Donate
   
Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Amarakosha Search
730 results
WordReferenceGenderNumberSynonymsDefinition
abandhyaḥ2.4.5MasculineSingularphalegrahiḥ
abhayā2.2.59FeminineSingularśivā, haimavatī, pūtanā, avyathā, śreyasī, harītakī, kāyasthā, cetakī, amṛtā, pathyā
abhitaḥ3.3.263MasculineSingularkhedaḥ, adbhutam
abhram1.3.6-7NeuterSingularmudiraḥ, ambubhṛt, jaladharaḥ, stanayitnuḥ, dhūmayoniḥ, jīmūtaḥ, vāridaḥ, dhārādharaḥ, vārivāhaḥ, jalamuk, ghanaḥ, taḍitvān, balāhakaḥ, meghaḥcloud
ādrakam2.9.38NeuterSingularśṛṅgaveram
agniḥMasculineSingularjvalanaḥ, barhiḥ, śociṣkeśaḥ, bṛhadbhānuḥ, analaḥ, śikhāvān, hutabhuk, saptārciḥ, citrabhānuḥ, appittam, vaiśvānaraḥ, dhanañjayaḥ, jātavedāḥ, śuṣmā, uṣarbudhaḥ, kṛśānuḥ, rohitāśvaḥ, āśuśukṣaṇiḥ, dahanaḥ, damunāḥ, vibhāvasuḥ, vahniḥ, kṛpīṭayoniḥ, tanūnapāt, kṛṣṇavartmā, āśrayāśaḥ, pāvakaḥ, vāyusakhaḥ, hiraṇyaretāḥ, havyavāhanaḥ, śukraḥ, śuciḥ, vītihotraḥfire god
āhvayaḥ1.6.8MasculineSingularnāma, ākhyā, āhvā, abhidhānam, nāmadheyamname
ājiḥ3.3.38FeminineSingularcetanā, hastādyaiḥarthasūcanā
ajñaḥ3.1.47MasculineSingularbāliśaḥ, mūḍhaḥ, yathājātaḥ, mūrkhaḥ, vaidheyaḥ
akhātam1.10.27NeuterSingulardevakhātama natural pond
alaṅkāraḥ2..9.97MasculineSingularrajatam, rūpyam, kharjūram, śvetam
alpam3.1.61MasculineSingulartanuḥ, sūkṣmam, stokaḥ, kaṇaḥ, truṭiḥ, kṛśam, ślakṣaṇam, leśaḥ, mātrā, dabhram, kṣullakaḥ, aṇuḥ, lavaḥ
ām2.4.17MasculineSingularevam
amaraḥ1.1.7-9MasculineSingularnirjaraḥ, vibudhaḥ, sumanasaḥ, āditeyaḥ, aditinandanaḥ, asvapnaḥ, gīrvāṇaḥ, daivatam, devaḥ, suraḥ, tridiveśaḥ, diviṣad, ādityaḥ, amartyaḥ, dānavāriḥ, devatā, tridaśaḥ, suparvā, divaukāḥ, lekhaḥ, ṛbhuḥ, amṛtāndhāḥ, vṛndārakaḥimmortal
ambūkṛtamMasculineSingularsaniṣṭhevammeaningless
āṅ3.3.247MasculineSingularāśīḥ, kṣema, puṇyam
anādaraḥ1.7.22NeuterSingularparibhāvaḥ, asūrkṣaṇam, tiraskriyā, rīḍhā, avamānanā, avajñā, paribhavaḥ, avahelanamdisrespect
anayaḥ3.3.157MasculineSingularsaṅghātaḥ, sanniveśaḥ
aṅgahāraḥMasculineSingularaṅgavikṣepaḥa appropriate vocative for female friend
antarā2.4.10MasculineSingularantareṇa, antare
antikam3.1.67MasculineSingularnediṣṭam
anveṣitam3.1.105MasculineSingularmṛgitam, gaveṣitam, anviṣṭam, mārgitam
āpaḥ1.10.3-4FemininePluralsalilam, payaḥ, jīvanam, kabandham, puṣkaram, arṇaḥ, nīram, śambaram, vāḥ, kamalam, kīlālam, bhuvanam, udakam, sarvatomukham, toyaḥ, kṣīram, meghapuṣpam, vāri, jalam, amṛtam, vanam, pāthaḥ, ambhaḥ, pānīyam, ambu, ghanarasaḥwater
ārādhanam3.3.132NeuterSingularsat, samaḥ, ekaḥ
āragvadhaḥ2.4.23MasculineSingularsaṃpākaḥ, caturaṅgulaḥ, ārevataḥ, vyādhighātaḥ, kṛtamālaḥ, rājavṛkṣaḥ, suvarṇakaḥ
arālam3.1.70MasculineSingularbhugnam, natam, jihmam, vakram, kuṭilam, kuñcitam, vṛjinam, vellitam, āviddham, ūrmimat
ārāt3.3.250MasculineSingularkhedaḥ, anukampā, santoṣaḥ, vismayaḥ, āmantraṇam
arciḥ3.3.238MasculineSingulartejaḥ, purīṣaḥ
arghaḥ3.3.32MasculineSingularmāsam, amātyaḥ, atyupadhaḥ, medhyaḥ, sitaḥ, pāvakam
ariṣṭaḥ2.4.31MasculineSingularphenilaḥ
aritramMasculineSingularkenipātakaḥthe rudder
aruṇaḥ3.3.54MasculineSingularmeṣādiloma, bhruvauantarāāvartaḥ
aruṣkaraḥ3.3.197MasculineSingularupari, udīcī, aśreṣṭhaḥ
aśaḥ2.9.90MasculineSingularriktham, rāḥ, draviṇam, dhanam, svāpateyam, arthaḥ, hiraṇyam, ṛktham, vittam, vibhavaḥ, dyumnam, va‍su
āsphoṭanī2.10.34FeminineSingularvedhanikā
āsravaḥ2.4.29MasculineSingularkleśaḥ, ādīnavaḥ
asuraḥ1.1.12MasculineSingularditisutaḥ, indrāriḥ, daityaḥ, suradviṣ, śukraśiṣyaḥ, danujaḥ, pūrvadevaḥ, dānavaḥ, daiteyaḥgiant
atiśayaḥ1.1.67MasculineSingularbhṛśam, gāḍham, tīvram, atimātram, ativelam, dṛḍham, nitāntam, nirbharam, atyartham, bharaḥ, bāḍham, ekāntam, udgāḍhammuch or excessive
atyayaḥ3.3.158MasculineSingularviśrambhaḥ, yācñā, pre
avadhiḥ3.3.106MasculineSingularnadaviśeṣaḥ, abdhiḥ, sarit
avalgujaḥMasculineSingularvākucī, somarājī, pūtaphalī, suvalliḥ, somavallikā, kālameśī, kṛṣṇaphalā
avarṇaḥMasculineSingularākṣepaḥ, garhaṇam, jugupsā, parīvādaḥ, nindā, upakrośaḥ, nirvādaḥ, kutsā, apavādaḥcensure, blame, or contempt
avaśyāyaḥMasculineSingulartuṣāraḥ, tuhinam, himam, prāleyam, mahikā, nīhāraḥfrost
avi:3.3.215MasculineSingularutsekaḥ, amarṣaḥ, icchāprasavaḥ, mahaḥ
ayanam2.1.15NeuterSingularpadavī, mārgaḥ, vartanī, saraṇiḥ, panthāḥ, vartma, padyā, sṛtiḥ, adhvā, ekapadī, paddhatiḥ
babhruḥ3.3.178MasculineSingulardevātvṛtam, śreṣṭhaḥ, dāyādaḥ, viṭaḥ, manākpriyam
badhiraḥ2.6.48MasculineSingulareḍaḥ
badhyaḥ3.1.44MasculineSingularśīrṣacchedyaḥ
balabhadraḥ1.1.23-24MasculineSingularbaladevaḥ, balaḥ, saṅkarṣaṇaḥ, tālāṅkaḥ, halāyudhaḥ, revatīramaṇaḥ, pralambaghnaḥ, kālindībhedanaḥ, halī, rauhiṇeyaḥ, kāmapālaḥ, acyutāgrajaḥ, ānakadundubhiḥ, sīrapāṇiḥ, musalī, nīlāmbaraḥ, rāmaḥbalaram
