
abhisaṃvṛtamfn. surrounded by, accompanied by View this entry on the original dictionary page scan.
abhisaṃvṛtamfn. filled with, furnished with View this entry on the original dictionary page scan.
abhisaṃvṛttamfn. undertaking, beginning to (Inf.) View this entry on the original dictionary page scan.
abhisaṃyā -yāti-, to visit, approach to (accusative) ; to approach in hostile manner, assail View this entry on the original dictionary page scan.
abhisaṃyamto hold against, View this entry on the original dictionary page scan.
abhisaṃyattamfn. ( yat-), being taken care of or governed by (varia lectio abhi-sampanna-) View this entry on the original dictionary page scan.
abhisaṃyogam. (in mīmāṃsā- philosophy) close contact or relation to. View this entry on the original dictionary page scan.
abhisaṃyujCaus. to bring in close contact with (instrumental case) View this entry on the original dictionary page scan.
abhisaṃyuktamfn. furnished or endowed with View this entry on the original dictionary page scan.
abhisandhakamfn. in fine compositi or 'at the end of a compound' deceiving ["calumniating"commentator or commentary ] View this entry on the original dictionary page scan.
abhisāntv(p. -sāntvayat-; ind.p. -sāntvya-) to conciliate, pacify, comfort View this entry on the original dictionary page scan.
abhisāntvam. consolation, conciliation View this entry on the original dictionary page scan.
abhisāntvitamfn. conciliated, pacified View this entry on the original dictionary page scan.
abhisap(3. plural A1. -s/apante-) to carry on, manage View this entry on the original dictionary page scan.
abhisaram. (in fine compositi or 'at the end of a compound' f(ā-).) a companion View this entry on the original dictionary page scan.
abhisāram. attack, assault View this entry on the original dictionary page scan.
abhisāram. meeting, rendezvous (of lovers) etc. View this entry on the original dictionary page scan.
abhisāram. "pay for coming", messenger's pay View this entry on the original dictionary page scan.
abhisāram. companion View this entry on the original dictionary page scan.
abhisāram. a purificatory rite View this entry on the original dictionary page scan.
abhisāram. (eṇa-) instrumental case (with sarveṇa-) equals sarvābhisāreṇa- q.v (see lohābhisāra-and abhīsāra-) View this entry on the original dictionary page scan.
abhisāram. plural Name of a people etc. View this entry on the original dictionary page scan.
abhisaraṇan. meeting, rendezvous (of lovers) View this entry on the original dictionary page scan.
abhisārasthānan. a place of rendezvous (of lovers) View this entry on the original dictionary page scan.
abhisargam. creation View this entry on the original dictionary page scan.
abhisārīf. Name of a town View this entry on the original dictionary page scan.
abhisārikāf. a woman who goes to meet her lover or keeps an assignation View this entry on the original dictionary page scan.
abhisārinmfn. going to meet View this entry on the original dictionary page scan.
abhisāriṇīf. equals abhi-sārikā- View this entry on the original dictionary page scan.
abhisāriṇīf. Name of a species of the triṣṭubh- metre (as that in ,in which two pāda-'s contain twelve instead of eleven syllables, and which therefore is said toapproachanother metre called jagatī-) View this entry on the original dictionary page scan.
abhisarjanan. for ati-s- (q.v) View this entry on the original dictionary page scan.
abhisarpaṇaSee abhi-sṛp-.
abhisarpaṇan. approaching View this entry on the original dictionary page scan.
abhisarpaṇan. the ascent (of sap in the trees). View this entry on the original dictionary page scan.
abhisartṛmfn. attacking, assailant View this entry on the original dictionary page scan.
abhisatkṛ(1 kṛ-), (ind.p. -kṛtya-) to honour, receive (a guest) with reverence View this entry on the original dictionary page scan.
abhisatkṛtamn. honoured, received with reverence View this entry on the original dictionary page scan.
abhisatvanm. surrounded by heroes (see abh/i-vīra-.) View this entry on the original dictionary page scan.
abhisāvakīyaNom. P. yati-, to long for a sāvaka- (q.v) commentator or commentary View this entry on the original dictionary page scan.
abhisāyamind. about evening, at sunset (see abhi-prāt/ar-.) View this entry on the original dictionary page scan.
abhisevanan. practising, cultivating View this entry on the original dictionary page scan.
abhisiddhif. the state of being effected or realized View this entry on the original dictionary page scan.
abhisidh -sedhati- View this entry on the original dictionary page scan.
abhisidh -sidhyati-, to be accomplished ; to obtain, win (with accusative) View this entry on the original dictionary page scan.
abhisisārayiṣumfn. intending to go to a rendezvous or to visit (a lover) View this entry on the original dictionary page scan.
abhiskambhCaus. (p. -skabhāyat-) commentator or commentary View this entry on the original dictionary page scan.
abhiskand(perf. -caskanda-) to ascend
abhiskanda according to to some,"m. the mounting [buck]", . View this entry on the original dictionary page scan.
abhiskandamind. running near View this entry on the original dictionary page scan.
abhismi(p. -smayat-) to smile upon View this entry on the original dictionary page scan.
abhisneham. affection, desire View this entry on the original dictionary page scan.
abhisnigdhaSee an-abhisn-. View this entry on the original dictionary page scan.
abhisphuritamfn. expanded to the full (as a blossom). View this entry on the original dictionary page scan.
abhisphūrj -sphūrjati-, to sound towards View this entry on the original dictionary page scan.
abhispṛś(Opt. -spṛśet-) to touch ; to influence, affect View this entry on the original dictionary page scan.
abhis(3. plural imperfect tense -asaran-, perf. -sasrur-) to flow towards (accusative) ; to approach, go towards, advance in order to meet, attack etc. ; to go to a rendezvous (said of lovers) : Causal to lead towards ; to cause to attack, lead to battle (varia lectio) ; to invite to a rendezvous ; to approach, visit View this entry on the original dictionary page scan.
abhisraṃs Aorist subjunctive 2. sg. -srās-, which is better derived fr. abhi-srij- q.v View this entry on the original dictionary page scan.
abhisṛj(imperfect tense -asṛjat-; Aorist Passive voice -/asarji-[ ] and 3. plural -asṛgran-[ ] or -asṛkṣata-[ ]) to pour into or upon (accusative), pour out for a purpose (accusative) or for the sake of (accusative) ; to let loose in a special direction ; (Aorist subjunctive 2. sg. -srās-for -srākṣ-s-) to throw upon ; to surrender, give, grant, allow, permit etc. ; to assail, attack View this entry on the original dictionary page scan.
abhisṛp(Imper. 2. sg. -sarpa-) to approach silently or softly View this entry on the original dictionary page scan.
abhisṛṣṭamfn. "let loose in a special direction", running towards (accusative or locative case) View this entry on the original dictionary page scan.
abhisṛṣṭamfn. allowed to View this entry on the original dictionary page scan.
abhisṛṣṭamfn. uttered View this entry on the original dictionary page scan.
abhisṛṣṭamfn. surrendered, given, granted View this entry on the original dictionary page scan.
abhisṛtamfn. gone near (accusative) View this entry on the original dictionary page scan.
abhisṛtamfn. one who has approached (for attacking) View this entry on the original dictionary page scan.
abhisṛtamfn. directed towards (in compound) View this entry on the original dictionary page scan.
abhisṛtamfn. visited by (instrumental case) View this entry on the original dictionary page scan.
abhisṛtya ind.p. having gone near (accusative) View this entry on the original dictionary page scan.
abhisru(Imper. 3. plural -sravantu-) to cause to flow near ; (p. -sravanta-for -sravat-) View this entry on the original dictionary page scan.
abhistaraṇan. scattering, strewing, , Scholiast or Commentator View this entry on the original dictionary page scan.
abhisthiramind. very firmly, intensely View this entry on the original dictionary page scan.
abhistṛto scatter over, cover View this entry on the original dictionary page scan.
abhisūto bring forth, View this entry on the original dictionary page scan.
abhisūcitamfn. pointed out View this entry on the original dictionary page scan.
abhisusūṣmfn. desirous of expressing soma- Juice View this entry on the original dictionary page scan.
abhisusūṣSee abhi-ṣu-. View this entry on the original dictionary page scan.
abhisvarf. (instrumental case -sv/arā-) invocation View this entry on the original dictionary page scan.
abhisvareind. dative case "for calling into one's presence", just behind (with genitive case) View this entry on the original dictionary page scan.
abhisvartṛm. an invoker View this entry on the original dictionary page scan.
abhisvayamātṛṇṇamind. on the brick (used in sacrifices and called) svayamātṛṇṇ/ā- (q.v) View this entry on the original dictionary page scan.
abhisvṛ(Imper. 2. sg. -svara-,3. plural -svarantu-) to join in praising or invoking ; to keep a note (in singing) up to (accusative) View this entry on the original dictionary page scan.
abhisyandSee abhi-ṣyand-. View this entry on the original dictionary page scan.
abhisyandam. oozing or flowing View this entry on the original dictionary page scan.
abhisyandam. running at the eyes View this entry on the original dictionary page scan.
abhisyandam. great increase or enlargement (Cf. pittābhiṣyanda-, raktābh-, vātābh-, śleṣmābh-) View this entry on the original dictionary page scan.
abhisyandiramaṇan. a smaller city appended to a larger one, suburb View this entry on the original dictionary page scan.
abhivisṛjA1. (imperfect tense 3. plural -asṛjanta-) to throw or shout towards (accusative) ; to assume from (ablative), View this entry on the original dictionary page scan.
abhūmisāhvayam. "named a-bhūmi- (bhūmi-dharā-,earth) id est adhara- ", lip View this entry on the original dictionary page scan.
abhyatisṛj(1. plural -/ati-sṛjāmas-) to let pass
abuddhisthamfn. not being in the conscience of commentator or commentary on View this entry on the original dictionary page scan.
acirarocisf. lightning. View this entry on the original dictionary page scan.
adhisaṃdhā(perf. 3. plural -dadh/uḥ-) to put or join together View this entry on the original dictionary page scan.
adhisaṃvas(3. pl. v/asante-) to dwell or reside together (quoted in ) View this entry on the original dictionary page scan.
adhisaṃvṛt(imperfect tense s/am-avar-tatādhi-) to originate from View this entry on the original dictionary page scan.
adhisenāpatif. the chief commander of an army, View this entry on the original dictionary page scan.
adhispardh(3. plural p. -sp/ardhante-and perf. -paspṛdhre-) to compete for an aim, strive at (locative case) View this entry on the original dictionary page scan.
adhispṛśto touch lightly or slightly : Causal (Potential -sparś/ayet-) to cause to reach to, to extend to View this entry on the original dictionary page scan.
adhisṛpto glide along View this entry on the original dictionary page scan.
adhisruto trickle or drop off View this entry on the original dictionary page scan.
ādhistenam. the stealer of a deposit, . View this entry on the original dictionary page scan.
adhistriind. concerning a woman or a wife View this entry on the original dictionary page scan.
adhistrīf. a superior woman View this entry on the original dictionary page scan.
adhisyadamfn. very swift, View this entry on the original dictionary page scan.
ādisargam. primitive creation View this entry on the original dictionary page scan.
ādisargam. see View this entry on the original dictionary page scan.
ādisiṃham. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
ādisthāyikasee sthāyika- (parasmE-pada 1264) View this entry on the original dictionary page scan.
ādisūram. Name of a prince. View this entry on the original dictionary page scan.
ādisvaritamfn. having the Svarita accent on the first syllable, VPra1t., Scholiast or Commentator View this entry on the original dictionary page scan.
ādityajyotis(ādity/a--) mfn. having the light of the sun View this entry on the original dictionary page scan.
adrisaṃhata(/adri--) mfn. expressed with stones View this entry on the original dictionary page scan.
adrisānumfn. lingering on the mountains View this entry on the original dictionary page scan.
ādrisāramf(ī-)n. (fr. adri-s-), made of iron, iron View this entry on the original dictionary page scan.
adrisāram. "essence of stones"iron. View this entry on the original dictionary page scan.
adrisāramayamfn. made of iron. View this entry on the original dictionary page scan.
āgatavismayamfn. filled with wonder, View this entry on the original dictionary page scan.
agnijyotismfn. flaming, View this entry on the original dictionary page scan.
agnisādam. weakness of digestion View this entry on the original dictionary page scan.
agnisahāyam. "friend of fire", the wind View this entry on the original dictionary page scan.
agnisahāyam. a wild pigeon View this entry on the original dictionary page scan.
agnisajjāf.? indigestion View this entry on the original dictionary page scan.
agnisakham. "friend of fire", the wind View this entry on the original dictionary page scan.
agnisākṣikamfn. taking agni- or the domestic or nuptial fire for a witness View this entry on the original dictionary page scan.
agnisākṣikamaryādamfn. one who taking agni- for a witness gives a solemn promise of conjugal fidelity. View this entry on the original dictionary page scan.
agnisamādhānan. kindling fire, View this entry on the original dictionary page scan.
agnisambhavamfn. produced from fire View this entry on the original dictionary page scan.
agnisambhavam. wild safflower View this entry on the original dictionary page scan.
agnisambhavam. equals -jāra- View this entry on the original dictionary page scan.
agnisambhavam. "the result of digestion", chyme or chyle View this entry on the original dictionary page scan.
agnisaṃcayam. preparing the sacrificial fire-place View this entry on the original dictionary page scan.
agnisaṃcayam. See -cayana-. View this entry on the original dictionary page scan.
agnisaṃdīpanamfn. stimulating digestion, View this entry on the original dictionary page scan.
agnisaṃkāśa(agn/i--) mfn. resplendent like fire View this entry on the original dictionary page scan.
agnisaṃskāram. the consecration of fire View this entry on the original dictionary page scan.
agnisaṃskāram. performance of any rite in which the application of fire is essential, as the burning of a dead body View this entry on the original dictionary page scan.
agnisāran. a medicine for the eyes, a collyrium View this entry on the original dictionary page scan.
agnisarasn. Name of a tīrtha- View this entry on the original dictionary page scan.
agnisātind. to the state of fire (used in compound with1. kṛ-and bhū- exempli gratia, 'for example' agnisāt kṛ-,to reduce to fire, to consume by fire) see bhasmasāt-. View this entry on the original dictionary page scan.
agnisavam. consecration of the fire View this entry on the original dictionary page scan.
agnisāvarṇim. Name of a manu- View this entry on the original dictionary page scan.
agnisiṃham. Name of the father of the seventh black vāsudeva- View this entry on the original dictionary page scan.
agnisparśamfn. scalding hot, View this entry on the original dictionary page scan.
agnisroṇif. leg of the sacrificial altar View this entry on the original dictionary page scan.
agnistambham. or View this entry on the original dictionary page scan.
agnistambhanan. the (magical) quenching of fire. View this entry on the original dictionary page scan.
agnisthalan. the fire-place, View this entry on the original dictionary page scan.
agnistokam. a particle of fire, spark. View this entry on the original dictionary page scan.
agnisūtran. thread of fire View this entry on the original dictionary page scan.
agnisūtran. a girdle of sacrificial grass put upon a young Brahman at his investiture View this entry on the original dictionary page scan.
agnisvāttaSee -ṣvātt/a-. View this entry on the original dictionary page scan.
agnivisarpam. spread of inflammation (in a tumour). View this entry on the original dictionary page scan.
agnyādhānahavisn. an oblation at the agnyādheya- View this entry on the original dictionary page scan.
agnyarcisf. or n. flame View this entry on the original dictionary page scan.
agṛbhītaśocismfn. (/agṛbhīta--) "having unsubdued splendour", Name of agni- and the marut-s View this entry on the original dictionary page scan.
agṛbhītaśocismfn. ("having inconceivable splendour") View this entry on the original dictionary page scan.
āhatavisargatāf. the deadening of a visarga- or its change into o- View this entry on the original dictionary page scan.
ahavismfn. not offering oblations View this entry on the original dictionary page scan.
ahimarocism. "hot-rayed", the sun, View this entry on the original dictionary page scan.
ajiraśocis(ajir/a-.) m. having a quick light, glittering, Name of agni-, of soma- View this entry on the original dictionary page scan.
ājisṛtmfn. equals -k/ṛt- q.v View this entry on the original dictionary page scan.
ājyahavis(/ājya--) mfn. having an oblation consisting of clarified butter View this entry on the original dictionary page scan.
akṛmiparisṛptamfn. not crawled over by worms, View this entry on the original dictionary page scan.
akṣisaṃskāram. painting the eyes, View this entry on the original dictionary page scan.
akṣisaṃskāracollyrium, View this entry on the original dictionary page scan.
akṣisaṃtarjanan. (probably), Name of a mythic weapon View this entry on the original dictionary page scan.
aktubhisind. at night View this entry on the original dictionary page scan.
amatismfn. poor, indigent View this entry on the original dictionary page scan.
āmātisāram. dysentery or diarrhoea produced by vitiated mucus in the abdomen (the excretion being mixed with hard and fetid matter) View this entry on the original dictionary page scan.
āmātisārinmfn. afflicted with the above disease. View this entry on the original dictionary page scan.
ambudhisravāf. the plant Aloes Perfoliata. View this entry on the original dictionary page scan.
aṃhriskandham. a part of the foot between the ancle and the heel View this entry on the original dictionary page scan.
āmisn. raw flesh, meat View this entry on the original dictionary page scan.
āmisn. a dead body ([ /āmiṣi-]). View this entry on the original dictionary page scan.
anabhisambandhamfn. unconnected View this entry on the original dictionary page scan.
anabhisambandham. no connection. View this entry on the original dictionary page scan.
anabhisandhānan. absence of design View this entry on the original dictionary page scan.
anabhisandhānan. disinterestedness. View this entry on the original dictionary page scan.
anabhisandhim. idem or 'n. disinterestedness.' View this entry on the original dictionary page scan.
anabhisandhikṛtamfn. done undesignedly. View this entry on the original dictionary page scan.
anabhisnehamfn. without affection, cold, unimpassioned View this entry on the original dictionary page scan.
anāśismfn. not desirable, not agreeable View this entry on the original dictionary page scan.
anatisṛṣṭamfn. not allowed, View this entry on the original dictionary page scan.
andhatāmisram. complete darkness of the soul View this entry on the original dictionary page scan.
andhatāmisran. the second or eighteenth of the twenty-one hells View this entry on the original dictionary page scan.
andhatāmisran. doctrine of annihilation after death. View this entry on the original dictionary page scan.
andhatāmisran. darkness, View this entry on the original dictionary page scan.
aṅghrisaṃdhim. "footjoint", the ancle, View this entry on the original dictionary page scan.
aṅghriskandham. the ancle. View this entry on the original dictionary page scan.
aṅgulisaṃdeṃsam. snapping or cracking the fingers as a sign. View this entry on the original dictionary page scan.
aṅgulisphoṭanan. snapping or cracking the fingers. View this entry on the original dictionary page scan.
anīcaisind. not in a low voice, loudly. View this entry on the original dictionary page scan.
anīcaistanamfn. not low, View this entry on the original dictionary page scan.
anisargamfn. unnatural, unnaturally affected. View this entry on the original dictionary page scan.
anisṛṣṭamfn. not allowed, unauthorized, . View this entry on the original dictionary page scan.
anistabdhamfn. not rendered immovable or stiff View this entry on the original dictionary page scan.
anistabdhamfn. not paralysed View this entry on the original dictionary page scan.
anistabdhamfn. not fixed. View this entry on the original dictionary page scan.
anistīrṇamfn. not crossed over View this entry on the original dictionary page scan.
anistīrṇamfn. not set aside View this entry on the original dictionary page scan.
anistīrṇamfn. not rid of View this entry on the original dictionary page scan.
anistīrṇamfn. unanswered, unrefuted. View this entry on the original dictionary page scan.
anistīrṇābhiyogam. (a defendant) who has not yet (by refutation) got rid of a charge. View this entry on the original dictionary page scan.
anistiṣṭhatmfn. not bringing to an end, View this entry on the original dictionary page scan.
añjisakthamfn. having coloured thighs (a victim) View this entry on the original dictionary page scan.
añjisakthamfn. see View this entry on the original dictionary page scan.
annavāhisrotasn. the oesophagus, gullet. View this entry on the original dictionary page scan.
anṛtābhisandhamfn. idem or 'mf(ikā-)n. of faithless disposition, ' View this entry on the original dictionary page scan.
antarjyotis(ant/ar--) mfn. having the soul enlightened, illuminated View this entry on the original dictionary page scan.
antisumna(/anti--) mfn. at hand with kindness View this entry on the original dictionary page scan.
anubhūtisvarūpācāryam. Name of the author of the grammar sārasvatī-prakriyā-. View this entry on the original dictionary page scan.
anuccaisind. not aloud, in a low voice. View this entry on the original dictionary page scan.
anujīvisātkṛtamfn. made wholly subservient View this entry on the original dictionary page scan.
anupalabdhisamamf(ā-) trying to establish a fact (exempli gratia, 'for example' the reality and eternity of sound) from the impossibility of perceiving the non perception of it, sophistical argument View this entry on the original dictionary page scan.
anuparisicto pour round, View this entry on the original dictionary page scan.
anuparisruto run after View this entry on the original dictionary page scan.
anutpattisamamf(ā-) (in nyāya- philosophy) arguing against a thing by trying to show that nothing exists from which it could spring. View this entry on the original dictionary page scan.
anuvismitamfn. one who is astonished after another View this entry on the original dictionary page scan.
anuvisto extend or stream over View this entry on the original dictionary page scan.
anuvisraṃsCaus. -sraṃsayati-, to separate, loose View this entry on the original dictionary page scan.
anuvisṛjto shoot at or towards ; to send along (accusative) View this entry on the original dictionary page scan.
anuvistṛtamfn. ( stṛ-),"extended, spread out", large, roomy View this entry on the original dictionary page scan.
anvatisicto pour out over or along View this entry on the original dictionary page scan.
anyadāśisf. a bad desire or hope (?) View this entry on the original dictionary page scan.
anyatojyotismfn. having light or a jyotis- day only on one side, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
apabarhismfn. not having the portion constituting the barhis- View this entry on the original dictionary page scan.
aparisamāptikamfn. not ending, endless commentator or commentary on View this entry on the original dictionary page scan.
aparisaṃkhyānan. innumerableness, infinite diffcrence, View this entry on the original dictionary page scan.
aparisaṃkhyeyamfn. innumerable, infinitely different, ibidem or 'in the same place or book or text' as the preceding, Scholiast or Commentator View this entry on the original dictionary page scan.
aparisaramfn. non-contiguous, distant. View this entry on the original dictionary page scan.
apariskandamind. so as not to jump or leap about View this entry on the original dictionary page scan.
aparisthānamfn. improper View this entry on the original dictionary page scan.
aparisthānan. impropriety, View this entry on the original dictionary page scan.
apisaṃgṛbhāyaNom. P. (Imper. 2. sg. -gṛbhāya-) to assume View this entry on the original dictionary page scan.
apisicto sprinkle with View this entry on the original dictionary page scan.
apisomopīthamfn. partaking of soma- drink, View this entry on the original dictionary page scan.
apisto flow upon View this entry on the original dictionary page scan.
apisṛjP. to place to or upon : P. and A1. to add to, mingle to View this entry on the original dictionary page scan.
aprāmisatya( -with prā- equals pra- see a-pr/amaya-),"of imperishable truthfulness", unalterably true View this entry on the original dictionary page scan.
apratisādhyamfn. incurable, , Scholiast or Commentator View this entry on the original dictionary page scan.
apratisaṃkhyāf. "not observing", in compound with View this entry on the original dictionary page scan.
apratisaṃkhyāinconsiderateness, View this entry on the original dictionary page scan.
apratisaṃkhyānirodham. the unobserved annihilation of an object View this entry on the original dictionary page scan.
apratisaṃkramamfn. having no intermixture. View this entry on the original dictionary page scan.
apratistabdhamfn. unrestrained (see a-pratiṣṭabdha-above.) View this entry on the original dictionary page scan.
araṅgisattvam. plural a class of deities View this entry on the original dictionary page scan.
arcisn. ray of light, flame, light, lustre (once. plural arc/īnṣi- ) etc. View this entry on the original dictionary page scan.
arcisf. idem or 'n. ray of light, flame, light, lustre (once. plural arc/īnṣi- ) etc.' etc., (is-), Name of the wife of kṛśāśva- and mother of dhūmaketu- View this entry on the original dictionary page scan.
arcisārciṣmatmfn. brilliant, resplendent etc. View this entry on the original dictionary page scan.
arcisārciṣmatm. fire, the god of fire View this entry on the original dictionary page scan.
arcisārciṣmatm. a flame View this entry on the original dictionary page scan.
arcisārciṣmatīf. one of the ten stages (through which a bodhisattva- must rise before becoming a buddha-) View this entry on the original dictionary page scan.
ardhavisargam. the sound visarga- before k, kh, p, ph (so called because its sign [$] is the half of that of the visarga-[ -]). View this entry on the original dictionary page scan.
argalāstutistotran. a hymn introductory to the devīmāhātmya-. View this entry on the original dictionary page scan.
arisiṃham. Name of an author. View this entry on the original dictionary page scan.
arisomam. a kind of soma- plant View this entry on the original dictionary page scan.
arisūdanam. destroyer of foes. View this entry on the original dictionary page scan.
arpisam. the heart View this entry on the original dictionary page scan.
arthāpattisamafn. an inference by which the quality of any object is attributed to another object because of their sharing some other quality in common View this entry on the original dictionary page scan.
arthasamisayam. danger in regard to one's fortune View this entry on the original dictionary page scan.
arthisātind. with 1. kṛ-, to grant anything (accusative) to one who asks for it View this entry on the original dictionary page scan.
aruṇajyotism. Name of śiva-: View this entry on the original dictionary page scan.
aruṇārcism. the rising sun View this entry on the original dictionary page scan.
asaṃjñisattvam. pl equals asaṅgi-s-. q.v View this entry on the original dictionary page scan.
asaṅgisattvam. plural Name of certain deities View this entry on the original dictionary page scan.
āśisf. asking for, prayer, wish etc. View this entry on the original dictionary page scan.
āśisf. blessing, benediction View this entry on the original dictionary page scan.
āśisf. wishing for any other View this entry on the original dictionary page scan.
āśisf. a particular medicament View this entry on the original dictionary page scan.
āśisf. (for 2. āśis-See sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
āśisf. a serpent's fang View this entry on the original dictionary page scan.
āśisf. (for 1. āś/is-See ā-śās-.) View this entry on the original dictionary page scan.
āsisādayiṣumfn. (fr. Desiderative of the Causal) , being about or wishing to attack View this entry on the original dictionary page scan.
asisūnāf. (= sūnā-), View this entry on the original dictionary page scan.
asitārcism. fire View this entry on the original dictionary page scan.
asthisamarpaṇan. throwing the bones of a dead body into the Ganges View this entry on the original dictionary page scan.
asthisambhavamfn. consisting of bones (said of the vajra- or thunder bolt) View this entry on the original dictionary page scan.
asthisambhavamfn. "produced in the bones", marrow View this entry on the original dictionary page scan.
asthisaṃcayam. the ceremony of collecting the bones (after burning a corpse) commentator or commentary on see etc. View this entry on the original dictionary page scan.
asthisaṃcayanan. the ceremony of collecting the bones (after burning a corpse) commentator or commentary on View this entry on the original dictionary page scan.
asthisaṃghātam. Name (also title or epithet) of a plant, View this entry on the original dictionary page scan.
asthisaṃhāram. idem or 'm. Name (also title or epithet) of a plant, ' View this entry on the original dictionary page scan.
asthisaṃhārakam. idem or 'f. idem or 'm. idem or 'm. Name (also title or epithet) of a plant, ' ' ' View this entry on the original dictionary page scan.
asthisaṃhārakam. "bone-seizer", the adjutant bird View this entry on the original dictionary page scan.
asthisaṃhārīf. idem or 'm. idem or 'm. Name (also title or epithet) of a plant, ' ' View this entry on the original dictionary page scan.
asthisaṃnahana m. Name (also title or epithet) of a plant, View this entry on the original dictionary page scan.
asthisaṃyogam. a joint, View this entry on the original dictionary page scan.
asthisandhim. a joint View this entry on the original dictionary page scan.
asthisāram. marrow View this entry on the original dictionary page scan.
asthisneha m. marrow View this entry on the original dictionary page scan.
asthisnehakam. marrow View this entry on the original dictionary page scan.
asthisraṃsamfn. causing the bones to fall asunder View this entry on the original dictionary page scan.
asthisthūṇamfn. having the bones for its pillars (as the body) View this entry on the original dictionary page scan.
aśvahavisn. Name of a sacrificial ceremony View this entry on the original dictionary page scan.
aśvisālokyan. attainment of heaven by those who have offered aśva-medha- sacrifices, View this entry on the original dictionary page scan.
aśvisutam. dual number the two sons of the aśvin-s (nakula- and saha-deva-), View this entry on the original dictionary page scan.
atamisramfn. not dark, not benighted. View this entry on the original dictionary page scan.
atibodhisattvamfn. exceeding a bodhi-sattva-, View this entry on the original dictionary page scan.
atisādhvasan. excessive fear. View this entry on the original dictionary page scan.
atisaktif. excessive attachment. View this entry on the original dictionary page scan.
atisaktimatmfn. excessively attached. View this entry on the original dictionary page scan.
atisamarthamfn. very competent. View this entry on the original dictionary page scan.
atisaṃcayam. excessive accumulation. View this entry on the original dictionary page scan.
atisaṃdhāto overreach, deceive ; to wrong or injure View this entry on the original dictionary page scan.
atisaṃdhānan. overreaching, cheating. View this entry on the original dictionary page scan.
atisaṃdheyamfn. easy to be settled or conciliated. View this entry on the original dictionary page scan.
atisaṃdheyamfn. easy to be conciliated, easy to be settled. View this entry on the original dictionary page scan.
atisamīpamfn. very near. View this entry on the original dictionary page scan.
atisamparkam. excessive (sexual) intercourse. View this entry on the original dictionary page scan.
atisaṃskṛtamfn. highly finished. View this entry on the original dictionary page scan.
atisaṃtaptamfn. greatly afflicted. View this entry on the original dictionary page scan.
atisāṃvatsaramfn. extending over more than a year View this entry on the original dictionary page scan.
atisāmyāf. the sweet juice of the Bengal Madder, Rubia Manjith. View this entry on the original dictionary page scan.
atisandhamind. so as to violate an agreement or any fixed order View this entry on the original dictionary page scan.
atisandhitamfn. overreached, cheated. View this entry on the original dictionary page scan.
atisāntapanan. a kind of severe penance (inflicted especially for eating unclean animal food). View this entry on the original dictionary page scan.
atisaram. effort, exertion View this entry on the original dictionary page scan.
atisāra m. purging, dysentery. View this entry on the original dictionary page scan.
atisāratransgression (in - ti-- s-), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
atisārakin mfn. afflicted with purging or dysentery. View this entry on the original dictionary page scan.
atisarasvatīf. a particular personification, View this entry on the original dictionary page scan.
atisargam. act of parting with, dismissal, giving away View this entry on the original dictionary page scan.
atisargam. granting permission, leave View this entry on the original dictionary page scan.
atisargam. atisarg/am- 1. d/a-, to bid any one farewell View this entry on the original dictionary page scan.
atisargaremnant View this entry on the original dictionary page scan.