bālamFeminineSingularbarhiṣṭham, udīcyam, keśāmbunāma, hrīberam
baliśam1.10.16NeuterSingularmatsyavedhanamgoad
bāṇaḥ3.3.51MasculineSingularnirvyāpārasthitiḥ, kālaviśeṣaḥ, utsavaḥ
bāndhakineyaḥ2.6.26MasculineSingularbandhulaḥ, asatīsutaḥ, ‍kaulaṭeraḥ, ‍kaulaṭeyaḥ
bandhyaḥMasculineSingularaphalaḥ, avakeśī
bhāgyam3.3.163NeuterSingularniṣkṛtiḥ, karma, pūjanam, ārambhaḥ, cikitsā, upāyaḥ, śikṣā, ceṣṭā, saṃpradhāraṇam
bhaṭṭārakaḥMasculineSingulardevaḥa king
bhavaḥ3.3.214MasculineSingularātmā, janma, sattā, svabhāvaḥ, abhiprāyaḥ, ceṣṭā
bhāvaḥ3.3.215MasculineSingularjanmahetuḥ, ādyopalabdhisthānam
bhe3.3.3FeminineSingularmārutaḥ, vedhāḥ, bradhnaḥ
bhikṣā3.3.232FeminineSingularraviḥ, śvetaḥ, chadaḥ
bhinnārthakaḥ3.1.81MasculineSingularanyataraḥ, ekaḥ, tvaḥ, anyaḥ, itaraḥ
bhoḥ2.4.7MasculineSingularhai, pāṭ, pyāṭ, aṅga, he
bhojanam2.9.56-57NeuterSingularjemanam, lehaḥ, āhāraḥ, nighāsaḥ, nyādaḥ, jagdhiḥ
bhrātṛvyaḥ3.3.154MasculineSingularśapathaḥ, jñānam, viśvāsaḥ, hetuḥ, randhraḥ, adhīnaḥ, śabdaḥ
bhṛtyaḥ2.10.17MasculineSingular‍paricārakaḥ, ‍‍kiṅkaraḥ, ‍gopyakaḥ, dāseyaḥ, bhujiṣyaḥ, niyojyaḥ, dāsaḥ, ‍‍praiṣyaḥ, ceṭakaḥ, dāseraḥ
bhūḥ2.1.2-3FeminineSingularkṣmā, mahī, dhātrī, kumbhinī, ratnagarbhā, bhūmiḥ, rasā, dharā, kṣoṇī, kṣitiḥ, vasudhā, gotrā, pṛthvī, medinī, gahvarī, ilā, bhūtadhātrī, sāgarāmbarā, anantā, sthirā, dharaṇī, kāśyapī, vasumatī, vasundharā, pṛthivī, avaniḥ, vipulā, gauḥ, kṣamā, jagatī, acalā, viśvambharā, dharitrī, jyā, sarvaṃsahā, urvī, kuḥ
bhujaḥ2.6.80Ubhaya-lingaSingularbāhuḥ, praveṣṭaḥ, doḥ
bhūtam3.3.84MasculineSingularrupyam, sitam, hema
bhūtiḥ3.3.76FeminineSingularjagat, chandoviśeṣaḥ, kṣitiḥ
bhūtikam3.3.8NeuterSingularmahendraḥ, guggulu, ulūkaḥ, vyālagrāhī
brahmā1.1.16-17MasculineSingularprajāpatiḥ, viścasṛṭ, aṇḍajaḥ, kamalodbhavaḥ, satyakaḥ, ātmabhūḥ, pitāmahaḥ, svayaṃbhūḥ, abjayoniḥ, kamalāsanaḥ, vedhāḥ, vidhiḥ, pūrvaḥ, sadānandaḥ, haṃsavāhanaḥ, surajyeṣṭhaḥ, hiraṇyagarbhaḥ, caturāsanaḥ, druhiṇaḥ, sraṣṭā, vidhātā, nābhijanmā, nidhanaḥ, rajomūrtiḥ, parameṣṭhī, lokeśaḥ, dhātā, virañciḥbramha
brahma3.3.121NeuterSingularprayojanam, niḥsaraṇam, vanabhedaḥ
bṛhatī3.3.81FeminineSingularrupyam, hema
buddhiḥ1.5.1FeminineSingularpratipat, upalabdhiḥ, śemuṣī, dhiṣaṇā, cetanā, saṃvit, prekṣā, prajñā, manīṣā, jñaptiḥ, cit, matiḥ, dhīḥunderstanding or intellect
cakṣuṣyā2.9.103FeminineSingularpuṣpakam, ku‍sumāñjanam, puṣpaketu
cāmpeyaḥ2.2.63MasculineSingularcampakaḥ, hemapuṣpakaḥ
cāmpeyaḥ2.2.65MasculineSingularkesaraḥ, nāgakesaraḥ, kāñcanāhvayaḥ
caṇḍālaḥ2.10.19MasculineSingularantevāsī, janaṅgamaḥ, plavaḥ, pukkasaḥ, śvapacaḥ, divākīrttiḥ, cāṇḍālaḥ, niṣādaḥ, mātaṅgaḥ
candrakaḥ2.5.33MasculineSingularmecakaḥ
caurakaḥ2.10.24MasculineSingularparāskandī, taskaraḥ, aikāgārikaḥ, ‍‌pratirodhī, dasyuḥ, malimlucaḥ, ‍‍‍pāṭaccaraḥ, moṣakaḥ, stenaḥ
caurikā2.10.25FeminineSingularstainyam, cauryam, steyam
chātraḥ2.7.13MasculineSingularantevāsī, śiṣyaḥ
churikā2.8.93FeminineSingularśastrī, asiputrī, asidhenukā
ciram2.4.1MasculineSingularcirasya, ciram, cireṇa, cirāt, cirāya, cirarātrāya
citrāFeminineSingularmūṣikaparṇī, pratyakśreṇī, dravantī, raṇḍā, vṛṣā, nyagrodhī, sutaśreṇī, śambarī, upacitrā
citram1.5.17MasculineSingularkarburaḥ, kirmīraḥ, kalmāṣaḥ, śabalaḥ, etaḥvariegated
cittamNeuterSingularmanaḥ, cetaḥ, hṛdayam, svāntam, hṛt, mānasammalice
daivam1.4.28NeuterSingularniyatiḥ, vidhiḥ, diṣṭam, bhāgadheyam, bhāgyamdestiny or luck
daraḥ3.3.192MasculineSingularvinā, tādarthyam, paridhānam, avasaraḥ, ātmīyaḥ, bhedaḥ, avadhiḥ, antarātmā, bahiḥ, chidram, antardhiḥ, avakāśaḥ, madhyaḥ
dāritaḥ3.1.101MasculineSingularbhinnaḥ, bheditaḥ
darpaḥMasculineSingularavaṣṭambhaḥ, cittodrekaḥ, smayaḥ, madaḥ, avalepaḥarrogance
devalaḥ2.10.11MasculineSingulardevājīvaḥ
devaraḥ2.6.32MasculineSingulardevāḥ
dhamanīFeminineSingularhanuḥ, haṭṭavilāsinī, añjanakeśī
dharmaḥ1.4.25MasculineSingularpuṇyam, śreyaḥ, sukṛtam, vṛṣaḥvirtue or moral merit
dharmarājaḥ1.1.61-62MasculineSingularantakaḥ, daṇḍadharaḥ, yamarāṭ, kṛtāntaḥ, pitṛpatiḥ, vaivasvataḥ, kālaḥ, śamanaḥ, paretarāṭ, śrāddhadevaḥ, yamaḥ, yamunābhrātā, samavartīyama
dhātuḥ3.3.72MasculineSingularrātriḥ, veśma
dhenukā3.3.15FeminineSingularmukhyaḥ, anyaḥ, kevalaḥ
dhik3.3.248MasculineSingularsaha, ekavāram
dhīndriyam1.5.8NeuterSingularghrāṇaḥ, rasanā, tvak, manaḥ, netram, śrotraman intellectual organ
dhūliḥ2.8.101FeminineSingularreṇuḥ, pāṃśuḥ, rajaḥ
dhūrtaḥ2.10.44MasculineSingularakṣadhūrttaḥ, dyūtakṛt, akṣade, kitavaḥ
dhvāṅkṣaḥ3.3.227MasculineSingularsukṛtaḥ, vṛṣabhaḥ, śukralaḥ, mūṣikaḥ, śreṣṭhaḥ
ḍimbhaḥ3.3.142MasculineSingularbhe, akṣedundubhiḥ
dṇḍāhatam2.9.54NeuterSingularariṣṭam, gorasaḥ, kālaśeyam
dolā2.8.53FeminineSingularpreṅkhā
dravaḥ1.7.32MasculineSingularkrīḍā, khe, narma, keliḥ, parīhāsaḥdalliance or blandishnment
draviṇam3.3.58NeuterSingularsādhakatamam, kṣetram, gātram, indriyam
droṇaḥ3.3.55MasculineSingularstambhaḥ, veśma
dṛṣṭāntaḥ3.3.69MasculineSingularśleṣmādiḥ, aśmavikṛtiḥ, rasādiḥ, śabdayoniḥ, raktādiḥ, mahābhūtādiḥ, mahābhūtaguṇāḥ, indriyāṇi
dūtaḥ2.8.15MasculineSingularsaṃdeśaharaḥ
dvandvaḥ3.3.220NeuterSingularpuñjaḥ, meṣādyāḥ
dvijāFeminineSingularkauntī, kapilā, bhasmagandhinī, hareṇū, reṇukā
dvijaḥ3.3.36MasculineSingularpūrdvāraḥ, kṣetram
dvivarṣā2.9.69FeminineSingularekābdā
dyauḥ1.2.1FeminineSingularvyoma, nabhaḥ, anntam, viyat, vihāyaḥ, dyuḥ, meghādhvā, dyauḥ, puṣkaram, antarīkṣam, suravartma, viṣṇupadam, vihāyasaḥ, tārāpathaḥ, mahābilam, abhram, ambaram, gaganam, kham, ākāśam, nākaḥ, antarikṣamsky
eḍamūkaḥ3.1.37MasculineSingular
eḍūkamNeuterSingular
ekabrahmavratacāriṇaḥ2.7.13MasculineSingular
ekāgraḥ3.3.198MasculineSingularsvāduḥ, priyaḥ
ekāgraḥ3.1.79MasculineSingularekatālaḥ, ananyavṛttiḥ, ekāyanaḥ, ekasargaḥ, ekāgryaḥ, ekāyanagataḥ
ekaḥ3.3.16MasculineSingularpaktiḥ, śiśuḥ
ekahāyanī2.9.69FeminineSingularcaturhāyaṇī
ekākī3.1.81MasculineSingularekaḥ, ekakaḥ
ekatālaḥMasculineSingularharmony
ekebhaikarathā2.8.82FeminineSingular
elābālukamNeuterSingularbālukam, aileyam, sugandhi, haribālukam
elāparṇīFeminineSingularyuktarasā, suvahā, rāsnā
etahi2.4.22MasculineSingularadhunā, sāmpratam, saṃprati, idānīm
evam2.4.15MasculineSingulareva, iti, punaḥ,
evam3.3.258MasculineSingularbhūṣaṇam, paryāptiḥ, śaktiḥ, vāraṇam
gairikam3,.3.12NeuterSingularsāṣṭaṃśataṃsuvarṇam, hema, urobhūṣaṇam, palam, dīnāraḥ
gajabhakṣyāFeminineSingularsuvahā, hlādinī, surabhī, rasā, maheraṇā, kundurukī, sallakī
gaṇaḥ3.3.52MasculineSingularbhāskaraḥ, varṇabhedaḥ
gaṇanīyam3.1.64MasculineSingulargaṇeyam
gandhiparṇamNeuterSingularśukam, barhipuṣpam, sthauṇeyam, kukkuram
gāṅgerukīFeminineSingularnāgabālā, jhaṣā, hrasvagavedhukā
gaṇikā2.6.19FeminineSingularrūpājīvā, vārastrī, veśyā
garutmānMasculineSingularnāgāntakaḥ, viṣṇurathaḥ, garuḍaḥ, suparṇaḥ, tārkṣyaḥ, pannagāśanaḥ, vainateyaḥ, khageśvaraḥa heavanly bird
gauḥ2.9.67-72FeminineSingularupasaryā, rohiṇī, bahusūtiḥ, kapilā, navasūtikā, ekahāyanī, droṇakṣīrā, bandhyā, saurabhe, garbhopaghātinī, arjunī, acaṇḍī, dhavalā, vaṣkayiṇī, dvivarṣā, pīnoghnī, tryabdā, samāṃsamīnā, sandhinī, vaśā, praṣṭhauhī, naicikī, pareṣṭukā, pāṭalā, suvratā, caturabdā, droṇadugdhā, avatokā, usrā, kālyā, aghnyā, sukarā, kṛṣṇā, dhenuḥ, ekābdā, pīvarastanī, trihāyaṇī, māhe, vehad, śṛṅgiṇī, bālagarbhiṇī, śavalī, cirasūtā, dvihāyanī, sukhasaṃdohyā, caturhāyaṇī, dhenuṣyā, sravadgarbhā, mātā(49)cow
gavedhuḥ2.9.25FeminineSingulargavedhukā
gharmaḥMasculineSingularnidāghaḥ, svedaḥsweat
ghṛtāmṛtam3.3.82MasculineSingularmahābhītiḥ, jīvanāpekṣikarma
godhikātmajaḥ2.2.7MasculineSingulargaudhāraḥ, gaudheraḥ, gaudheyaḥ
gṛham2.2.4-5NeuterSingularagāram, vastyam, sadma, geham, ālayaḥ, gṛhāḥ, bhavanam, niśāntam, veśma, nilayaḥ, mandiram, sadanam, niketanam, udavasitam, nikāyyaḥ
gṛhāvagrahaṇīFeminineSingulardehalī
gundraḥMasculineSingulartejanakaḥ, śaraḥ
haṃsaḥ2.5.26MasculineSingularcakrāṅgaḥ, mānasaukāḥ, śvetagarut
haṃsaḥ3.3.234MasculineSingularkarṇapūraḥ, śekharaḥ
hañjikāFeminineSingularvardhakaḥ, bhārgī, brāhmaṇayaṣṭikā, aṅgāravallī, bāleyaśākaḥ, brāhmaṇī, varvaraḥ, padmā
hanta3.3.252MasculineSingularanekaḥ, ubhayaḥ
hastī2.8.35MasculineSingularpadmī, karī, gajaḥ, anekapaḥ, dantī, stamberamaḥ, vāraṇaḥ, mataṅgajaḥ, dviradaḥ, hāthī, ibhaḥ, kuñjaraḥ, dvipaḥ, dantāvalaḥ
himāṃśuḥ1.3.13-14MasculineSingularśaśadharaḥ, induḥ, sudhāṃśuḥ, niśāpatiḥ, somaḥ, kalānidhiḥ, nakṣatreśaḥ, candramāḥ, kumudabāndhavaḥ, śubhrāṃśuḥ, abjaḥ, glauḥ, dvijarājaḥ, kṣapākaraḥ, candraḥ, vidhuḥ, oṣadhīśaḥ, jaivātṛkaḥ, mṛgāṅkaḥthe moon
hrādinī3.3.119FeminineSingularkṛtyaḥ, ketuḥ, upanimantraṇam
hreṣā2.8.48FeminineSingularheṣā
ikṣugandhāFeminineSingularkāṇḍekṣuḥ, kokilākṣaḥ, ikṣuraḥ, kṣuraḥ
indhanamNeuterSingularsamit, edhaḥ, idhmam, edhaḥ
indraḥ1.1.45MasculineSingularmarutvān, pākaśāsanaḥ, puruhūtaḥ, lekharṣabhaḥ, divaspatiḥ, vajrī, vṛṣā, balārātiḥ, harihayaḥ, saṅkrandanaḥ, meghavāhanaḥ, ṛbhukṣāḥ, maghavā, vṛddhaśravāḥ, purandaraḥ, śakraḥ, sutrāmā, vāsavaḥ, vāstoṣpatiḥ, śacīpatiḥ, svārāṭ, duścyavanaḥ, ākhaṇḍalaḥ, viḍaujāḥ, sunāsīraḥ, jiṣṇuḥ, śatamanyuḥ, gotrabhid, vṛtrahā, surapatiḥ, jambhabhe, namucisūdanaḥ, turāṣāṭ, sahasrākṣaḥindra, the king of the gods
itaraḥ3.3.200MasculineSingularkṛtāntaḥ, anehāḥ
jagalaḥ2.10.42NeuterSingularmedakaḥ
jagat3.3.86MasculineSingularkṛtrimam, lakṣaṇopetam