ātisārikamf(ī-)n. like diarrhoea, View this entry on the original dictionary page scan.
atisārin mfn. afflicted with purging or dysentery. View this entry on the original dictionary page scan.
atisārinmfn. afflicted with purging or dysentery. View this entry on the original dictionary page scan.
atisarjanan. the act of giving away, granting View this entry on the original dictionary page scan.
atisarjanan. liberality View this entry on the original dictionary page scan.
atisarjanan. a gift View this entry on the original dictionary page scan.
atisarjanan. sending out of the world, killing. View this entry on the original dictionary page scan.
atisarvamfn. too complete View this entry on the original dictionary page scan.
atisarvamfn. superior to all See sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
atisarvamfn. superior to all View this entry on the original dictionary page scan.
atisarvam. the Supreme. View this entry on the original dictionary page scan.
atisauhityan. excessive satiety exempli gratia, 'for example' being spoiled, stuffed with food, etc. View this entry on the original dictionary page scan.
atisauparṇamfn. superior to (the powers of) suparṇa- or garuḍa-. View this entry on the original dictionary page scan.
atisaurabhamfn. very fragrant View this entry on the original dictionary page scan.
atisaurabhan. extraordinary fragrance. View this entry on the original dictionary page scan.
atisāyamind. very late in the evening. View this entry on the original dictionary page scan.
atisenam. Name of a prince. View this entry on the original dictionary page scan.
atisevto use or enjoy immoderately, to practise excessively ; see ati-sevā- sub voce, i.e. the word in the Sanskrit order ati-. View this entry on the original dictionary page scan.
atisevāf. excessive addiction (to a habit). View this entry on the original dictionary page scan.
atisiddhif. great perfection. View this entry on the original dictionary page scan.
atisitāṅgavihaṃgam. a swan, View this entry on the original dictionary page scan.
atisnigdhamfn. very smooth, very nice, very affectionate View this entry on the original dictionary page scan.
atisparśam. too marked contact (of the tongue and palate) in pronunciation. View this entry on the original dictionary page scan.
atisphiramfn. very tremulous. View this entry on the original dictionary page scan.
atisCaus. to cause to pass through: Passive voice -sāryate- ; to be purged View this entry on the original dictionary page scan.
atisraṃsto drop or turn away from, to escape View this entry on the original dictionary page scan.
atisrāvitamfn. caused to flow excessively (as a wound) View this entry on the original dictionary page scan.
atisṛjto glide over or along ; to send away dismiss, abandon ; to leave as a remnant, to remit, forgive ; to give away, present, to create in a higher degree View this entry on the original dictionary page scan.
atisṛjyamfn. to be dismissed View this entry on the original dictionary page scan.
atisṛjyamfn. View this entry on the original dictionary page scan.
atisṛpto glide or creep over, get over View this entry on the original dictionary page scan.
atisṛṣṭi(/ati--) f. an extraordinary or excellent creation View this entry on the original dictionary page scan.
atisṛṣṭif. a higher creation View this entry on the original dictionary page scan.
atisruto flow over or flow excessively. View this entry on the original dictionary page scan.
atisrutamfn. that which has been flowing over (Name of soma-) View this entry on the original dictionary page scan.
atisthiramfn. very stable. View this entry on the original dictionary page scan.
atisthūlamfn. (/ati-.) excessively big or clumsy View this entry on the original dictionary page scan.
atisthūlamfn. excessively stupid. View this entry on the original dictionary page scan.
atistrimf(is-,or ī-)n. surpassing a woman View this entry on the original dictionary page scan.
atistrimf(is-,or ī-)n. See Gram. 123. b-. View this entry on the original dictionary page scan.
atistutif. excessive praise View this entry on the original dictionary page scan.
atisuhitamfn. excessively kind, over-kind. View this entry on the original dictionary page scan.
atisuhitamfn. perfectly satiated, View this entry on the original dictionary page scan.
atisujanamfn. very moral, very friendly. View this entry on the original dictionary page scan.
atisulabhamfn. very easily obtainable. View this entry on the original dictionary page scan.
atisundaramfn. very handsome View this entry on the original dictionary page scan.
atisundaramf. a metre belonging to the class aṣṭi- (also called citra-or cañcalā-). View this entry on the original dictionary page scan.
atisvapnam. excessive sleep View this entry on the original dictionary page scan.
atisvapnan. excessive tendency to dreaming. View this entry on the original dictionary page scan.
atisvāryamfn. the last of the seven notes
atisvasthamfn. enjoying excellent health. View this entry on the original dictionary page scan.
ātisvāyanamfn. (fr. ati-svan-), (gaRa pakṣādi-, q.v) View this entry on the original dictionary page scan.
atisvinnamfn. caused to perspire abundantly, View this entry on the original dictionary page scan.
atisvṛto hold or sustain a note View this entry on the original dictionary page scan.
atithisatkāram. honourable treatment of a guest. View this entry on the original dictionary page scan.
atithisevāf. attention to a guest. View this entry on the original dictionary page scan.
ātmajyotisn. the light of the soul or supreme spirit View this entry on the original dictionary page scan.
ātmajyotismfn. receiving light from one's self View this entry on the original dictionary page scan.
atrisaṃhitā f. the code ascribed to atri-. View this entry on the original dictionary page scan.
atrismṛtif. the code ascribed to atri-. View this entry on the original dictionary page scan.
atyabhisṛtamfn. ( sṛ-), having approached too much, having come too close View this entry on the original dictionary page scan.
atyagnisomārkamfn. brighter than fire or the moon or the sun. View this entry on the original dictionary page scan.
atyaṣṭisāmagrīf. Name of work View this entry on the original dictionary page scan.
atyuccaisind. very loudly. View this entry on the original dictionary page scan.
avaharṣistamfn. ( hṛṣ-), caused to shiver View this entry on the original dictionary page scan.
avanisutam. equals -ja- above View this entry on the original dictionary page scan.
avantisenam. Name of a man View this entry on the original dictionary page scan.
avantisomam. sour gruel (prepared from the fermentation of, rice-water) View this entry on the original dictionary page scan.
avantisvāminm. Name of a sanctuary built by avantivarman- View this entry on the original dictionary page scan.
avavisraṃsitamfn. ( sraṃs-, Causal) fallen down, View this entry on the original dictionary page scan.
avīcisaṃśoṣaṇam. a particular samādhi- View this entry on the original dictionary page scan.
āvisind. (said to be connected with vahis-and ava-;or fr. ā-vid- ; confer, compare Greek ; Latin ex?) , before the eyes, openly, manifestly, evidently View this entry on the original dictionary page scan.
avisaṃvādam. non-contradiction View this entry on the original dictionary page scan.
avisaṃvādam. non-violation of one's promise View this entry on the original dictionary page scan.
avisaṃvādinmfn. not contradictory, coinciding, agreeing View this entry on the original dictionary page scan.
avisaṃvāditamfn. undisputed, generally approved, View this entry on the original dictionary page scan.
avisaṃvāditāf. not violating (id est keeping) a promise View this entry on the original dictionary page scan.
avisarginmfn. unintermittent (as a fever) View this entry on the original dictionary page scan.
avisarpinm. Name of a hell View this entry on the original dictionary page scan.
aviskanttṛmfn. not leaping to and fro, View this entry on the original dictionary page scan.
avismitamfn. not proud View this entry on the original dictionary page scan.
avismṛtamfn. not forgotten View this entry on the original dictionary page scan.
avismṛtif. not forgetting, remembering View this entry on the original dictionary page scan.
avisodhan. d. View this entry on the original dictionary page scan.
avisoḍhaSee /avi-. View this entry on the original dictionary page scan.
avispanditamfn. not quivering View this entry on the original dictionary page scan.
avispaṣṭamf(ā-)n. not clear or plain, indistinct, obscure etc. View this entry on the original dictionary page scan.
avispaṣṭan. indistinct speech View this entry on the original dictionary page scan.
avispaṣṭan. anything indistinct View this entry on the original dictionary page scan.
avisraṃsam. not falling asunder View this entry on the original dictionary page scan.
avisrāvyamfn. (water) that cannot be caused to flow off View this entry on the original dictionary page scan.
avisrāvyamfn. not to be bled View this entry on the original dictionary page scan.
avisṛṣṭamfn. not removed or put aside, View this entry on the original dictionary page scan.
avisṛṣṭanot dismissed, View this entry on the original dictionary page scan.
āvistarāmind. in a more manifest or very manifest way (very often joined to the roots as-, bhū-,and 1. kṛ-). View this entry on the original dictionary page scan.
avisthalan. "sheep-place", Name of a town (edition Bomb.) and 2595. View this entry on the original dictionary page scan.
avistīrṇamfn. not extended, of small extent or circuit View this entry on the original dictionary page scan.
avistṛtamfn. not spread or expanded View this entry on the original dictionary page scan.
avisvararmind. without dissonance View this entry on the original dictionary page scan.
avisyanditaSee a-vispand-.
avitathābhisandhimfn. whose intentions are not futile id est successive View this entry on the original dictionary page scan.
ayonisambhavamfn. equals a-yoni-ja- q.v View this entry on the original dictionary page scan.
ayugārcism. "having odd (id est seven) flames", fire View this entry on the original dictionary page scan.
baddhanisyandamfn. having the flow or discharge of anything impeded View this entry on the original dictionary page scan.
baddhanisyandamfn. impeding it View this entry on the original dictionary page scan.
bahisind. (the final s-is changed before k-and p-into -; see ) out, forth, outwards, outside (a house, village, city, kingdom etc.;also with ablative or in fine compositi or 'at the end of a compound' = out of, apart from, except, beside) (with kṛ-,to place outside, expel, banish, exclude;with bhū-,to come forth;with gam-,or -,to go out etc.; see compound) View this entry on the original dictionary page scan.
bahiṣṭājjyotisn. Name of a triṣṭubh- the last pāda- of which contains 8 syllables View this entry on the original dictionary page scan.
bahistanvamfn. one whose limbs extend over the body (of the fire-altar) View this entry on the original dictionary page scan.
bahistapasn. outward penance, View this entry on the original dictionary page scan.
bahuvaistika mfn. weighing many Vistas, View this entry on the original dictionary page scan.
bahuvistamfn. weighing many Vistas, View this entry on the original dictionary page scan.
bahuvistaram. great extension View this entry on the original dictionary page scan.
bahuvistaram. ( bahuvistarayuktam -yuktam- ind. in all directions, everywhere ) View this entry on the original dictionary page scan.
bahuvistaramf(ā-)n. of wide extent, widely spread (also tāra- ) View this entry on the original dictionary page scan.
bahuvistaramf(ā-)n. manifold, various View this entry on the original dictionary page scan.
bahuvistaramf(ā-)n. very detailed ( bahuvistaram am- ind.) View this entry on the original dictionary page scan.
bahuvistaramind. bahuvistara
bahuvistarayuktamind. bahuvistara View this entry on the original dictionary page scan.
bahuvistīrṇamfn. widespread, widely diffused (--,f) View this entry on the original dictionary page scan.
bahuvistīrṇāf. Abrus precatorius (a shrub bearing a small red and black berry and commonly called Kucai) View this entry on the original dictionary page scan.
balanisūdanam. equals -nāśana- View this entry on the original dictionary page scan.
balisadmann. equals -mandira- View this entry on the original dictionary page scan.
balisudana wrong reading for bala-s-. View this entry on the original dictionary page scan.
bandisthitamfn. sitting in prison, imprisoned View this entry on the original dictionary page scan.
bandistrīf. a female bard on View this entry on the original dictionary page scan.
barhirjyotism. fire or the god of fire View this entry on the original dictionary page scan.
barhisn. (rarely m.)"that which is plucked up", sacrificial grass, a bed or layer of kuśa- grass (usually strewed over the sacrificial ground and especially over the vedi-, to serve as a sacred surface on which to present the oblations, and as a seat for the gods and for the sacrificers) etc. View this entry on the original dictionary page scan.
barhisn. Sacrificial Grass personified (and enumerated among the prayāja- and anuyāja- deities) View this entry on the original dictionary page scan.
barhisn. sacrifice View this entry on the original dictionary page scan.
barhisn. ether View this entry on the original dictionary page scan.
barhisn. water View this entry on the original dictionary page scan.
barhisn. a kind of perfume View this entry on the original dictionary page scan.
barhism. fire, light, splendour View this entry on the original dictionary page scan.
barhism. Plumbago Zeylanica View this entry on the original dictionary page scan.
barhism. Name of a man View this entry on the original dictionary page scan.
barhism. of a son of bṛhad-rāja- View this entry on the original dictionary page scan.
barhism. plural the descendants of barhis- View this entry on the original dictionary page scan.
barhistṛṇan. a blade of the sacrificial grass View this entry on the original dictionary page scan.
bhagavadbhaktisādhanan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktisārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktistotran. Name of work View this entry on the original dictionary page scan.
bhaisSee 1. bhī-, p.758. View this entry on the original dictionary page scan.
bhaktābhisāram. an eating room (others"giving of food") View this entry on the original dictionary page scan.
bhaktisāgaram. Name of work View this entry on the original dictionary page scan.
bhaktisāmānyanirūpaṇan. Name of work View this entry on the original dictionary page scan.
bhaktisaṃdarbham. (and bhaktisaṃdarbhapadyāvalī bha-padyāvalī- f.) Name of work View this entry on the original dictionary page scan.
bhaktisaṃdarbhapadyāvalīf. bhaktisaṃdarbha
bhaktisaṃnyāsanirṇayavivaraṇan. Name of work View this entry on the original dictionary page scan.
bhaktisaṃvardhanaśatakan. Name of work View this entry on the original dictionary page scan.
bhaktisāram. (and bhaktisārasaṃgraha ra-saṃgraha-,m.) Name of work View this entry on the original dictionary page scan.
bhaktisārasaṃgraham. bhaktisāra
bhaktisiddhāntam. Name of work View this entry on the original dictionary page scan.
bhaktisudhodayam. Name of work View this entry on the original dictionary page scan.
bhaktisūtran. Name of work () View this entry on the original dictionary page scan.
bhāradvājāgnisaṃdhānādismārtaprayogam. Name of work View this entry on the original dictionary page scan.
bharaṇisenam. Name of a man View this entry on the original dictionary page scan.
bhavapratisaṃdhim. entering into existence View this entry on the original dictionary page scan.
bhīmarūpistotran. Name of work View this entry on the original dictionary page scan.
bhisf. boiled rice
bhissaṭāor bhissiṭā- f. cooked rice View this entry on the original dictionary page scan.
bhrājis equals bhrājas- above. View this entry on the original dictionary page scan.
bhṛśavismitamfn. excessively astonished or perplexed View this entry on the original dictionary page scan.
bhūgolavistāram. Name of work View this entry on the original dictionary page scan.
bhuktisaptaśatīf. Name of a poem. View this entry on the original dictionary page scan.
bhūmisambhavamfn. produced on or from the earth View this entry on the original dictionary page scan.
bhūmisambhavāf. Name of sītā- View this entry on the original dictionary page scan.
bhūmisaṃniveśam. the general appearance or configuration of a country View this entry on the original dictionary page scan.
bhūmisāmrājyan. sovereignty over the earth View this entry on the original dictionary page scan.
bhūmisattran. an offering consisting of a donation of land View this entry on the original dictionary page scan.
bhūmisavam. one of the 9 vrātya-stoma-s View this entry on the original dictionary page scan.
bhūmisenam. Name of one of the sons of the 10th manu- View this entry on the original dictionary page scan.
bhūmisenam. of a scholar View this entry on the original dictionary page scan.
bhūmisnum. an earthworm View this entry on the original dictionary page scan.
bhūmispṛśmfn. touching the ground View this entry on the original dictionary page scan.
bhūmispṛśmfn. blind View this entry on the original dictionary page scan.
bhūmispṛśmfn. cripple, lame View this entry on the original dictionary page scan.
bhūmispṛśm. a man View this entry on the original dictionary page scan.
bhūmispṛśm. a vaiśya- View this entry on the original dictionary page scan.
bhūmispṛśm. a thief who creeps along the ground View this entry on the original dictionary page scan.
bhūmistomam. Name of an ekāha- View this entry on the original dictionary page scan.
bhūmisutam. "earth-son", the planet Mars View this entry on the original dictionary page scan.
bhūmisvāminm. "landlord", a king, prince View this entry on the original dictionary page scan.
bhūpādiskandhalakṣaṇan. Name of work View this entry on the original dictionary page scan.
bhūpatistutif. Name of a hymn. View this entry on the original dictionary page scan.
bhūrisakhamfn. "having many friends"or,"dear to many", View this entry on the original dictionary page scan.
bhūristhātra(bh/ūri--) mfn. having many stations, being at many places or spots View this entry on the original dictionary page scan.
bhūtajyotism. "light of living beings", Name of a king View this entry on the original dictionary page scan.
bhūtisita() mfn. white with ashes (said of śiva-). View this entry on the original dictionary page scan.
bhūtisṛjmfn. creating welfare View this entry on the original dictionary page scan.
bhuvism. (?) the sea, ocean View this entry on the original dictionary page scan.
bhuvisf. heaven View this entry on the original dictionary page scan.
bhuvispṛśmfn. touching the ground View this entry on the original dictionary page scan.
bimbisāram. (from bimbin-or bimbī+s-?) Name of a king of magadha- (contemporary and patron of gautama- buddha-) (varia lectio vidhisāra-, vidmi-sāra-, vindu-sena-, vindhya-sena-) View this entry on the original dictionary page scan.
bis (or vis-) cl.4. bisyati-, to go, move ; to split or grow ; to urge on, incite ; to cast, throw View this entry on the original dictionary page scan.
bisan. (m.only ;also written vīsa-; in fine compositi or 'at the end of a compound' f(ā-).) a shoot or sucker, the film or fibre of the water-lily or lotus, also the stalk itself or that part of it which is underground (eaten as a delicacy) etc. View this entry on the original dictionary page scan.
bisan. the whole lotus plant View this entry on the original dictionary page scan.
bisābharaṇan. an ornament made of lotus-fibres, View this entry on the original dictionary page scan.
bisagranthim. a knot on a lotus-stalk (used for filtering or clearing water ) View this entry on the original dictionary page scan.
bisagranthim. a particular disease of the eyes View this entry on the original dictionary page scan.
bisaguṇamfn. (a bow) strung with a lotus fibre, View this entry on the original dictionary page scan.
bisajan. a lotus-flower View this entry on the original dictionary page scan.
bisakaṇṭhikāf. a kind of small crane View this entry on the original dictionary page scan.
bisakaṇṭhinm. a kind of small crane View this entry on the original dictionary page scan.
bisākara m. a species of Euphorbia View this entry on the original dictionary page scan.
bisākāram. a species of Euphorbia View this entry on the original dictionary page scan.
bisakhāmfn. one who digs up fibres of lotus-roots View this entry on the original dictionary page scan.
bisakhādikāf. "eating lotus-fibres", Name of a play or sport View this entry on the original dictionary page scan.
bisakisalayacchedapatheyavatmfn. having pieces of fibres of young lotus as provisions for a journey View this entry on the original dictionary page scan.
bisakusuman. a lotus-flower View this entry on the original dictionary page scan.
bisalan. a sprout, bud, young shoot View this entry on the original dictionary page scan.
bisalatāf. the lotus-plant View this entry on the original dictionary page scan.
bisalāvamind. (with -) so as to cut off like a lotus fibre, View this entry on the original dictionary page scan.
bisamṛṇalan. a lotus-fibre View this entry on the original dictionary page scan.
bisanābhif. the lotus-plant (padminī-) View this entry on the original dictionary page scan.
bisanasikāf. a kind of crane (see -kaṇṭhikā-). View this entry on the original dictionary page scan.
bisaprasūna() n. a lotus-flower. View this entry on the original dictionary page scan.
bisapuṣpa() n. a lotus-flower. View this entry on the original dictionary page scan.
bisaśālūkam. (!) a lotus-root View this entry on the original dictionary page scan.
bisatantum. a lotus-fibre View this entry on the original dictionary page scan.
bisatantumayamf(ī-)n. made of lotus-flower View this entry on the original dictionary page scan.
bisavartmann. a particular disease of the eyes, (see -granthi-) View this entry on the original dictionary page scan.
bisavati(b/isa--) f. a place abounding in lotus-fibres View this entry on the original dictionary page scan.
bisilamfn. (fr. bisa-) gaRa kāśādi-. View this entry on the original dictionary page scan.
bisinīf. a lotus (the whole plant) or an assemblage of lotus-flowers View this entry on the original dictionary page scan.
bisinīpattran. a lotus-leaf. View this entry on the original dictionary page scan.
bisorṇāf. equals bisa-mṛṇāla- View this entry on the original dictionary page scan.
bodhisaṃcodiṇīf. Name of a particular ray of light View this entry on the original dictionary page scan.
bodhisaṃcodiṇīsamuccayāf. Name of a Buddhist deity View this entry on the original dictionary page scan.
bodhisaṃghārāmam. Name of a monastery. View this entry on the original dictionary page scan.
bodhisattvam. "one whose essence is perfect knowledge", one who is on the way to the attainment of perfect knowledge (id est a Buddhist saint when he has only one birth to undergo before obtaining the state of a supreme buddha- and then nirvāṇa-) (the early doctrine had only one bodhi-sattva-, viz. maitreya-;the later reckoned many more ) View this entry on the original dictionary page scan.
bodhisattvam. Name of the principal buddha- of the present era (before he became a buddha-) View this entry on the original dictionary page scan.
bodhisattvam. of a poet View this entry on the original dictionary page scan.
bodhisattvabhūmif. Name of work View this entry on the original dictionary page scan.
bodhisattvabuddhānusmṛtisamādhim. Name of work View this entry on the original dictionary page scan.
bodhisattvacaryāf. the actions or condition of a bodhisattva- View this entry on the original dictionary page scan.
bodhisattvacaryālvatāraf. Name of work View this entry on the original dictionary page scan.
bodhisattvāṃśam. part of a bodhisattva- View this entry on the original dictionary page scan.
bodhisattvapakṣanirdeśam. Name of work View this entry on the original dictionary page scan.
bodhisattvapiṭakamn. Name of work View this entry on the original dictionary page scan.
bodhisattvatāf. the state of a bodhisattva--state, bodhi-sattva--ship View this entry on the original dictionary page scan.
bodhisattvāvadānakalpalatāf. Name of work View this entry on the original dictionary page scan.
bodhisiddhif. Name of work View this entry on the original dictionary page scan.
brahmajyotisn. the splendour of brahma- or of the Supreme Being (also written brahma-jy-) View this entry on the original dictionary page scan.
brahmajyotismfn. having the splendour of brahmā- (Scholiast or Commentator"of the presiding priest") View this entry on the original dictionary page scan.
brahmajyotism. Name of śiva- View this entry on the original dictionary page scan.
brahmaṇaspatisūktan. brahmaṇaspati
brahmayonisthamfn. brahmayoni
brāhmīśāntisaṃkalpam. Name of work View this entry on the original dictionary page scan.
bṛhacchāntistava(hac+śā-) m. the larger śānti-stava- View this entry on the original dictionary page scan.
bṛhajjyotismfn. (h/aj--) bright-shining View this entry on the original dictionary page scan.
bṛhajjyotism. Name of a grandson of brahmā- View this entry on the original dictionary page scan.
bṛhaspatisamamfn. equal to bṛhaspati-, like bṛhaspati- View this entry on the original dictionary page scan.
bṛhaspatisaṃhitāf. Name of two works. View this entry on the original dictionary page scan.
bṛhaspatisavam. Name of a festival lasting one day (said to confer the rank, of a purohita- on those observing it) View this entry on the original dictionary page scan.
bṛhaspatisavahautraprayogam. Name of work View this entry on the original dictionary page scan.
bṛhaspatisavakḷptif. Name of work View this entry on the original dictionary page scan.
bṛhaspatisavaprayogam. Name of work View this entry on the original dictionary page scan.
bṛhaspatisiddhāntam. Name of work View this entry on the original dictionary page scan.
bṛhaspatismṛtif. bṛhaspati-'s law-book. View this entry on the original dictionary page scan.
bṛhaspatistomam. Name of an ekāha- View this entry on the original dictionary page scan.
bṛhaspatistotran. Name of work View this entry on the original dictionary page scan.
bṛhaspatisuratāf. a proper N. View this entry on the original dictionary page scan.
bṛhaspatisuta(b/ṛhas-p/ati--) mfn. pressed out (as soma- juice) by bṛhas-pati- View this entry on the original dictionary page scan.
bṛhaspatisutran. Name of work View this entry on the original dictionary page scan.
buddhabhūmisūtran. buddhabhūmi
buddhisāgaram. "ocean of wisdom", Name of a man View this entry on the original dictionary page scan.
buddhisahāyam. a counsellor minister View this entry on the original dictionary page scan.
buddhisaṃkīrṇam. a kind of pavilion View this entry on the original dictionary page scan.
buddhisampannamfn. equals -yukta- View this entry on the original dictionary page scan.
buddhiskandhamayamf(ī-)n. one whose trunk or stem is the intellect View this entry on the original dictionary page scan.
buddhisthamfn. fixed in or present to the mind ( buddhisthatva -tva- n.) View this entry on the original dictionary page scan.
buddhisthatvan. buddhistha
buddhivisphuraṇam. a particular samādhi- View this entry on the original dictionary page scan.
caṇḍarocism. equals -kara- View this entry on the original dictionary page scan.
caraṇakisalayan. idem or 'n. "foot-lotus", a beautiful foot ' View this entry on the original dictionary page scan.
caturaśītisāhasramfn. numbering 84000 View this entry on the original dictionary page scan.
caturthamandrātisvāryamfn. "to be lengthened in a particular way", said of a kind of recitation of the View this entry on the original dictionary page scan.
caturviṃśatisāhasramf(ī-)n. consisting of 24000 (G) i, 4, 147 View this entry on the original dictionary page scan.
caturviṃśatismṛtif. equals -mata- View this entry on the original dictionary page scan.
cedisaṃvatsee kalacuri-- saṃvatsara-, parasmE-pada 1324. View this entry on the original dictionary page scan.
chadisn. () a cover, roof of a carriage, roof (gṛha- ) View this entry on the original dictionary page scan.
chadisn. View this entry on the original dictionary page scan.
chadisn. see chādiṣeya-. View this entry on the original dictionary page scan.
chadistṛṇan. straw for a roof, View this entry on the original dictionary page scan.
chandahānismfn. giving up one's desires (?) View this entry on the original dictionary page scan.
chardisn. (equals chad/is-) a fence, secure place or residence (gṛha- ) View this entry on the original dictionary page scan.
chardisn. View this entry on the original dictionary page scan.
chardisn. (f. ) vomition View this entry on the original dictionary page scan.
chismakam. Name of a prince, (varia lectio for śiśuka-). View this entry on the original dictionary page scan.
cintisurāṣṭram. plural the cinti-s and the inhabitants of su-rāṣṭra- gaRa kārta-kaujapādi-. View this entry on the original dictionary page scan.
citavistaram. a kind of ornament View this entry on the original dictionary page scan.
citrabarhis(tr/a--) mfn. having a brilliant bed (of stars;the moon) View this entry on the original dictionary page scan.
citrārcism. the sun View this entry on the original dictionary page scan.
citraśocis(tr/a--) mfn. shining brilliantly View this entry on the original dictionary page scan.
cittadhārābuddhisaṃku sumitā- bhyudgata-, m. Name (also title or epithet) of a tathāgata-, View this entry on the original dictionary page scan.
dadhisaktum. plural barley-meal with d/adhi-, View this entry on the original dictionary page scan.
dadhisambhavamfn. produced bya- View this entry on the original dictionary page scan.
dadhisambhavan. fresh butter View this entry on the original dictionary page scan.
dadhisamudram. the d/adhi- ocean (see -vāri-), View this entry on the original dictionary page scan.
dadhisāran. idem or 'n. fresh butter ' View this entry on the original dictionary page scan.
dadhiskandan. Name of a tīrtha- View this entry on the original dictionary page scan.
dadhisneham. equals -maṇḍa- View this entry on the original dictionary page scan.
dadhisvedam. butter-milk View this entry on the original dictionary page scan.
dadhisya+ Nom. yati- equals dhīya- View this entry on the original dictionary page scan.
dakṣiṇājyotis(d/akṣ-) mfn. brilliant by the sacrificial gift View this entry on the original dictionary page scan.
dakṣiṇāmūrtisaṃhitāf. Name of work View this entry on the original dictionary page scan.
dakṣiṇāmūrtistava m. 10 verses ascribed to śaṃkara- (explained by viśva-rūpa- or sureśvara- in a commentary with gloss by rāma-tīrtha-) View this entry on the original dictionary page scan.