jaitraḥ2.8.76MasculineSingularje
jāmiḥ3.3.150FeminineSingularpucchaḥ, puṇḍraḥ, aśvabhūṣā, prādhānyam, ketuḥ
jaṭharaḥ3.3.197MasculineSingularśreṣṭhaḥ, adhaḥ
jātiḥ3.3.74FeminineSingularvīṇābhedaḥ
jatukam2.9.40NeuterSingularsahasravedhi, ‍vāhlīkam, hiṅgu, rāmaṭham
jayā2.2.66FeminineSingulartarkārī, kaṇikā, vaijayantikā, jayantī, jayaḥ, agnimanthaḥ, nāde, gaṇikārikā, śrīparṇam
jvālaḥUbhaya-lingaSingulararciḥ, hetiḥ, śikhā, kīlaḥflame
kabarī2.6.98FeminineSingularkeśaveśaḥ
kādambinīFeminineSingularmeghamālāa sucession of cloud
kākaḥ2.5.22MasculineSingularcirañjīvī, parabhṛt, sakṛtprajaḥ, karaṭaḥ, maukuliḥ, vāyasaḥ, ātmaghoṣaḥ, balipuṣṭaḥ, ekadṛṣṭiḥ, balibhuk, dhvāṅkṣaḥ, ariṣṭaḥ
kākodumbarikā2.2.61FeminineSingularphalguḥ, malayūḥ, jaghanephalā
kakṣyā3.3.166FeminineSingularātmavān, arthātanapetaḥ
kakudaḥ3.3.99MasculineSingulargosevitam, gopadamānam
kālaḥ1.4.1MasculineSingularsamayaḥ, diṣṭaḥ, anetime
kalaṅkaḥ3.3.4MasculineSingulartucchadhānyam, saṅkṣepaḥ, bhaktam, sikthakam
kālānusāryamFeminineSingularśaileyam, vṛddham, aśmapuṣpam, śītaśivam
kalikā3.3.15FeminineSingulardāmbhikaḥ, adūreritākṣaḥ
kāmam2.9.58MasculineSingulariṣṭam, yathepsitam, prakāmam, ‍paryāptam, ‍nikāmam
kāminī3.3.119FeminineSingularprajāpatiḥ, tattvam, tapaḥ, brahma, brahmā, vipraḥ, vedāḥ
kandurvā2.9.31Ubhaya-lingaSingularsvedanī
kāntāram3.3.179MasculineSingularviṣṇuḥ, indraḥ, kapilaḥ, ahiḥ, aṃśuḥ, arkaḥ, anilaḥ, bhekaḥ, śukaḥ, siṃhaḥ, candraḥ, yamaḥ, kapiḥ, vājī
kaphaḥ2.6.63MasculineSingularśleṣmā
karaḥ2.8.27MasculineSingularbhāgadheyaḥ, baliḥ
kāraṇāFeminineSingularyātanā, tīvravedanāagony
karcūrakaḥMasculineSingulardrāviḍakaḥ, kālpakaḥ, vedhamukhyakaḥ
kareṇuḥ3.3.58FeminineSingularpramātā, hetuḥ, maryādā, śāstreyattā
kariṇī2.8.37FeminineSingulardhenukā, vaśā
karipippalīFeminineSingularkapivallī, kolavallī, śreyasī, vaśiraḥ
karkareṭuḥ2.5.21MasculineSingularkareṭuḥ
karṣakaḥ2.9.6MasculineSingular‍kṛṣikaḥ, ‍kṛṣīvalaḥ, kṣetrājīvaḥ
kārtikeyaḥMasculineSingularmahāsenaḥ, kumāraḥ, śikhivāhanaḥ, bāhuleyaḥ, senānīḥ, ṣaḍānanaḥ, śaktidharaḥ, viśākhaḥ, guhaḥ, skandaḥ, śarajanmā, krauñcadāruṇaḥ, ṣāṇmāturaḥ, tārakajit, agnibhūḥ, pārvatīnandanaḥkaarttik
kaṭaḥ3.3.40FeminineSingularkṣemam, aśubhābhāvaḥ
kattṛṇamNeuterSingularpauram, saugandhikam, dhyāmam, devajagdhakam, rauhiṣam
kaṭuḥFeminineSingularcakrāṅgī, kaṭaṃvarā, śakulādanī, aśokarohiṇī, kaṭurohiṇī, matsyapittā, kṛṣṇabhe
kaukkuṭikaḥ3.3.17MasculineSingularmadhyaratnam, ne
kaulaṭineyaḥ2.6.26MasculineSingular‍kaulaṭeyaḥ
keśavaḥ2.6.45MasculineSingularkeśikaḥ, keśī
khaḍgaḥ2.8.90MasculineSingularkṛpāṇaḥ, asiḥ, riṣṭiḥ, kaukṣethakaḥ, maṇḍalāgraḥ, nistriṃśaḥ, karavālaḥ, candrahāsaḥ
khanati2.9.65MasculineSingulardhu‍rīṇaḥ, dhūrvahaḥ, dhuryyaḥ, dhaureyaḥ
kīlālam3.3.208NeuterSingularchadiḥ, netraruk, samūhaḥ
kim3.3.259MasculineSingularaprathamaḥ, bhedaḥ
kiñjalakaḥMasculineSingularkesaraḥa filament
kiñjalkaḥ3.3.21MasculineSingularbālaḥ, bhedakaḥ
kndukaḥ1.2.139MasculineSingulargendukaḥ
kolam2.4.36NeuterSingularphenilam, sauvīram, badaram, ghoṇṭā, kuvalam
kośaḥ3.3.226MasculineSingularpreṣaṇam, mardanam
koṭiśaḥ2.9.12MasculineSingularloṣṭabhedenaḥ
krīḍāFeminineSingularkūrdanam, khea play or game
kṛṣṇāFeminineSingularkolā, uṣaṇā, māgadhī, śauṇḍī, kaṇā, vaide, pippalī, capalā, upakulyā
kṛṣṇaḥMasculineSingularśyāmaḥ, kālaḥ, śyāmalaḥ, mecakaḥ, nīlaḥ, asitaḥblack or dark blue
kṛṣṇapākaphalaḥ2.2.67MasculineSingularavignaḥ, suṣeṇaḥ, karamardakaḥ
krūraḥ3.3.199MasculineSingularsaṃyatāḥkeśāḥ, cūḍā, kirīṭam
kṣetrajñaḥ3.3.39MasculineSingulardevaśilpī
kṣetram2.9.11NeuterSingular‍kedāraḥ, vapraḥ
kṣīravidārīFeminineSingularmahāśve, ṛkṣagandhikā
ku3.3.248MasculineSingularavadhāraṇam, bhedaḥ
kuberaḥ1.1.68-69MasculineSingularekapiṅgaḥ, paulastyaḥ, dhanādhipaḥ, manuṣyadharmā, tryambakasakhaḥ, śrīdaḥ, yakṣaḥ, vaiśravaṇaḥ, rājarājaḥ, guhyakeśvaraḥ, aiḍaviḍaḥ, naravāhanaḥ, kinnareśaḥ, dhanadaḥ, yakṣarāṭ, puṇyajaneśvaraḥkuber
kukubhaḥMasculineSingularprasevakaḥthe belly below the neck of a lute
kulakaḥ2.10.5MasculineSingularkulaśreṣṭhī
kuṇḍalam2.6.104NeuterSingularkarṇaveṣṭnam
kuruvindaḥMasculineSingularmeghanāmā, mustā, mustakam
kusumbham3.3.144NeuterSingularbhekaḥ, kapiḥ
kuṭannaṭamNeuterSingulargonardam, dāśapuram, kaivartīmustakam, vāneyam, paripelavam, plavam, gopuram
kūtuḥ2.9.33FeminineSingularsnehapātram
lābhaḥ2.9.81MasculineSingular‍naimeyaḥ, ‍nimayaḥ, parīvarttaḥ
lavaṅgam2.6.126NeuterSingulardevakusumam, śrīsaṃjñam
locanam2.6.94NeuterSingulardṛṣṭiḥ, netram, īkṣaṇam, cakṣuḥ, akṣiḥ, dṛk, nayanam
lolaḥ3.3.213MasculineSingularśailaḥ, meṣaḥ, arkaḥ
loṣṭhāni2.9.12MasculineSingularleṣṭuḥ
lubdhakaḥ3.3.19MasculineSingularpuṣpareṇuḥ