dakṣiṇāmūrtistotran. 10 verses ascribed to śaṃkara- (explained by viśva-rūpa- or sureśvara- in a commentary with gloss by rāma-tīrtha-) View this entry on the original dictionary page scan.
dālbhyaparisiṣṭan. Name of work View this entry on the original dictionary page scan.
dantisthamfn. seated on an elephant View this entry on the original dictionary page scan.
daśajyotism. Name of a son of su-bhrāj- View this entry on the original dictionary page scan.
dehasiddhisādhanan. Name of work View this entry on the original dictionary page scan.
dehavisarjanan. "quitting the body", death View this entry on the original dictionary page scan.
devabodhisattvam. Name of a Buddhist saint. View this entry on the original dictionary page scan.
devahavisn. oblation to the gods View this entry on the original dictionary page scan.
dhamanisaṃtata mfn. "having the veins strained like cords", emaciated, lank View this entry on the original dictionary page scan.
dhanvantarisāranidhim. Name of work View this entry on the original dictionary page scan.
dhāraṇīmukhasarvajagatpraṇidhisaṃdhāraṇagarbham. Name of a bodhi-sattva-. View this entry on the original dictionary page scan.
dharaṇisthamfn. being or staying on earth View this entry on the original dictionary page scan.
dharaṇisutam. metron. of the planet Mars (see -ja-). View this entry on the original dictionary page scan.
dhṛtārcism. "of constant splendour", Name of viṣṇu- View this entry on the original dictionary page scan.
dhṛtisiṃham. (varia lectio ta-s-) Name of an author (said to have assisted puruṣottama- in composing the hārāvalī-) View this entry on the original dictionary page scan.
dhvanisiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
dhyānibodhisattvam. a spiritual (not material) buddha- or bodhi-sattva- View this entry on the original dictionary page scan.
dinajyotisn. daylight, sunshine View this entry on the original dictionary page scan.
dinamaṇisārathim. the sun's charioteer, aruṇa- View this entry on the original dictionary page scan.
dīrghāyuśocismfn. (gh/āyu--) shining through a long life (agni-) View this entry on the original dictionary page scan.
ditisutam. idem or 'm. equals -ja- ' View this entry on the original dictionary page scan.
ditisutagurum. the planet Venus View this entry on the original dictionary page scan.
divisadand equals -ṣ/ad- and -ṣṭha-. View this entry on the original dictionary page scan.
divispṛśmfn. heaven-touching View this entry on the original dictionary page scan.
divispṛśatmfn. idem or 'mfn. heaven-touching ' View this entry on the original dictionary page scan.
dṛṣṭisambhedam. "mixing glances", mutual glance View this entry on the original dictionary page scan.
dundubhisvanam. "drum-sound", a kind of magical formula against evil spirits supposed to possess weapons View this entry on the original dictionary page scan.
dundubhisvaram. "having drum-like voice", Name of a man View this entry on the original dictionary page scan.
dundubhisvaranirghoṣam. Name (also title or epithet) of a tathāgata-, . View this entry on the original dictionary page scan.
dundubhisvararājam. Name of several buddha-s. View this entry on the original dictionary page scan.
durabhisambhavamfn. difficult to be performed, beset with difficulties, View this entry on the original dictionary page scan.
durabhisaṃdhim. equals -abhiprāya- Scholiast or Commentator on View this entry on the original dictionary page scan.
durāśismfn. having evil wishes or intentions View this entry on the original dictionary page scan.
durokaśocismfn. glowing unpleasantly (too bright or hot) View this entry on the original dictionary page scan.
dvādaśārcism. equals śāṃśu- View this entry on the original dictionary page scan.
dvaisaṃdhyan. morning and evening twilight View this entry on the original dictionary page scan.
dvaisamikamf(ī-)n. 2 years old Va1rtt. 2 View this entry on the original dictionary page scan.
dvihavismfn. connected with 2 oblations View this entry on the original dictionary page scan.
dvijātisātind. for or to Brahmans View this entry on the original dictionary page scan.
dvisind. (; confer, compare ) twice etc. dvir ahnaḥ-, ahnā-, or ahni-, twice a day [ confer, compare Zend bis; Greek ; Latin bis.] View this entry on the original dictionary page scan.
dvisahasramfn. worth 2000 View this entry on the original dictionary page scan.
dvisahasran. vArttika (see -ṣāh-and -sāh-) View this entry on the original dictionary page scan.
dvisāhasramf(ī-)n. equals -sahasra-, View this entry on the original dictionary page scan.
dvisāhasran. 2000 View this entry on the original dictionary page scan.
dvisahasrākṣam. "the 2000-eyed one", Name of the serpent-king śeṣa- View this entry on the original dictionary page scan.
dvisamamfn. consisting of 2 equal portions View this entry on the original dictionary page scan.
dvisamamfn. having 2 equal sides View this entry on the original dictionary page scan.
dvisamacaturaśram. an isosceles quadrangle or triangle, algebra View this entry on the original dictionary page scan.
dvisamatribhujam. an isosceles quadrangle or triangle, algebra View this entry on the original dictionary page scan.
dvisaṃdhimfn. equals -ṣaṃdhi- View this entry on the original dictionary page scan.
dvisaṃdhyamfn. having a morning and an evening twilight View this entry on the original dictionary page scan.
dvisamīnamfn. 2 years old, Scholiast or Commentator View this entry on the original dictionary page scan.
dvisaṃstha mfn. standing on 2 fields View this entry on the original dictionary page scan.
dvisaṃsthitamfn. standing on 2 fields View this entry on the original dictionary page scan.
dvisāṃvatsarikamf(ī-)n. equals -saṃvatsarīṇa- View this entry on the original dictionary page scan.
dvisaṃvatsarīṇamfn. accomplished in 2 years View this entry on the original dictionary page scan.
dvisaptadhāind. in (into) 14 parts View this entry on the original dictionary page scan.
dvisaptanmfn. plural 2x7, 14 View this entry on the original dictionary page scan.
dvisaptasaṃkhyākamfn. idem or 'mfn. plural 2x7, 14 ' View this entry on the original dictionary page scan.
dvisaptatamf(ī-)n. the 72nd, chapter of View this entry on the original dictionary page scan.
dvisaptatif. 72 (see dvā-.) View this entry on the original dictionary page scan.
dvisāptatikamf(ī-)n. worth 72 View this entry on the original dictionary page scan.
dvisaptatitamamf(ī-)n. the 72nd, chapter of and View this entry on the original dictionary page scan.
dvisattvalakṣaṇan. Name of work View this entry on the original dictionary page scan.
dvisauvarṇikamfn. worth 2 suvarṇa-s vArttika View this entry on the original dictionary page scan.
dvisītyamfn. twice ploughed View this entry on the original dictionary page scan.
dvisraktimfn. 2-cornered View this entry on the original dictionary page scan.
dvisraktin. a vessel so shaped for making libations to the aśvin-s View this entry on the original dictionary page scan.
dvistanā(dv/i-.) f. having 2 udders or 2 pegs commentator or commentary (see ) . View this entry on the original dictionary page scan.
dvistanīf. having 2 udders or 2 pegs commentator or commentary (see ) . View this entry on the original dictionary page scan.
dvistāvāf. (fr. tāvat-) twice as large (a vedi-) View this entry on the original dictionary page scan.
dvisthūṇam. (sc. daṇḍa-) a particular form of military array View this entry on the original dictionary page scan.
dvisuryamfn. having 2 suns View this entry on the original dictionary page scan.
dvisuvarṇa mfn. worth 2 suvarṇa-s vArttika View this entry on the original dictionary page scan.
dvisvabhāvamfn. having a double nature or character View this entry on the original dictionary page scan.
dvisvaramfn. 2-syllabled View this entry on the original dictionary page scan.
dvisvaramfn. doubly accented View this entry on the original dictionary page scan.
dvitrisind. twice or three times View this entry on the original dictionary page scan.
dvivaistikamf(ī-)n. equals -vista- View this entry on the original dictionary page scan.
dvivistamfn. worth 2 Vistas View this entry on the original dictionary page scan.
dyotisn. light, brightness View this entry on the original dictionary page scan.
dyotisn. a star View this entry on the original dictionary page scan.
ekadaṇḍisaṃnyāsavidhim. Name of work View this entry on the original dictionary page scan.
ekajyotisn. "the only light", Name of śiva-. View this entry on the original dictionary page scan.
ekākṣaragaṇapatistotran. a hymn in honour of gaṇeśa- (a portion of the rudrayāmala-) View this entry on the original dictionary page scan.
gādhisūnum. idem or 'm. equals -ja- ' View this entry on the original dictionary page scan.
gadisiṃham. Name of a grammarian. View this entry on the original dictionary page scan.
gaṇapatistavarājam. Name of a hymn in praise of gaṇeśa- View this entry on the original dictionary page scan.
gaṇapatistotran. prayers addressed to gaṇeśa- View this entry on the original dictionary page scan.
gāndhārisaptasamam. View this entry on the original dictionary page scan.
gaṇistharājam. Name of a tree View this entry on the original dictionary page scan.
garbhaparisravam. secundines View this entry on the original dictionary page scan.
gāyatrisāram. Catechu (Terra japonica) View this entry on the original dictionary page scan.
ghanadundbhisvanamfn. deep as the sound of a drum or of a cloud, View this entry on the original dictionary page scan.
ghṛṇārcism. "having hot rays", fire (see ghṛtārc-.) View this entry on the original dictionary page scan.
ghṛtārcism. "brilliant with ghee", fire View this entry on the original dictionary page scan.
ghṛtārcism. a form of the sun View this entry on the original dictionary page scan.
girisambhavam. a kind of hill-mouse View this entry on the original dictionary page scan.
girisambhavan. bitumen View this entry on the original dictionary page scan.
girisānun. equals -prastha- View this entry on the original dictionary page scan.
girisāram. iron View this entry on the original dictionary page scan.
girisāram. tin View this entry on the original dictionary page scan.
girisāram. Name of the Malaya mountains (in the south of India) View this entry on the original dictionary page scan.
girisāramayamf(ī-)n. made of iron View this entry on the original dictionary page scan.
girisarpam. a kind of snake View this entry on the original dictionary page scan.
girisenam. Name of a man View this entry on the original dictionary page scan.
girisravāf. equals -ṇadī- View this entry on the original dictionary page scan.
giristanīf. "mountain-breasted", the earth, View this entry on the original dictionary page scan.
girisutam. "mountain-son", Name of a divine being View this entry on the original dictionary page scan.
girisutāf. (equals --) Name of pārvatī- View this entry on the original dictionary page scan.
girisutaf. (gireḥ sutā- ) View this entry on the original dictionary page scan.
girisutākāntam. " pārvatī-'s lover", Name of śiva- View this entry on the original dictionary page scan.
gītisūtran. a sūtra- composed in the gīti- metre (on ) Introd. 43. View this entry on the original dictionary page scan.
gosvāmisthānan. Name of a mountain peak in the middle of the himālaya- View this entry on the original dictionary page scan.
govisargam. (equals -sarga-) "time at which cows are let loose", day-break View this entry on the original dictionary page scan.
granthavistaram. a voluminous text View this entry on the original dictionary page scan.
granthavistaram. a multitude of grantha-s (of 32 syllables each) View this entry on the original dictionary page scan.
granthavistāram. diffuseness of style, voluminousness View this entry on the original dictionary page scan.
gūḍhārcismfn. of concealed glory View this entry on the original dictionary page scan.
guṇavistaramfn. abounding in excellent qualities View this entry on the original dictionary page scan.
guṇisarvasvan. Name of work View this entry on the original dictionary page scan.
haribhaktisamāgamam. Name of work View this entry on the original dictionary page scan.
haribhaktisāram. Name of work View this entry on the original dictionary page scan.
haribhaktisudhārasam. Name of work View this entry on the original dictionary page scan.
haribhaktisudhodayam. Name of work View this entry on the original dictionary page scan.
hārisam. or n. a particular high number View this entry on the original dictionary page scan.
harisādhanacandrikāf. Name of work View this entry on the original dictionary page scan.
harisakham. "friend of indra-", a gandharva- View this entry on the original dictionary page scan.
harisakthan. saṃjñāyām- View this entry on the original dictionary page scan.
harisaṃkīrtanan. the act of pronouncing or repeating the name of viṣṇu- (supposed to possess great efficacy) View this entry on the original dictionary page scan.
harisaṃkīrtanan. Name of work View this entry on the original dictionary page scan.
harisenam. Name of a minister of samudra-gupta- View this entry on the original dictionary page scan.
harisenam. of an author View this entry on the original dictionary page scan.
harisevakamiśram. Name of an author View this entry on the original dictionary page scan.
harisiddhif. Name of a goddess View this entry on the original dictionary page scan.
harisiṃham. Name of a king View this entry on the original dictionary page scan.
harisiṃhadevam. (śrī-hari--) Name of a king View this entry on the original dictionary page scan.
harisomam. Name of a man View this entry on the original dictionary page scan.
haristavamfn. one whose bay horses are praised View this entry on the original dictionary page scan.
haristotran. of hymns (in praise of viṣṇu-). View this entry on the original dictionary page scan.
haristutif. View this entry on the original dictionary page scan.
harisūktan. Name of a particular hymn addressed to hari- View this entry on the original dictionary page scan.
harisūnum. "son of hari-", Name of arjuna- View this entry on the original dictionary page scan.
harisutam. "son of hari-", Name of arjuna- View this entry on the original dictionary page scan.
harisutam. of the 10th cakra-vartin- (equals -ṣeṇa-) View this entry on the original dictionary page scan.
harisvāminm. Name of various men View this entry on the original dictionary page scan.
harisvāmiputram. Name of an author View this entry on the original dictionary page scan.
harṣanisvana() m. idem or '() m. idem or 'm. a shout of joy ' ' View this entry on the original dictionary page scan.
hastisenam. Name of a king View this entry on the original dictionary page scan.
hastisnānan. the washing of an elephants View this entry on the original dictionary page scan.
hastisomāf. Name of a river View this entry on the original dictionary page scan.
hastisūtran. a sūtra-. treating of elephants View this entry on the original dictionary page scan.
havisn. an oblation or burnt offering, anything offered as an oblation with fire (as clarified butter, milk, Soma, grain; haviṣ- kṛ-,"to prepare an oblation","make into an oblation") etc. View this entry on the original dictionary page scan.
havisn. water View this entry on the original dictionary page scan.
havisn. fire View this entry on the original dictionary page scan.
havisn. Name of a marutvat- (?) View this entry on the original dictionary page scan.
hiḍimbanisūdana m. "destroyer of hiḍimba-", bhīma- View this entry on the original dictionary page scan.
himagirisutāf. patronymic of pārvati- View this entry on the original dictionary page scan.
himagirisutākāntam. "loved by pārvati-", Name of śiva- View this entry on the original dictionary page scan.
himajyotismfn. cold-rayed (as the moon) View this entry on the original dictionary page scan.
himavadgirisaṃśrayam. himavadgiri
hiraṇyajyotisn. splendour of golden View this entry on the original dictionary page scan.