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketanaḥ, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
madhuvrataḥ2.5.31MasculineSingularbhramaraḥ, puṣpaliṭ, madhupaḥ, ṣaṭpadaḥ, dvirephaḥ, madhuliṭ, aliḥ, bhṛṅgaḥ, alī, madhukaraḥ
mahatī3.3.76FeminineSingularśastram, vahnijvālā, raverarciḥ
makūlakaḥMasculineSingularnikumbhaḥ, dantikā, pratyakśreṇī, udumbaraparṇī
mañjiṣṭhāFeminineSingularbhaṇḍīrī, vikasā, bhaṇḍī, jiṅgī, yojanavallī, samaṅgā, kālameśikā, maṇḍūkaparṇī
manthanī2.9.75FeminineSingularkramelakaḥ, mayaḥ, mahāṅgaḥ
marunmālāFeminineSingularsamudrāntā, de, koṭivarṣā, laghuḥ, spṛkkā, vadhūḥ, latā, piśunā, laṅkopikā
marutaḥ3.3.65MasculineSingulargrahabhedaḥ, dhvajaḥ
māsavaḥ2.10.42MasculineSingularmaireyam, śīdhuḥ
mātrā3.3.185FeminineSingularnideśaḥ, granthaḥ
matsyādhānīFeminineSingularkuveṇīa fish basket
mayūraḥ2.5.32MasculineSingularmeghanādānulāsī, nīlakaṇṭhaḥ, bhujaṅgabhuk, śikhāvalaḥ, śikhī, barhiṇaḥ, ke, barhī
medhiḥ2.9.15MasculineSingularkhaledāru
meruḥ1.1.52MasculineSingularsumeruḥ, hemādriḥ, ratnasānuḥ, surālayaḥmountain
mṛgaḥ3.3.24MasculineSingularsnānīyam, rajaḥ, kausumaḥreṇuḥ
mṛgayā2.10.24NeuterSingularmṛgavyam, ākheṭaḥ, ācchodanam
mṛtaḥ2.8.119MasculineSingularpramītaḥ, parāsuḥ, prāptapañcatvaḥ, paretaḥ, pretaḥ, saṃsthitaḥ
muktiḥ1.5.6FeminineSingularśreyaḥ, niḥśreyasam, amṛtam, mokṣaḥ, kaivalyam, apavargaḥ, nirvāṇambeatitude
mūlyam2.10.38-39NeuterSingularbharaṇam, bharma, vidhā, paṇaḥ, bharaṇyam, bhṛ‍tiḥ, karmaṇyā, nirveśaḥ, vetanam, bhṛtyā
mūrcchitaḥ3.3.89MasculineSingularāśrayaḥ, avātaḥ, śastrābhedyaṃvarma
mūrvāFeminineSingulargokarṇī, sruvā, madhurasā, madhuśreṇī, tejanī, de, pīluparṇī, madhūlikā, moraṭā
nāgāḥMasculinePluralkādraveyāḥgreat darkness or dulusion of the mind
naigamaḥ3.3.147MasculineSingularceṣṭā, alaṅkāraḥ, bhrāntiḥ
nākulīFeminineSingularrāsnā, suvahā, sugandhā, gandhanākulī, nakuleṣṭā, bhujaṅgākṣī, surasā, chatrākī
nāma3.3.259MasculineSingularniścayaḥ, niṣedhaḥ
nandīMasculineSingularbhṛṅgī, riṭiḥ, tuṇḍī, nandikaḥ, nandikeśvaraḥ, śṛṅgīnandi
nārācaḥ2.8.87MasculineSingularprakṣveḍanaḥ
nārācī2.10.32MasculineSingulareṣaṇikā
nepathyam2.6.100MasculineSingularākalpaḥ, veṣaḥ, pratikarma, prasādhanam
nidrā1.7.36FeminineSingularśayanam, svāpaḥ, svapnaḥ, saṃveśaḥsleep
nigālaḥ2.8.48MasculineSingulargaloddeśaḥ
nihnavaḥ3.3.216MasculineSingularbhabhedaḥ, niścitam, śāśvatam
nijaḥ3.3.38MasculineSingularkhalatiḥ, duṣcarmā, maheśvaraḥ
nikṛṣṭaḥ3.1.53MasculineSingularrephaḥ, garhyaḥ, kutsitaḥ, avamaḥ, arvā, kheṭaḥ, kupūyaḥ, yāpyaḥ, pratikṛṣṭaḥ, aṇakaḥ, avadyaḥ, adhamaḥ
nirdeśaḥ2.8.25MasculineSingularavavādaḥ, nideśaḥ, śāsanam, śiṣṭiḥ, ājñā
niṣṭhevanam2.4.38NeuterSingularniṣṭhyūtiḥ, niṣṭhīvanam, niṣṭhevaḥ
nyagrodhaḥ3.3.103MasculineSingularcetaḥpīḍā, adhiṣṭhānam, bandhakam, vyasanam
nyāyaḥ2.8.23MasculineSingularabhreṣaḥ, kalpaḥ
om2.4.12MasculineSingularevam, paramam
padmam1.10.39-40MasculineSingularpaṅkeruham, kamalam, aravindam, rājīvam, sārasam, kuśeśayam, sahasrapattram, nalinam, ambhoruham, bisaprasūnam, tāmarasam, śatapattram, mahotpalam, puṣkaram, sarasīruhama lotus
pākaḥ3.3.19MasculineSingulardeśyaḥ, guruḥ
palagaṇḍaḥ2.10.6MasculineSingularlepakaḥ
palam3.3.210NeuterSingularpuṇyam, śikṣitaḥ, paryāptiḥ, kṣema
paṃkam1.4.24MasculineSingularkalmaṣam, pāpmā, aṃhaḥ, vṛjinam, kilbiṣam, duṣkṛtam, agham, kaluṣam, pāpam, duritam, enaḥsin
pāraśavaḥ3.3.218MasculineSingulargaurī, pheravaḥ
paridhiḥ3.3.104MasculineSingularparicchedaḥ, bilam
parighaḥ3.3.32MasculineSingularmṛdbhedaḥ, dṛgruk, śikyam
parirambhaḥ2.4.30MasculineSingularpariṣvaṅgaḥ, saṃśleṣaḥ, upagūhanam
parivyādhaḥ2.4.30MasculineSingularvidulaḥ, nāde, ambuvetasaḥ
parjanyaḥ3.3.154MasculineSingulardīrghadveṣaḥ, anutāpaḥ
parṇāsaḥMasculineSingularkaṭhiñjaraḥ, kuṭherakaḥ
pāśakaḥ2.10.45MasculineSingularakṣaḥ, devanaḥ
paṭaḥ2.10.18MasculineSingularuṣṇaḥ, dakṣaḥ, caturaḥ, ‍‍‍peśalaḥ, sūtthānaḥ
patākā2.8.102FeminineSingular‍vaijayantī, ketanam, ‍‍dhvajam
pāṭaliḥ2.2.54MasculineSingularkuberākṣī, pāṭalā, amoghā, kācasthālī, phaleruhā, kṛṣṇavṛntā
pāṭhāFeminineSingularpāpace, śreyasī, ambaṣṭhā, vanatiktikā, ekāṣṭhīlā, sthāpanī, prācīnā, rasā, viddhakarṇī
pattiḥ3.3.79FeminineSingularvedaḥ, śravaḥ
pattroṇam2.6.114NeuterSingulardhautakauśeyam
pāyasaḥ1.2.129MasculineSingularsaraladravaḥ, śrīvāsaḥ, vṛkadhūpaḥ, śrīveṣṭaḥ
payodharaḥ3.3.171MasculineSingularajātaśṛṅgaḥgauḥ, kāleऽpiaśmaśruḥnā
pecakaḥ3.3.6MasculineSingularekadeśaḥ, pratikūlaḥ
picchā2.2.47FeminineSingularśālmalīveṣṭaḥ
piśunaḥ3.3.134MasculineSingularparicchedaḥ, paryuptaḥ, salilasthitaḥ
pītadruḥMasculineSingularpacampacā, dāruharidrā, parjanī, kālakeyaḥ, haridraḥ, dārvī
piṭakaḥ2.10.30MasculineSingular‍‍‍peṭakaḥ, peṭā, mañjūṣā