hiraṇyajyotismfn. having golden splendour View this entry on the original dictionary page scan.
hiraṇyakeśisūtran. Name of work View this entry on the original dictionary page scan.
hiraṇyakeśisūtravyākhyānan. Name of work View this entry on the original dictionary page scan.
hṛdispṛśmfn. touching the heart, charming, lovely View this entry on the original dictionary page scan.
hṛdispṛśamfn. idem or 'mfn. touching the heart, charming, lovely ' View this entry on the original dictionary page scan.
hṛdisthamfn. being in the heart etc. View this entry on the original dictionary page scan.
hṛdisthamfn. beloved, dear View this entry on the original dictionary page scan.
idhmābarhis([ ]) n. sg. and (iṣī-) dual number fuel and grass. View this entry on the original dictionary page scan.
illisam. idem or 'm. the fish Clupea Alosa ([ see ilīśa-]) ' View this entry on the original dictionary page scan.
indrasurisam. equals -surasa-. View this entry on the original dictionary page scan.
jahistambhamfn. constantly striking against a post (not in ) View this entry on the original dictionary page scan.
jaiminisūtran. Name of work , View this entry on the original dictionary page scan.
jaiminīyanyāyamālāvistaram. Name of a compendium of the mīmāṃsā- philosophy by mādhava-. View this entry on the original dictionary page scan.
jaladhisambhavamfn. marine View this entry on the original dictionary page scan.
jātisāṃkaryan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
jātisampannamfn. belonging to a noble family View this entry on the original dictionary page scan.
jātisāran. idem or 'n. Name (also title or epithet) of work ' View this entry on the original dictionary page scan.
jātisasyan. equals -kośa- View this entry on the original dictionary page scan.
jātismaramf(ā-)n. recollecting a former existence View this entry on the original dictionary page scan.
jātismaran. Name of a tīrtha- View this entry on the original dictionary page scan.
jātismarahradam. Name of a pond View this entry on the original dictionary page scan.
jātismaraṇan. equals ra-- View this entry on the original dictionary page scan.
jātismaratāf. recollection of a former existence View this entry on the original dictionary page scan.
jātismaratvan. idem or 'f. recollection of a former existence ' View this entry on the original dictionary page scan.
jātisvabhāvam. specific or generic character or nature, View this entry on the original dictionary page scan.
jayāśisf. cheer of victory View this entry on the original dictionary page scan.
jayāśisf. a prayer for victory View this entry on the original dictionary page scan.
jīvabarhis(v/a-.) mfn. having a fresh bed of sacrificial grass View this entry on the original dictionary page scan.
jyotisn. light (of the sun, dawn, fire, lightning, etc.;also plural), brightness (of the sky) etc. (tr/īṇi jy/otīṃṣi-,light appearing in the 3 worlds, viz. on earth, in the intermediate region, and in the sky or heaven [the last being called uttam/a- ;or /uttara-, ;or tṛt/īya- ] ;also personified as"fire"on earth,"ether or air"in the intermediate region, and"sun"in the sky ;"fire, sun and moon") View this entry on the original dictionary page scan.
jyotisn. fire, flash of lightning View this entry on the original dictionary page scan.
jyotisn. moonlight View this entry on the original dictionary page scan.
jyotisn. (plural) View this entry on the original dictionary page scan.
jyotisn. eye-light View this entry on the original dictionary page scan.
jyotisn. the eye View this entry on the original dictionary page scan.
jyotisn. dual number sun and moon View this entry on the original dictionary page scan.
jyotisn. plural the heavenly bodies, planets and stars etc. (tiṣām ayana- n. course or movements of the heavenly bodies, science of those movements ([ equals tiṣa-]) ) View this entry on the original dictionary page scan.
jyotisn. sg. the light of heaven, celestial world View this entry on the original dictionary page scan.
jyotisn. light as the divine principle of life or source of intelligence, intelligence View this entry on the original dictionary page scan.
jyotisn. (pauruṣaj-"human intelligence") View this entry on the original dictionary page scan.
jyotisn. (para jyotis-,"highest light or truth") and View this entry on the original dictionary page scan.
jyotisn. light as the type of freedom or bliss or victory (confer, compare , and Latin lux) View this entry on the original dictionary page scan.
jyotisn. Name of several ekāha-s etc. View this entry on the original dictionary page scan.
jyotisn. of certain formularies containing the word jyotis- View this entry on the original dictionary page scan.
jyotisn. a metre of 32 short and 16 long syllables View this entry on the original dictionary page scan.
jyotisn. equals tiṣa-, science of the movements of the heavenly bodies View this entry on the original dictionary page scan.
jyotisn. a mystical N. for the letter r- View this entry on the original dictionary page scan.
jyotism. fire View this entry on the original dictionary page scan.
jyotism. the sun View this entry on the original dictionary page scan.
jyotism. Trigonella foenum graecum View this entry on the original dictionary page scan.
jyotism. Name of a marut- View this entry on the original dictionary page scan.
jyotism. of a son of manu- svārociṣa-, 429 View this entry on the original dictionary page scan.
jyotism. of a prajā-pati- View this entry on the original dictionary page scan.
jyotism. see d/akṣiṇā--, śukr/a--, sa--, h/iraṇya--, etc. View this entry on the original dictionary page scan.
jyotissātkṛ equals tiṣ-- View this entry on the original dictionary page scan.
jyotistattvan. equals tiṣa-t- View this entry on the original dictionary page scan.
kalacurisaṃvatsara(= cedi-- saṃvat-), a year of the kalacuri- (or cedi-) era (beginning on September 5, D. 348). View this entry on the original dictionary page scan.
kalisaṃśrayam. the act of betaking one's self to kali-. View this entry on the original dictionary page scan.
kalisaṃtaraṇan. Name of an upaniṣad-. View this entry on the original dictionary page scan.
kalistomam. a particular stoma-. View this entry on the original dictionary page scan.
kāmāgnisaṃdīpanan. kindling the fire of lust, excitement of sexual love. View this entry on the original dictionary page scan.
kāṇḍavisargam. the completion of (the study of) a kāṇḍa-, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
kapardisvāminm. Name of an author. View this entry on the original dictionary page scan.
kapiskandham. Name of a dānava- View this entry on the original dictionary page scan.
kapiskandham. of a being in the retinue of skanda- View this entry on the original dictionary page scan.
kapisthalan. the abode of an ape on View this entry on the original dictionary page scan.
kapisvaram. Name of a man. View this entry on the original dictionary page scan.
karakisalayam. n. "hand-bud", the hand closed in the form of a bud View this entry on the original dictionary page scan.
karakisalayam. "hand-shoot", the finger View this entry on the original dictionary page scan.
kariskandham. a herd of elephants on View this entry on the original dictionary page scan.
karisundarikāf. a gauge, water-mark View this entry on the original dictionary page scan.
kārtisiṃhadevam. Name of a man. View this entry on the original dictionary page scan.
kāruṇyalaharistavam. Name (also title or epithet) of work View this entry on the original dictionary page scan.
kastūrismṛtif. smṛtiśekhara
katisaṃkhyamfn. how many in number? View this entry on the original dictionary page scan.
kaṭisthamfn. borne on the hip or in arms, View this entry on the original dictionary page scan.
kaṭisūtran. a zone or waistband, girdle View this entry on the original dictionary page scan.
kelisacivam. minister of the sports, master of the revels View this entry on the original dictionary page scan.
kelisadanan. equals -gṛha- View this entry on the original dictionary page scan.
kelisāram. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
kelisthalīf. a place of pleasure, play-ground, . View this entry on the original dictionary page scan.
kesarisutam. "son of kesarin-", Name of hanumat- View this entry on the original dictionary page scan.
keśisūdanam. idem or 'm. idem or 'm. "slayer of the asura- keśin-", kṛṣṇa- (varia lectio -nisūdana-).' ' View this entry on the original dictionary page scan.
kevalabarhis(k/ev-) mfn. having its own sacrificial straw View this entry on the original dictionary page scan.
khajyotism. a shining flying insect, fire-fly etc. View this entry on the original dictionary page scan.
khaṇḍasphuṭapratisaṃskaraṇan. repairing of dilapidations View this entry on the original dictionary page scan.
khaṇḍasphuṭapratisaṃskaraṇan. (pāli- ṇḍa-phulla--.) View this entry on the original dictionary page scan.
kikkisam. idem or 'm. a kind of worm (pernicious to the hair, nails, and teeth) ' View this entry on the original dictionary page scan.
kikkisādam. "eating the kikkisa-", a species of snake View this entry on the original dictionary page scan.
kiṃjyotis(k/iṃ--) mfn. having which light? View this entry on the original dictionary page scan.
kīrtisāram. Name of a man View this entry on the original dictionary page scan.
kīrtisenam. Name of a nephew of the serpent-king vāsuki- View this entry on the original dictionary page scan.
kīrtisiṃhadevam. Name of a man. View this entry on the original dictionary page scan.
kīrtisomam. Name of a man View this entry on the original dictionary page scan.
kīrtistambham. a column of fame View this entry on the original dictionary page scan.
kisind. (fr. 1. ki- see n/akis-, m/ākis-), a particle of interrogation,"whether" ([ equals kartṛ-,"a doer" ]) View this entry on the original dictionary page scan.
kisam. Name of an attendant of the sun View this entry on the original dictionary page scan.
kisalamn. equals kisalaya-1. View this entry on the original dictionary page scan.
kisalayan. [ as- m. ] a sprout or shoot, the extremity of a branch bearing new leaves View this entry on the original dictionary page scan.
kisalayaNom. P. yati-, to cause to shoot or spring forth View this entry on the original dictionary page scan.
kisalayakarāf. (a woman) having hands as tender as buds commentator or commentary View this entry on the original dictionary page scan.
kisalayitamfn. (gaRa tārakādi-) furnished with leaf-buds or young shoots View this entry on the original dictionary page scan.
kolisarpam. plural Name of a degraded warrior-tribe (varia lectio -sparśa-). View this entry on the original dictionary page scan.
kolisparśaSee -sarpa-. View this entry on the original dictionary page scan.
koṭisthāf. Name of the tutelar deity of the family of cyāvāna- View this entry on the original dictionary page scan.
kravisn. raw flesh, carrion, View this entry on the original dictionary page scan.
kravisn. ([ confer, compare Greek ; Latin cruor,cruentus,cru1dus,caro; Lithuanian krauja-s,"blood"; Russian krovj; Hibernian or Irish cru; Old German hreo.]) View this entry on the original dictionary page scan.
kṛmisarārīf. a kind of venomous insect
kṛmisenam. Name of a yakṣa- View this entry on the original dictionary page scan.
kṛmisūf. equals -śukti- View this entry on the original dictionary page scan.
kṛmisūtran. Name of a particular disease. View this entry on the original dictionary page scan.
kṛṣisaṃgraham. Name of work (said to be written by parāśara-). View this entry on the original dictionary page scan.
kṛṣisaṃśita(ṣ/i--) mfn. stirred up by ploughing View this entry on the original dictionary page scan.
kṛṣisevāf. agriculture View this entry on the original dictionary page scan.
kṛṣṇārcism. "dark-flamed (through smoke)", fire View this entry on the original dictionary page scan.
kṛṣṇavyathis(ṣṇ/a--) mfn. one whose path is black (said of agni-) View this entry on the original dictionary page scan.
kṛtābhisaraṇaveṣamfn. attired in the dress of a maiden who goes to meet her lover View this entry on the original dictionary page scan.
kṛtavismayamfn. astonished View this entry on the original dictionary page scan.
kṛtavismayamfn. astonishing. View this entry on the original dictionary page scan.
kṛtisādhyatvan. the state of being accomplished by exertion. View this entry on the original dictionary page scan.
kṛtoccaisind. raised on high (?) see gaRa svar-ādi- and View this entry on the original dictionary page scan.
kṣemaisind. instrumental case plural idem or 'm. (in fine compositi or 'at the end of a compound' with yathā- )' View this entry on the original dictionary page scan.
kṣemārcis varia lectio for ma-jit- q.v View this entry on the original dictionary page scan.
kṣīrasarpisn. equals -ghṛta- View this entry on the original dictionary page scan.
kṣitispṛśm. an inhabitant of the earth View this entry on the original dictionary page scan.
kṣitisuram. equals -deva-. View this entry on the original dictionary page scan.
kṣitisutam. (equals -ja-) the planet Mars View this entry on the original dictionary page scan.
kṣitisutam. Name of the demon naraka- View this entry on the original dictionary page scan.
kulmalabarhism. idem or 'm. Name of a Vedic poet (author of ) ' View this entry on the original dictionary page scan.
kumbhasarpisn. butter placed in a jar View this entry on the original dictionary page scan.
kuntisurāṣṭram. plural the kunti-s and the inhabitants of surāṣṭra- gaRa kārtakaujapādi-. View this entry on the original dictionary page scan.
kuruvistam. a pala- of gold (in weight equal to about 700 troy grains) = View this entry on the original dictionary page scan.
laghulalitavistaram. Name of work View this entry on the original dictionary page scan.
lakṣmisampannamfn. possessed of good fortune View this entry on the original dictionary page scan.
lalitavistaram. Name of a sūtra- work giving a detailed account of the artless and natural acts in the life of the buddha-. View this entry on the original dictionary page scan.
lalitavistarapurāṇan. Name of a sūtra- work giving a detailed account of the artless and natural acts in the life of the buddha-. View this entry on the original dictionary page scan.
laugākṣismṛtif. Name of work View this entry on the original dictionary page scan.
lauhābhisārikāprayogam. Name of work View this entry on the original dictionary page scan.
liṅgaviseṣaṇan. Name of work View this entry on the original dictionary page scan.
lipisajjāf. implements or materials for writing View this entry on the original dictionary page scan.
lipisaṃkhyāf. a number of written characters View this entry on the original dictionary page scan.
lipisaṃnāham. "writing belt", a belt worn on the fore-arm View this entry on the original dictionary page scan.
lohābhisāram. Name of a military ceremony performed on the 10th day after the nīrājana- View this entry on the original dictionary page scan.
lohābhisāram. equals next (see lauhābhisārikā-prayoga-). View this entry on the original dictionary page scan.
lohitārcism. "red-rayed", the planet Mars View this entry on the original dictionary page scan.
lokavisargam. the end of the world View this entry on the original dictionary page scan.
lokavisargam. the creation of the world View this entry on the original dictionary page scan.
lokavisargikamf(ī-)n. bringing about or leading to the creation of the world View this entry on the original dictionary page scan.
lokavisarginmfn. creating the world View this entry on the original dictionary page scan.
lokavistāram. universal spreading, general extension or diffusion on (varia lectio loke v-). View this entry on the original dictionary page scan.
luptāhatavisargamfn. having visarga- dropped or coalesced (with a preceding a) into o- ( luptāhatavisargatā -- f.) View this entry on the original dictionary page scan.
luptāhatavisargatāf. luptāhatavisarga
luptavisargamfn. dropping the visarga- View this entry on the original dictionary page scan.
luptavisargan. equals next View this entry on the original dictionary page scan.
luptavisargakan. () View this entry on the original dictionary page scan.