plavagaḥ3.3.29MasculineSingularcihnam, śephaḥ
plavaṃgamaḥ3.3.145MasculineSingularvaṇikpathaḥ, puram, vedaḥ
prābhṛtam2.8.27NeuterSingularpradeśanam
pradhānam3.1.58NeuterSingularagryaḥ, agraḥ, pravarhaḥ, mukhyaḥ, pravekaḥ, agriyaḥ, prāgryaḥ, parārdhyaḥ, vareṇyaḥ, uttamaḥ, pramukhaḥ, agrīyaḥ, prāgraharaḥ, anavarārdhyaḥ, varyaḥ, anuttamaḥ
prāduḥ3.3.264MasculineSingularhetuḥ, avadhāraṇam
prajñānam3.3.129NeuterSingularprabhāvaḥ, gṛham, dehaḥ, tviṭ
pralayaḥ1.7.33MasculineSingularnaṣṭaceṣṭatāfainting
pramilā3.3.184FeminineSingularālekhyam, āścaryam
prāṇīMasculineSingularjantuḥ, janyuḥ, śarīrī, cetanaḥ, janmīanimal
prapunnāḍaḥMasculineSingulareḍagajaḥ, dadrughnaḥ, cakramardakaḥ, padmāṭaḥ, uraṇākhyaḥ
prasūnam3.3.130NeuterSingularcatuṣpathaḥ, saṃniveśaḥ
pratīhāraḥ3.3.178MasculineSingularanyaśubhadveṣaḥ, anyaśubhadveṣavat, kṛpaṇaḥ
pratītaḥ3.3.88MasculineSingulardhavalaḥ, mecakaḥ
pratyākhyānam2.4.32NeuterSingularnirākṛtiḥ, nirasanam, pratyādeśaḥ
pratyantaḥMasculineSingularmlecchadeśaḥ
pravalhikā1.6.6FeminineSingularprahelikāriddle/ name of the atharvaveda
pravṛddham3.1.76MasculineSingularprauḍham, edhitam
prekṣā3.3.232FeminineSingularaprema, acikkaṇaḥ
preMasculineSingularprema, snehaḥ, priyatā, hārdamafllection or kindness
pṛthag2.4.2MasculineSingularhiruk, nānā, vinā, antareṇa, ṛte
pṛthvīkāFeminineSingulare, niṣkuṭiḥ, bahulā, candrabālā
pūḥFeminineSingularnagarī, pattanam, puṭabhedanam, sthānīyam, nigamaḥ, purī
punnāgaḥ2.4.25MasculineSingulardevavallabhaḥ, puruṣaḥ, tuṅgaḥ, kesaraḥ
purā3.3.261MasculineSingularjijñāsā, anunayaḥ, niṣedhaḥ, vākyālaṅkāraḥ
puraskṛtaḥ3.3.90MasculineSingularabhidheyaḥ, rāḥ, vastu, prayojanam, nivṝttiḥ
puruṣaḥ3.3.227MasculineSingularśiroveṣṭam, kirīṭam
pūtam3.1.54MasculineSingularpavitram, medhyam
rāḥ3.3.173MasculineSingularvedabhedaḥ, guhyavādaḥ
rājā3.3.118MasculineSingulardehaḥ, tvak
rajakaḥ2.10.10MasculineSingularnirṇejakaḥ
rajasvalā2.6.20FeminineSingularātre, malinī, puṣpavatī, ṛtumatī, strīdharmiṇī, udakyā, aviḥ
rākṣasīFeminineSingularkṣemaḥ, duṣpatraḥ, gaṇahāsakaḥ, caṇḍā, dhanaharī
rāmaḥ3.3.148MasculineSingularruk, stambaḥ, se
rāṣṭaḥ3.3.192MasculineSingularpadmam, karihastāgram, tīrthaḥ, vādyabhāṇḍamukham, oṣadhiviśeṣaḥ, jalam, vyoma, khaḍgaphalam
rathakuṭumbinaḥ2.8.61MasculineSingulardakṣiṇasthaḥ, yantā, sūtaḥ, kṣattā, sārathiḥ, niyantā, savyeṣṭhaḥ, prājitā
ratnam2.9.94NeuterSingularhiraṇyam, ‍tapanīyam, ‍bharma, jātarūpam, rukmam, a‍ṣṭāpadaḥ, suvarṇam, hema, śātakumbham, karburam, mahārajatam, kārtasvaram, kanakam, hāṭakam, gāṅgeyam, cāmīkaram, kāñcanam, jāmbūnadam
re1.10.32FeminineSingularnarmadā, somodbhavā, mekalakanyakānarmada(river)
rītiḥ2.9.98FeminineSingular‍śulbam, mlecchamukham, dvyaṣṭam, variṣṭham, udumbaram
ṛkṣagandhāFeminineSingularchagalāntrī, āve, vṛddhadārakaḥ, juṅgaḥ
rodanam2.6.94NeuterSingularasru, netrāmbu, asram, aśru
sādhanam3.3.126NeuterSingularnetracchedaḥ, adhvā
sadhurandharaḥ2.9.66MasculineSingularekadhurīṇaḥ, ekadhuraḥ
sādinaḥ3.3.114MasculineSingularkeśaḥ
sahasravedhīFeminineSingularamlavetasaḥ, śatavedhī, cukraḥ
sainikaḥ2.8.62MasculineSingularsenārakṣaḥ
śakalam3.3.13NeuterSingularmeghajālam
śakrapādapaḥ2.2.53MasculineSingulardevadāru, bhadradāru, drukilimam, pītadāru, dāru, pūtikāṣṭham, pāribhadrakaḥ
śāktīkaḥ2.8.70MasculineSingularśaktihetikaḥ
śākyamuniḥ1.1.14-15MasculineSingularsarvārthasiddhaḥ, śauddhodaniḥ, gautamaḥ, arkabandhuḥ, māyādevīsutaḥ, śākyasiṃhaḥbuddha
śāleyaḥMasculineSingularśītaśivaḥ, chatrā, madhurikā, misiḥ, miśreyaḥ
samagram3.1.66MasculineSingularpūrṇam, akhilam, kṛtsnam, sarvam, anūnakam, sakalam, nikhilam, eṣam, samam, akhaṇḍam, niḥśeṣam, samastam, viśvam
samālambhaḥ2.4.27MasculineSingularvilepanam
śaṃbhuḥMasculineSingularkapardī, kapālabhṛt, virūpākṣaḥ, sarvajñaḥ, haraḥ, tryambakaḥ, andhakaripuḥ, vyomakeśaḥ, sthāṇuḥ, ahirbudhnyaḥ, paśupatiḥ, mahānaṭaḥ, maheśvaraḥ, īśānaḥ, bhūteśaḥ, giriśaḥ, kṛttivāsāḥ, ugraḥ, śitikaṇṭhaḥ, mahādevaḥ, kṛśānuretāḥ, nīlalohitaḥ, bhargaḥ, gaṅgādharaḥ, vṛṣadhvajaḥ, bhīmaḥ, umāpatiḥ, īśaḥ, gajāriḥ, śūlī, śarvaḥ, candraśekharaḥ, girīśaḥ, mṛtyuñjayaḥ, prathamādhipaḥ, śrīkaṇṭhaḥ, vāmadevaḥ, trilocanaḥ, dhūrjaṭiḥ, smaraharaḥ, tripurāntakaḥ, kratudhvaṃsī, bhavaḥ, rudraḥ, aṣṭamūrtiḥ, śivaḥ, īśvaraḥ, śaṅkaraḥ, khaṇḍaparaśuḥ, mṛḍaḥ, pinākī(51)shiva, god
saṃgaraḥ3.3.174MasculineSingulartūryam, ravaḥ, gajendrāṇāṃgarjitam
sāmpratam2.4.11MasculineSingularsthāne
saṃsthānam3.3.131NeuterSingularsvajātiśreṣṭhaḥ
samundanam2.4.29NeuterSingulartemaḥ, stemaḥ
samvedaḥ03.04.2006MasculineSingularvedanā
sandhā3.3.109FeminineSingularadhikṣepaḥ, nirdeśaḥ
sandhiḥ3.4.11MasculineSingularśleṣaḥ
śaṅkhinīFeminineSingularcorapuṣpī, keśinī