luptavisargatāf. () absence of visarga-. View this entry on the original dictionary page scan.
madhurālāpanisargapaṇḍitamfn. madhurālāpa
madhuranisvanamf(ā-)n. sweet-voiced View this entry on the original dictionary page scan.
madhusarpisn. dual number honey and ghee View this entry on the original dictionary page scan.
madhyākṣaravistaralipif. Name of a particular kind of written character View this entry on the original dictionary page scan.
madhyamoccaistaramf(ā-)n. half loud and very loud View this entry on the original dictionary page scan.
madhyejyotisf. a kind of Vedic metre View this entry on the original dictionary page scan.
mahābhisyandinmfn. (bh-) generating hypertrophy (superl. di-tama-) View this entry on the original dictionary page scan.
mahābhisyanditamatvan. state of hypertrophy View this entry on the original dictionary page scan.
mahābhisyanditvan. state of hypertrophy View this entry on the original dictionary page scan.
mahābodhisaṃghārāmam. Name of a Buddhist monastery View this entry on the original dictionary page scan.
mahāgaṇapatisahasranāmastotran. Name of work View this entry on the original dictionary page scan.
mahāgaṇapatistavarājam. Name of work View this entry on the original dictionary page scan.
mahāgaṇapatistotran. Name of work View this entry on the original dictionary page scan.
mahāgnisarvasvan. Name of work View this entry on the original dictionary page scan.
mahāhavisn. the principal oblation at the sākam-edha- sacrifice View this entry on the original dictionary page scan.
mahāhavisn. clarified butter View this entry on the original dictionary page scan.
mahāhavisn. Name of śiva- (see havis-) View this entry on the original dictionary page scan.
mahāhavism. Name of a hotṛ- View this entry on the original dictionary page scan.
mahājyotism. "having great splendour", Name of śiva- View this entry on the original dictionary page scan.
mahāmantrādisevāprakāram. Name of work View this entry on the original dictionary page scan.
mahāmunisvādhyāyam. Name of work View this entry on the original dictionary page scan.
mahārcis(r-) mfn. having great flames, flaming high View this entry on the original dictionary page scan.
mahauṣadhisūktan. Name of View this entry on the original dictionary page scan.
mahāvistaramfn. very extensive or copious View this entry on the original dictionary page scan.
mahītalavisarpinm. "earth-walker", an inhabitant of the earth View this entry on the original dictionary page scan.
makārādisahasranāmann. Name of chapter of the rudra-yāmala- (containing 1000 names of rāma- beginning with m-). View this entry on the original dictionary page scan.
mākis(m/ā--) ind. (only in prohibitive sentences with subjunctive) may not or let not (= Latin ne) ; may no one (=ne-quis) View this entry on the original dictionary page scan.
malavisargam. () () the act of removing dirt, cleansing (of a temple) View this entry on the original dictionary page scan.
malavisargam. evacuation of feces. View this entry on the original dictionary page scan.
malavisarjanan. () the act of removing dirt, cleansing (of a temple) View this entry on the original dictionary page scan.
malavisarjanan. evacuation of feces. View this entry on the original dictionary page scan.
mallārisahasranāmann. Name of work View this entry on the original dictionary page scan.
mandaśisiramfn. slightly cool View this entry on the original dictionary page scan.
mandavisarpam. Name of a snake (see next; varia lectio manda-viṣa-). View this entry on the original dictionary page scan.
mandavisarpinmfn. creeping slowly View this entry on the original dictionary page scan.
mandavisarpiṇīf. Name of a louse View this entry on the original dictionary page scan.
maṅgalapratisaram. equals -sūtra-, View this entry on the original dictionary page scan.
maṅgalapratisaram. the cord of an amulet View this entry on the original dictionary page scan.
māṇikyamisram. Name of a man View this entry on the original dictionary page scan.
maṇisānum. "jewel-ridged", Name of mount meru- View this entry on the original dictionary page scan.
maṇisaram. a string or ornament of pearls (wrong reading -śara-; see muktā-m-). View this entry on the original dictionary page scan.
maṇisāram. or n. (?) , Name of a nyāya- work View this entry on the original dictionary page scan.
maṇisāradarpaṇam. Name of work View this entry on the original dictionary page scan.
maṇisārakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
maṇisāraprāmāṇyavādam. Name of work View this entry on the original dictionary page scan.
maṇisaupāna(!) m. a staff or stick set with jewel View this entry on the original dictionary page scan.
maṇiskandham. Name of a snake-demon (varia lectio maṇi-and skandha-as 2 names) . View this entry on the original dictionary page scan.
maṇisopānan. steps or stairs formed of jewel or crystal View this entry on the original dictionary page scan.
maṇisopānan. a chain of golden beads View this entry on the original dictionary page scan.
maṇisrajf. a garland of jewel View this entry on the original dictionary page scan.
maṇistambham. a crystal post or column View this entry on the original dictionary page scan.
maṇisūtran. a string of pearls View this entry on the original dictionary page scan.
maṇisvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
manojyotis(m/ano--) mfn. one whose light is the intellect View this entry on the original dictionary page scan.
manthiśocis(manth/i--) mfn. sparkling like mixed soma- View this entry on the original dictionary page scan.
mantrajyotisn. Name of work View this entry on the original dictionary page scan.
mantrisūnum. equals -putra- View this entry on the original dictionary page scan.
mantrisuta m. equals -putra- View this entry on the original dictionary page scan.
marīcismṛtif. Name of work View this entry on the original dictionary page scan.
mātalisārathim. "having mātali- for his charioteer", Name of indra- View this entry on the original dictionary page scan.
matisacivam. a wise counsellor, View this entry on the original dictionary page scan.
mātrādisrāddhanirṇaya(trād-), m. Name of work View this entry on the original dictionary page scan.
maunisthalikamfn. (fr. muni-sthala-) gaRa kumudādi-. View this entry on the original dictionary page scan.
meghadundubhisvararājam. Name of a buddha- View this entry on the original dictionary page scan.
meghajyotisn. "drink-light", lightning, a flash of lightning View this entry on the original dictionary page scan.
meghavisphūrjitan. the rumbling of cloud, thundering View this entry on the original dictionary page scan.
meghavisphūrjitāf. a particular metre View this entry on the original dictionary page scan.
mis cl.4 P. m/isyati- to go View this entry on the original dictionary page scan.
misaram. or n. (perhaps = $ misr-, Egypt?) Name of a place (see miśara-.) View this entry on the original dictionary page scan.
misaruName of a place View this entry on the original dictionary page scan.
misarumiśram. Name of an author (14th cent.) View this entry on the original dictionary page scan.
misif. (only ) Anethum Sowa and Panmori View this entry on the original dictionary page scan.
misif. Nardostachys Jatamansi View this entry on the original dictionary page scan.
misiajamodāf. equals uśīrī- (see miśi-). View this entry on the original dictionary page scan.
misrSee miśr-, . View this entry on the original dictionary page scan.
mitraśis(fr. śās-; see āśis-) mfn. on View this entry on the original dictionary page scan.
mṛtisādhanamfn. causing death View this entry on the original dictionary page scan.
muhukaisind. muhuka
muhūrtacintāmaṇisāram. muhūrtacintāmaṇi
muhūrtacintāmaṇisāriṇīf. muhūrtacintāmaṇi
muhūrtakalpadrumīyasaṃkrāntisaṃjñākusuman. muhūrtakalpadruma
muhustanaisind. at repeated intervals, repeatedly, constantly
mukhārcisn. "mouth -flame", hot breath (?) View this entry on the original dictionary page scan.
muktāmaṇisaram. a string of pearls View this entry on the original dictionary page scan.
muktisaptaśatīf. Name of work View this entry on the original dictionary page scan.
muktisāram. Name of work View this entry on the original dictionary page scan.
muktisenam. Name of a man View this entry on the original dictionary page scan.
muktisopānan. Name of work View this entry on the original dictionary page scan.
mūlakādisutamn. and f(ā-). gruel made of the root of mūlaka- View this entry on the original dictionary page scan.
munisattran. Name of a particular iṣṭi- View this entry on the original dictionary page scan.
munisevitam. a kind of wild grain or rice View this entry on the original dictionary page scan.
munisthala gaRa kumudādi-. View this entry on the original dictionary page scan.
munisthānan. an abode of muni-s or ascetics View this entry on the original dictionary page scan.
munisutam. equals -putra- View this entry on the original dictionary page scan.
munisuvratam. (with jaina-s) Name of the 12th arhat- of the past and the 20th of the present avasarpiṇī- View this entry on the original dictionary page scan.
mūrdhajyotisn. equals brahma-randhra- View this entry on the original dictionary page scan.
mūrtisaṃcaramfn. going about with a body, embodied, incarnate, View this entry on the original dictionary page scan.
mūrtisaṃcāramfn. equals -dhara- View this entry on the original dictionary page scan.
mūrtisanāthamfn. (in fine compositi or 'at the end of a compound') possessing an idol of. View this entry on the original dictionary page scan.
mūrtisevanan. (in fine compositi or 'at the end of a compound') worship of the idol of View this entry on the original dictionary page scan.
mūṣikanirviseṣamfn. not differing from a mouse. View this entry on the original dictionary page scan.
muṣṭistham. or n. (?) a kind of game View this entry on the original dictionary page scan.
muṣṭivisargam. the opening of the fist or closed hand View this entry on the original dictionary page scan.
nais vṛddhi- form of nis- in compound View this entry on the original dictionary page scan.
naisargamfn. innate, natural View this entry on the original dictionary page scan.
naisargikamfn. idem or 'mfn. innate, natural ' View this entry on the original dictionary page scan.
naisargikamfn. wrong reading for naiḥ-s- q.v View this entry on the original dictionary page scan.
naisargikadaśakan. Name of work View this entry on the original dictionary page scan.
naisarpam. (fr. unused ni-s-) Name of one of the 9 treasures (with jaina-s). View this entry on the original dictionary page scan.
naisnehya wrong reading for naiḥsn- and -svya-. View this entry on the original dictionary page scan.
naistriṃśikamfn. armed with a sword
naisvya wrong reading for naiḥsn- and -svya-. View this entry on the original dictionary page scan.
nakiṃcidapisaṃkalpam. no desire for anything View this entry on the original dictionary page scan.
nakisind. (n/a--) no one, nobody View this entry on the original dictionary page scan.
nakisind. equals next (gaRa di-; see ) . View this entry on the original dictionary page scan.
nakṣatrakāntivistāram. the white yāvanāla- flower. View this entry on the original dictionary page scan.
nāmavismṛtif. forgetting the name (of any one) View this entry on the original dictionary page scan.
namucisūdanam. "destroyer of namuci-" idem or '() m. "hater or killer of namuci-", Name of indra-.' View this entry on the original dictionary page scan.
namucisūdanasārathim. indra-'s charioteer mātali- View this entry on the original dictionary page scan.
nandisenam. Name of an attendant of skanda- View this entry on the original dictionary page scan.
nandisvāminm. Name of a grammarian View this entry on the original dictionary page scan.
nārāyaṇabalisamarthanan. nārāyaṇabali
nārāyaṇabalisvayamprayojanasañcikāf. nārāyaṇabali
nāsāpaisrāvam. "nose-flow", running at the nose View this entry on the original dictionary page scan.
naṣṭāptisūtran. "line or series of lost property", booty View this entry on the original dictionary page scan.
nātiparisphuṭamfn. not fully displayed View this entry on the original dictionary page scan.
nātisamañjasamf(ā-or ī-)n. not quite right or proper View this entry on the original dictionary page scan.
nātisāndramfn. not too tough View this entry on the original dictionary page scan.
nātisvalpamfn. not too short View this entry on the original dictionary page scan.
nātisvasthamfn. not very well View this entry on the original dictionary page scan.
nātivistārasaṃkaṭamfn. neither too wide nor too narrow View this entry on the original dictionary page scan.
nātivistārasaṃkaṭamfn. neither too wide nor too narrow View this entry on the original dictionary page scan.
navārcisn. equals nava-dīdhiti- View this entry on the original dictionary page scan.
navasaṃyojanavisaṃyojanakam. Name of buddha- View this entry on the original dictionary page scan.
nemisvanam. equals -ghoṣa- View this entry on the original dictionary page scan.
neṣatamaisind. neṣa
nīcaisind. low, below, down, downwards, underneath etc. View this entry on the original dictionary page scan.
nīcaisind. also used adjectively exempli gratia, 'for example' nīcair adṛśyata-, he appeared lower or shorter View this entry on the original dictionary page scan.
nīcaisind. see uccais- (nīcair nīcais-tarām-,deeper and deeper ) View this entry on the original dictionary page scan.
nīcaisind. humbly, modestly View this entry on the original dictionary page scan.
nīcaisind. softly, gently View this entry on the original dictionary page scan.
nīcaisind. in a low or deep tone View this entry on the original dictionary page scan.
nīcaisind. Name of a mountain (called also vāmana-giri-or kharva-) View this entry on the original dictionary page scan.
nīcaistanamfn. low, View this entry on the original dictionary page scan.
nīcaistarāmind. lower, deeper, softer, gentler View this entry on the original dictionary page scan.
nīcakaisind. low, below, little ( ) View this entry on the original dictionary page scan.
nimnaisind. nimna
nirabhisaṃdhānan. absence of design, sāṃkhya-s. Scholiast or Commentator View this entry on the original dictionary page scan.
nirabhisaṃdhinmfn. free from egoistic designs View this entry on the original dictionary page scan.
nirāśismfn. hopeless, despairing etc. ( nirāśīstva śīs-tva- n. ) View this entry on the original dictionary page scan.
nirāśismfn. free from desire, indifferent, View this entry on the original dictionary page scan.
nirāśismfn. without a blessing View this entry on the original dictionary page scan.
niratisayatvan. niratiśaya
nirayāvalisūtran. Name of work View this entry on the original dictionary page scan.
nirgranthisiratāf. the having veins without knots (one of the 80 minor marks of a buddha-), View this entry on the original dictionary page scan.
nirjyotismfn. lightless, dark View this entry on the original dictionary page scan.
nirvisargamfn. without visarga- View this entry on the original dictionary page scan.
nirvṛtisthānan. place of eternal bliss (wrong reading nir-vṛtti-). View this entry on the original dictionary page scan.
nisind. out, forth, away etc. (rarely used as an independent word[ exempli gratia, 'for example' ],but mostly as a prefix to verbs and their derivatives[ see niḥ-- kṣi-etc. below], or to nouns not immediately connected with verbs, in which case it has the sense,"out of","away from"[ see nirvana-, niṣ-kauśāmbi-etc.] or that of a privative or negative adverb= a-3,"without","destitute of","free from","un-"[ see nir-artha-, nir-mala-etc.], or that of a strengthening particle"thoroughly","entirely","very"[ see nih-śūnya-, niṣ-kevala-, nir-muṇḍa-];it is liable to be changed to niḥ-, nir-, niś-, niṣ-,and -; see above and below).
nisSee . View this entry on the original dictionary page scan.
nisaṃjña wrong reading for niḥ-s-. View this entry on the original dictionary page scan.