saptalāFeminineSingularvimalā, sātalā, bhūriphe, carmakaṣā
sāraḥ3.3.178MasculineSingularvaṃśāṅkuraḥ, tarubhedaḥ, ghaṭaḥ
sāraṅgaḥ3.3.28MasculineSingularvāk, svargaḥ, bhūḥ, dik, paśuḥ, ghṛṇiḥ, vajram, iṣuḥ, jalam, netram
śarīram2.6.71NeuterSingulartanūḥ, dehaḥ, varṣma, gātram, tanuḥ, kāyaḥ, saṃhananam, kalevaram, mūrtiḥ, vigrahaḥ, vapuḥ
saritaḥ1.10.34FemininePluralcandrabhāgā, sarasvatī, kāve, śarāvatī, vetravatīsavarmati(river)
sarpaḥ1.8.6-8MasculineSingulardvirasanaḥ, kumbhīnasaḥ, bhogadharaḥ, bhujaṅgaḥ, āśīviṣaḥ, vyālaḥ, gūḍhapāt, phaṇī, dandaśūkaḥ, pannagaḥ, pavanāśanaḥ, gokarṇaḥ, phaṇadharaḥ, pṛdākuḥ, ahiḥ, viṣadharaḥ, sarīsṛpaḥ, cakṣuḥśravā, darvīkaraḥ, bileśayaḥ, bhogī, lelihānaḥ, kañcukī, hariḥ, bhujagaḥ, bhujaṅgamaḥ, cakrī, kuṇḍalī, kākodaraḥ, dīrghapṛṣṭhaḥ, uragaḥ, jihvagaḥa snake or serpent
śaśādanaḥ2.5.16MasculineSingularpatrī, śyenaḥ
śatamūlīFeminineSingularśatāvarī, ṛṣyaproktā, abhīruḥ, nārāyaṇī, varī, bahusutā, aheruḥ, abhīrupatrī, indīvarī
śatayaṣṭikaḥ2.6.106MasculineSingulardevacchandaḥ
satīnakaḥ2.9.16MasculineSingularkalāyaḥ, hareṇuḥ, khaṇḍikaḥ
satīrthyaḥ2.7.14MasculineSingularekaguruḥ
śatruḥ2.8.10MasculineSingularārātiḥ, śātravaḥ, ahitaḥ, durhṛd, sapatnaḥ, paraḥ, dasyuḥ, vipakṣaḥ, dveṣaṇaḥ, vairī, pratyarthī, abhighātī, amitraḥ, dviṭ, dviṣan, ripuḥ
satyam3.3.162NeuterSingularkaśe, hema
saumyam3.3.169MasculineSingularsādṛṣyam, bhedaḥ
śeluḥ2.4.34MasculineSingularśleṣmātakaḥ, śītaḥ, uddālaḥ, bahuvārakaḥ
śibiraḥ2.8.33NeuterSingularniveśaḥ
sikatā3.3.80FemininePluralmahatī, kṣudravārtākī, chandobhedaḥ
śikhā2.6.98FeminineSingularcūḍā, keśapāśī
śikhin3.3.113MasculineSingularvrīhibhedaḥ, varṣaḥ, arciḥ
śīlam3.3.13NeuterSingularkareṇuḥ
siṃhaḥ2.5.1MasculineSingularmṛgadviṭ, puṇḍarīkaḥ, mṛgaripuḥ, kesarī, mṛgendraḥ, citrakāyaḥ, mṛgāśanaḥ, kaṇṭhīravaḥ, haryakṣaḥ, pañcanakhaḥ, mṛgadṛṣṭiḥ, hariḥ, pañcāsyaḥ
siṃhanādaḥ2.8.108MasculineSingularkṣveḍā
sindūram2.9.106NeuterSingularvapram, ‍nāgam, yogeṣṭam
śiśnaḥ2.6.77NeuterSingularśephaḥ, meḍhram, mehanam
śivā2.2.5FeminineSingularjambukaḥ, kroṣṭā, mṛgradhūrtakaḥ, pheravaḥ, vañcalaḥ, gomāyuḥ, pheruḥ, sṛgālaḥ, bhūrimāyaḥ
śivamallīFeminineSingularpāśupataḥ, ekāṣṭhīlaḥ, vakaḥ, vasuḥ
skandhaḥ3.3.107MasculineSingularlepaḥ, amṛtam, snuhī
śleṣmalaḥ2.6.61MasculineSingularśleṣmaṇaḥ, kaphī
snigdhaḥ3.1.28MasculineSingularmeduraḥ
sokapātram1.10.13NeuterSingularsecanama bucket
śreṣṭhaḥ3.1.58MasculineSingularpuṣkalaḥ, sattamaḥ, atiśobhanaḥ, śreyān
śrutiḥFeminineSingularvedaḥ, āmnāyaḥ, trayīveda
stanitam1.3.8NeuterSingularmeghanirghoṣaḥ, rasitam, garjitamthe rattling of thunder
sthāṇuḥ3.3.55MasculineSingularmṛgī, hemapratimā, haritā
sthāsnuḥ3.1.72MasculineSingularsthirataraḥ, stheyān
sthāvaraḥ3.1.72MasculineSingularjaṅgametaraḥ
sthūṇā3.3.57FeminineSingularkareṇuḥ, karī
śubhacchā2.9.77MasculineSingularuraṇaḥ, ūrṇāyuḥ, meṣaḥ, vṛṣṇiḥ, eḍakaḥ, uramraḥ
subhagāsutaḥ2.6.24MasculineSingular‍saubhāgineyaḥ
sudharmāFeminineSingulardevasabhāthe council of gods
sukarā2.9.71FeminineSingularpareṣṭukā
śuklaḥ1.5.12MasculineSingulardhavalaḥ, sitaḥ, śyetaḥ, śuciḥ, valakṣaḥ, avadātaḥ, viśadaḥ, śubhraḥ, arjunaḥ, gauraḥ, pāṇḍaraḥ, śvetaḥwhite
śukram2.6.62NeuterSingularbījam, vīryam, indriyam, tejaḥ, retaḥ
śunakaḥ2.10.22MasculineSingularmṛgadaṃśakaḥ, bhaṣakaḥ, śvā, kauleyakaḥ, sārameyaḥ, kukkuraḥ
śuṇḍī2.9.38FeminineSingularmahauṣadham, ‍viśvam, nāgaram, viśvabheṣajam
sūraḥ1.3.28-30MasculineSingularsahasrāṃśuḥ, raviḥ, chāyānāthaḥ, jagaccakṣuḥ, pradyotanaḥ, lokabāndhavaḥ, aryamā, dhāmanidhiḥ, divākaraḥ, braghnaḥ, bhāsvān, haridaśvaḥ, arkaḥ, aruṇaḥ, taraṇiḥ, virocanaḥ, tviṣāṃpatiḥ, haṃsaḥ, savitā, tejasāṃrāśiḥ, karmasākṣī, trayītanuḥ, khadyotaḥ, sūryaḥ, bhagaḥ, dvādaśātmā, abjinīpatiḥ, ahaskaraḥ, vibhākaraḥ, saptāśvaḥ, vikartanaḥ, mihiraḥ, dyumaṇiḥ, citrabhānuḥ, grahapatiḥ, bhānuḥ, tapanaḥ, padmākṣaḥ, tamisrahā, lokabandhuḥ, dinamaṇiḥ, inaḥ, ādityaḥ, aṃśumālī, bhāskaraḥ, prabhākaraḥ, vivasvān, uṣṇaraśmiḥ, mārtaṇḍaḥ, pūṣā, mitraḥ, vibhāvasuḥ, aharpatiḥ(53)the sun
sūtaḥ3.3.68MasculineSingularnīvṛdviśeṣaḥ, samaraḥ, nṛtyasthānam
śvaḥśreyasamNeuterSingularśivam, kuśalam, bhāvukam, kalyāṇam, śastam, bhavyam, śubham, bhadram, kṣemam, bhavikam, maṅgalamhappy, well,or right
svāmī3.1.8MasculineSingularprabhuḥ, adhibhūḥ, īśvaraḥ, adhipaḥ, ne, īśitā, parivṛḍhaḥ, nāyakaḥ, patiḥ
svarvaidyauMasculineDualnāsatyau, aśvinau, dasrau, āśvineyau, aśvinīsutauashvin
śvetasurasāFeminineSingularbhūtaveśī
śyāmā2.2.55FeminineSingulargovandanī, priyakaḥ, viśvakse, priyaṅguḥ, latā, kārambhā, phalā, gundrā, mahilāhvayā, gandhaphalī, phalinī
śyāmāFeminineSingularpālindī, suṣeṇikā, kālā, masūravidalā, ardhacandrā, kālameṣikā
syūta2.9.27MasculineSingularprasevaḥ