nisaṃkakṣa wrong reading for niḥ-s-. View this entry on the original dictionary page scan.
nisampātam. equals niḥ-s- View this entry on the original dictionary page scan.
nisandim. Name of a daitya- View this entry on the original dictionary page scan.
nisara( sṛ-)
nisāra( sṛ-?) equals saṃgha-, sāra-, or nyāya-dātavya-vitta- (prob. wrong reading for ni-kara-). View this entry on the original dictionary page scan.
nisargam. ( sṛj-) evacuation, voiding excrement View this entry on the original dictionary page scan.
nisargam. giving away, granting, bestowing, a favour or grant etc. View this entry on the original dictionary page scan.
nisargam. relinquishing, abandoning View this entry on the original dictionary page scan.
nisargam. creation View this entry on the original dictionary page scan.
nisargam. natural state or condition or form or character, nature (nisarga- in the beginning of a compound, nisargeṇa geṇa- ind., nisargāt gāt- ind.,or nisargatas ga-tas- nature, naturally, spontaneously) View this entry on the original dictionary page scan.
nisargabhāvam. natural state or condition View this entry on the original dictionary page scan.
nisargabhinnamfn. naturally distinct View this entry on the original dictionary page scan.
nisargajamfn. innate, inborn, produced at creation, natural View this entry on the original dictionary page scan.
nisarganipuṇamfn. naturally clever View this entry on the original dictionary page scan.
nisargapadvamf(ī-)n. naturally inclined to, feeling attracted towards (locative case) View this entry on the original dictionary page scan.
nisargaśālīnamfn. naturally timid or modest View this entry on the original dictionary page scan.
nisargasauhṛdan. natural friendship, friendship from infancy View this entry on the original dictionary page scan.
nisargasiddhamfn. effected by nature, natural View this entry on the original dictionary page scan.
nisargātind. nisarga
nisargatasind. nisarga
nisargavinītamfn. naturally discreet View this entry on the original dictionary page scan.
nisargeṇaind. nisarga
nisarpaSee naisarpa-. View this entry on the original dictionary page scan.
nisevitavya wrong reading for ni--. View this entry on the original dictionary page scan.
nisindhu m. Vitex Negundo (see sindhu-, sindhu-vāra-). View this entry on the original dictionary page scan.
nisindhukam. Vitex Negundo (see sindhu-, sindhu-vāra-). View this entry on the original dictionary page scan.
nisnātamfn. See View this entry on the original dictionary page scan.
nisnātaSee ni-ṣṇā-. View this entry on the original dictionary page scan.
nisnāvam. ( snu-?) residue of articles etc. after a sale or market View this entry on the original dictionary page scan.
nisneha wrong reading for nīḥ-sneha-. View this entry on the original dictionary page scan.
nispanda= 1. 2. ni-ṣpanda- View this entry on the original dictionary page scan.
nispandaalso wrong reading for ni-syanda-. View this entry on the original dictionary page scan.
niṣpatisutāf. having no husband and no sons View this entry on the original dictionary page scan.
nispṛhmfn. ( spṛh-) greedy for, desirous of (locative case) (Nominal verb -sp/ṛk-). View this entry on the original dictionary page scan.
nispṛha wrong reading for niḥ-spṛha-. View this entry on the original dictionary page scan.
nispṛśP. -spṛśati- (Vedic infinitive mood -sp/ṛśe-), to touch softly, caress, fondle View this entry on the original dictionary page scan.
nisrava(also for niḥ-sr-) m. flowing down or out, stream, torrent View this entry on the original dictionary page scan.
nisrāvam. idem or '(also for niḥ-sr-) m. flowing down or out, stream, torrent ' View this entry on the original dictionary page scan.
nisrāvam. the scum of boiled rice (see niḥ-sr-). View this entry on the original dictionary page scan.
nisṛṣṭamfn. hurled, thrown, cast View this entry on the original dictionary page scan.
nisṛṣṭamfn. sent forth, dismissed, set free View this entry on the original dictionary page scan.
nisṛṣṭamfn. allowed, authorized View this entry on the original dictionary page scan.
nisṛṣṭamfn. kindled (as fire) intrusted, committed, transferred, granted, bestowed View this entry on the original dictionary page scan.
nisṛṣṭamfn. fabricated or made of (instrumental case) View this entry on the original dictionary page scan.
nisṛṣṭamfn. equals madhya-stha- View this entry on the original dictionary page scan.
nisṛṣṭaSee above. View this entry on the original dictionary page scan.
nisṛṣṭārthamf(ā-)n. intrusted with something, authorized View this entry on the original dictionary page scan.
nisṛṣṭārtham. a charge d'affaires, agent, messenger View this entry on the original dictionary page scan.
nisṛṣṭavatmfn. one who has granted or bestowed View this entry on the original dictionary page scan.
nisṛtamfn. (prob. mc. for niḥs-, sṛ-) gone away, disappeared View this entry on the original dictionary page scan.
nisṛtamfn. come forth id est unsheathed (as a sword) View this entry on the original dictionary page scan.
nisṛtāf. Ipomoea Turpethum View this entry on the original dictionary page scan.
nisṛtamfn. Name of a river (varia lectio niś-citā-). View this entry on the original dictionary page scan.
nisruA1. -sravate- (also for niḥ-sr-), to flow down or forth, spring or arise from (ablative) : Causal to make water flow down from (accusative) upon (locative case) View this entry on the original dictionary page scan.
nisruta(or niḥ-sr-?) mfn. flowed down or out View this entry on the original dictionary page scan.
nistabdhamfn. ( stabh-) paralyzed, numbed View this entry on the original dictionary page scan.
nistabdhamfn. stopped, fixed (See a-nist-). View this entry on the original dictionary page scan.
nistakṣP. -takṣati- (2. plural Aorist -ataṣṭa-), to carve out, fashion, create, form, make from (ablative) ; to cut, wound (by insults) View this entry on the original dictionary page scan.
nistalamfn. not flat, round, globular View this entry on the original dictionary page scan.
nistalamfn. trembling, moving View this entry on the original dictionary page scan.
nistalamfn. down, below View this entry on the original dictionary page scan.
nistamaskamfn. free from darkness, not gloomy, light View this entry on the original dictionary page scan.
nistambhamfn. equals niḥ-st-. View this entry on the original dictionary page scan.
nistambhaSee niḥ-st-. View this entry on the original dictionary page scan.
nistamisramfn. idem or 'mfn. free from darkness, not gloomy, light ' , Prasann. View this entry on the original dictionary page scan.
nistandramfn. not lazy, fresh, healthy View this entry on the original dictionary page scan.
nistandratāf. View this entry on the original dictionary page scan.
nistandri (Nominal verb īs-) mfn. idem or 'f. ' View this entry on the original dictionary page scan.
nistandrī(Nominal verb īs-) mfn. idem or ' (Nominal verb īs-) mfn. idem or 'f. ' ' View this entry on the original dictionary page scan.
nistanīf. (fr. stana-,"breast?") a pill, bolus, a sort of force-meat ball View this entry on the original dictionary page scan.
nistāntavamfn. not wearing a woven garment View this entry on the original dictionary page scan.
nistantra wrong reading for View this entry on the original dictionary page scan.
nistantumfn. having no offspring, childless View this entry on the original dictionary page scan.
nistapSee niṣ-ṭap-. View this entry on the original dictionary page scan.
nistāram. crossing, passing over, rescue, deliverance View this entry on the original dictionary page scan.
nistāram. acquittance, requital, payment, discharge of a debt View this entry on the original dictionary page scan.
nistāram. means, expedient View this entry on the original dictionary page scan.
nistāram. final liberation View this entry on the original dictionary page scan.
nistārabījan. a means of crossing (the ocean of life), a cause of final liberation View this entry on the original dictionary page scan.
nistārakamf(ikā-)n. rescuing, delivering, a saviour View this entry on the original dictionary page scan.
nistaraṃgamf(ā-)n. motionless, still View this entry on the original dictionary page scan.
nistaraṇa nis-tāra- etc. See nis-tṝ-. View this entry on the original dictionary page scan.
nistaraṇan. passing over, going forth, coming out (of danger), rescue, deliverance View this entry on the original dictionary page scan.
nistaraṇan. a means of success or rescue View this entry on the original dictionary page scan.
nistāraṇan. (fr. Causal) crossing, passing over, overcoming View this entry on the original dictionary page scan.
nistāraṇan. rescuing, liberating View this entry on the original dictionary page scan.
nistaraṇīya() mfn. to be passed over or overcome or conquered. View this entry on the original dictionary page scan.
nistārayitṛmfn. equals tāraka- View this entry on the original dictionary page scan.
nistarham. () crushing, destroying ( tṛh-). View this entry on the original dictionary page scan.
nistarhaṇan. () crushing, destroying ( tṛh-). View this entry on the original dictionary page scan.
nistarīka gaRa nirudakādi-. View this entry on the original dictionary page scan.
nistarīpa gaRa nirudakādi-. View this entry on the original dictionary page scan.
nistarkyamfn. unimaginable, inconceivable View this entry on the original dictionary page scan.
nistartavya( ) mfn. to be passed over or overcome or conquered.
nistattvamfn. not comprehended in the 24 tattva-s or principles View this entry on the original dictionary page scan.
nistejasmfn. destitute of fire or energy, impotent, spiritless, dull , View this entry on the original dictionary page scan.
nistimiramf(ā-)n. equals -tamaska- View this entry on the original dictionary page scan.
nistīrṇamfn. crossed, passed over, spent, gone through, fulfilled, accomplished View this entry on the original dictionary page scan.
nistīrṇamfn. escaped, rescued, delivered, saved View this entry on the original dictionary page scan.
nistitīrṣatmf(antī-)n. desirous to cross (the ocean of life), wishing for salvation or liberation View this entry on the original dictionary page scan.
nistodam. View this entry on the original dictionary page scan.
nistodanan. piercing, pricking, stinging View this entry on the original dictionary page scan.
nistoyamf(ā-)n. waterless etc. View this entry on the original dictionary page scan.
nistoyatṛṇapādapamf(ā-)n. without water or grass or trees View this entry on the original dictionary page scan.
nistṛ(only 3. sg. Aorist -/astar-), to throw down, overthrow (see a-niṣṭṛta-). View this entry on the original dictionary page scan.
nistṝP. -tarati- (ind.p. -tīrya- infinitive mood -tartum-), to come forth from, get out of. escape from (ablative) ; to pass over or through, cross (sea etc.), pass or spend (time) ; to overcome or master (an enemy) etc. ; to fulfil, accomplish, perform (promise, vow etc.) ; to suffer for, expiate (accusative) ; (with abhiyogam-) to clear one's self from an accusation : Causal -tārayati-, to rescue, save, deliver from (ablative) ; to overcome, overpower ; Desiderative -titīrṣati- etc., to wish to cross or pass over (accusative) View this entry on the original dictionary page scan.
nistraiguṇyamfn. destitute of the three guṇa-s (sattva-, rajas-, tamas-;See gnṇa-) View this entry on the original dictionary page scan.
nistraiṇapuṣpakam. a species of thorn-apple (prob. wrong reading for niḥ-śreṇipuṣpaka-). View this entry on the original dictionary page scan.
nistraṃśamfn. fearless (prob. wrong reading for n/is-triṃśa-) View this entry on the original dictionary page scan.
nistrapamfn. shameless View this entry on the original dictionary page scan.
nistras(only imperfect tense nir-atrasan-), to fly, run away View this entry on the original dictionary page scan.
nistriṃśamfn. more than thirty (plural) View this entry on the original dictionary page scan.
nistriṃśamfn. merciless, cruel View this entry on the original dictionary page scan.
nistriṃśam. a sword etc. View this entry on the original dictionary page scan.
nistriṃśam. a sacrificial knife View this entry on the original dictionary page scan.
nistriṃśam. a particular stage in the retrograde motion of the planet Mars, , (equals śamusala- ) View this entry on the original dictionary page scan.
nistriṃśabhṛtm. equals -dhārin- View this entry on the original dictionary page scan.
nistriṃśadhārinm. a sword-bearer View this entry on the original dictionary page scan.
nistriṃśadharminmfn. resembling a sword View this entry on the original dictionary page scan.
nistriṃśakarkaśamfn. cruel and hard View this entry on the original dictionary page scan.
nistriṃśapattrakam. () View this entry on the original dictionary page scan.
nistriṃśapattrikāf. () Euphorbia (Antiquorum or Tortilis) View this entry on the original dictionary page scan.
nistriṃśatvan. cruelty View this entry on the original dictionary page scan.
nistriṃśinmfn. bearing a sword View this entry on the original dictionary page scan.
nistṛṇakaṇṭakamfn. cleared or freed from grass and thorns View this entry on the original dictionary page scan.
nistṛṣmfn. desireless, satisfied View this entry on the original dictionary page scan.
nistṛṣṇamfn. free from desire, View this entry on the original dictionary page scan.
nistruṭīf. cardamoms View this entry on the original dictionary page scan.
nistruṭīf. cardamoms (see niṣ-kuṭi-). View this entry on the original dictionary page scan.
nistudP. -tudati- (Passive voice -tudyate-), to pierce, prick, sting View this entry on the original dictionary page scan.
nistulamfn. matchless, incomparable View this entry on the original dictionary page scan.
nistulamfn. varia lectio for -tala- (Bombay edition) View this entry on the original dictionary page scan.
nistuṣamf(ā-)n. freed from chaff or husk View this entry on the original dictionary page scan.
nistuṣamf(ā-)n. (figuratively) purified, cleansed View this entry on the original dictionary page scan.
nistuṣamf(ā-)n. simplified View this entry on the original dictionary page scan.
nistuṣakṣīram. wheat View this entry on the original dictionary page scan.
nistuṣakṣīrinm. wheat View this entry on the original dictionary page scan.
nistuṣaratnan. crystal View this entry on the original dictionary page scan.
nistuṣatvan. equals nir-doṣatva- n. View this entry on the original dictionary page scan.
nistuṣīkṛto free from husk id est lessen, diminish View this entry on the original dictionary page scan.
nistuṣitamfn. () freed from husk View this entry on the original dictionary page scan.
nistuṣitamfn. simplified View this entry on the original dictionary page scan.
nistuṣitamfn. abandoned View this entry on the original dictionary page scan.
nistutiSee niḥ-stuti-. View this entry on the original dictionary page scan.
nistvakpakṣamfn. deprived of skin and fins (Bombay edition) View this entry on the original dictionary page scan.
nistyaj(only -tyakta-vat- mfn.) to drive away, expel View this entry on the original dictionary page scan.
nisūdaka dana- See ni-ṣūd-. View this entry on the original dictionary page scan.
nisumbhaSee ni-s-. View this entry on the original dictionary page scan.
nisundam. Name of an asura- slain by kṛṣṇa- (see sunda-, upa-s-). View this entry on the original dictionary page scan.
nisusūṣmfn. (3. su-) (see abhi-s-). View this entry on the original dictionary page scan.
nisvanP. -svanati-, to make a noise in eating View this entry on the original dictionary page scan.
nisvanam. (in fine compositi or 'at the end of a compound' f(ā-).) sound, noise, voice