talam3.3.210MasculineSingularnirṇītam, ekaḥ, kṛtsnam
tālamālam2.9.104NeuterSingulargaireyam, arthyam, girijam, aśmajam
talpam3.3.138NeuterSingularkūrmī, vīṇābhedaḥ
tamas1.3.26NeuterSingularsaiṃhikeyaḥ, vidhuntudaḥ, rāhuḥ, svarbhānuḥthe acending node
tantraḥ3.3.193NeuterSingularrājakaśe
tāraḥ3.3.174MasculineSingularmakheṣuyūpakhaṇḍaḥ
tarjanī2.6.82FeminineSingularpradeśinī
tilakam2.6.124NeuterSingularcitrakam, viśeṣakam, tamālapatram
tilam2.9.19MasculineSingulartilapejaḥ
tiniśaḥ2.4.26MasculineSingularnemiḥ, rathadruḥ, atimuktakaḥ, vañjulaḥ, citrakṛt, syandanaḥ
totram2.8.41NeuterSingularveṇukam
trasaraḥ2.4.24MasculineSingularsūtraveṣṭanam
tūlikā2.10.33FeminineSingulareṣikā
tunnaḥMasculineSingularkuṇiḥ, kacchaḥ, kāntalakaḥ, nandivṛkṣaḥ, kuberakaḥ
tyāgaḥ2.7.31MasculineSingularaṃhatiḥ, prādeśanam, vitaraṇam, utsarjanam, apavarjanam, pratipādanam, viśrāṇanam, dānam, nirvapaṇam, sparśanam, visarjanam, vihāyitam
uccāvacam3.1.81MasculineSingularekabhedam
ucchāyaḥMasculineSingularutsedhaḥ, ucchrayaḥ
udajaḥ2.4.39MasculineSingularpaśupreraṇam
udāraḥ3.3.200MasculineSingulardrumaprabhedaḥ, mātaṅgaḥ, kāṇḍaḥ, puṣpam
udgiraṇam3.3.61NeuterSingularsūryaḥ, devaḥ
udumbaraḥMasculineSingularjantuphalaḥ, yajñāṅgaḥ, hemadugdhaḥ
ukṣā2.9.60MasculineSingularsaurabheyaḥ, ba‍līvardaḥ, ‍gauḥ, ṛṣabhaḥ, ‍vṛṣabhaḥ, ‍vṝṣaḥ, anaḍvān, ‍bhadraḥ
ulūkaḥ2.5.16MasculineSingularpecakaḥ, divāndhaḥ, kauśikaḥ, ghūkaḥ, divābhītaḥ, vāyasārātiḥ, niśāṭanaḥ
umā1.1.44FeminineSingularkātyāyanī, haimavatī, bhavānī, sarvamaṅgalā, durgā, ambikā, girijā, cāmuṇḍā, gaurī, īśvarī, rudrāṇī, aparṇā, mṛḍānī, āryā, menakātmajā, carmamuṇḍā, kālī, śivā, śarvāṇī, pārvatī, caṇḍikā, dākṣāyaṇī, karmamoṭī, carcikābhavaani
upabhogaḥ2.4.20MasculineSingularnirveśaḥ
upalā3.3.207FeminineSingularsasyam, hetukṛtam
upaskaraḥ2.9.35MasculineSingular‍vesavāraḥ
uśīramMasculineSingularlaghulayam, amṛṇālam, abhayam, iṣṭakāpatham, lāmajjakam, sevyam, avadāham, jalāśayam, naladam
uta3.3.251MasculineSingularprakāśaḥ, ādiḥ, samāptiḥ, hetuḥ, prakaraṇam
va2.4.9MasculineSingularevam, , yathā, tathā, eva
vaiṇivikā2.10.13MasculineSingular‍veṇudhmaḥ
vairamNeuterSingularvirodhaḥ, vidveṣaḥenmity
vakramNeuterPluralpuṭabhedaḥa winding decent of water
valiraḥ2.6.49MasculineSingularkekaraḥ
vāmaḥ3.3.152MasculineSingulardevaraḥ, śyālaḥ
vaṃśaḥMasculineSingulartejanaḥ, yavaphalaḥ, tvacisāraḥ, maskaraḥ, śataparvā, karmāraḥ, veṇuḥ, tṛṇadhvajaḥ, tvaksāraḥ
vaṃśarocanā2.9.110FeminineSingularśvetamaricam
vanam3.3.133NeuterSingularve, śūraḥ
varaṇaḥMasculineSingularsetuḥ, tiktaśākaḥ, kumārakaḥ, varuṇaḥ
vardhanam03.04.2007NeuterSingularchedanam
varṇaḥ3.3.54MasculineSingulargrāmādhipaḥ, nāpitaḥ, śreṣṭhaḥ
vāsitā3.3.82FeminineSingularhetuḥ, lakṣma
vaśyaḥ3.1.23MasculineSingularpraṇeyaḥ
‍vellitaḥ3.1.86MasculineSingularpreṅkhitaḥ, ādhūtaḥ, calitaḥ, ākampitaḥ, dhutaḥ
veṇī2.2.69FeminineSingularkharā, garī, devatāḍaḥ, jīmūtaḥ
veṇiḥ2.6.99FeminineSingularpraveṇī
veśaḥMasculineSingularveśyājanasamāśrayaḥ
vibhāvasuḥ3.3.234MasculineSingulardhanam, devabhedaḥ, analaḥ, raśmiḥ, ratnam
vicikitsāFeminineSingularsaṃśayaḥ, sandehaḥ, dvāparaḥdoubt
vidheyaḥ3.1.23MasculineSingularvinayagrāhī, vacanesthitaḥ, āśravaḥ
vidhuram2.4.20NeuterSingularpraviśleṣaḥ
vīkāśaḥ3.3.223MasculineSingularekavidhā, avasthānam
vilāpaḥ1.6.16MasculineSingularparivedanamlamentation
vimātṛjaḥ2.6.25MasculineSingularvaimātreya
vināyakaḥMasculineSingulargaṇādhipaḥ, ekadantaḥ, herambaḥ, lambodaraḥ, vighnarājaḥ, gajānanaḥ, dvaimāturaḥganesh
vipraḥ2.7.4MasculineSingularvāḍavaḥ, brāhmaṇaḥ, dvijātiḥ, agrajanmā, bhūdevaḥ
virocanaḥ3.3.115MasculineSingularmūrtaḥ, nirantaraḥ, meghaḥ, mūrtiguṇaḥ
viśalyā3.3.163FeminineSingularharmyādeḥprakoṣṭhaḥ, kañcī, madhyebhabandhanam
viṣam3.3.231NeuterSingularse, arthanā, bhṛtiḥ
viṣṇuḥ1.1.18-21MasculineSingularadhokṣajaḥ, vidhuḥ, yajñapuruṣaḥ, viśvarūpaḥ, vaikuṇṭhaḥ, hṛṣīkeśaḥ, svabhūḥ, govindaḥ, acyutaḥ, janārdanaḥ, cakrapāṇiḥ, madhuripuḥ, devakīnandanaḥ, puruṣottamaḥ, kaṃsārātiḥ, kaiṭabhajit, purāṇapuruṣaḥ, jalaśāyī, muramardanaḥ, kṛṣṇaḥ, dāmodaraḥ, mādhavaḥ, puṇḍarīkākṣaḥ, pītāmbaraḥ, viśvaksenaḥ, indrāvarajaḥ, padmanābhaḥ, trivikramaḥ, śrīpatiḥ, balidhvaṃsī, viśvambharaḥ, śrīvatsalāñchanaḥ, narakāntakaḥ, mukundaḥ, nārāyaṇaḥ, viṣṭaraśravāḥ, keśavaḥ, daityāriḥ, garuḍadhvajaḥ, śārṅgī, upendraḥ, caturbhujaḥ, vāsudevaḥ, śauriḥ, vanamālī(45)vishnu, the god
vitardiḥFeminineSingularvedikā
vīthīFeminineSingularāliḥ, āvaliḥ, paṅktiḥ, śreṇī
vivadhaḥ3.3.103MasculineSingulardoṣotpādaḥ, prakṛtyādivinaśvaraḥ(vyākaraṇe), mukhyānuyāyīśiśuḥ, prakṛtasyānuvartanam
vivasvataḥ3.3.64MasculineSingularmeghaḥ, parvataḥ
vṛkṣādanī2.10.34MasculineSingularvṛkṣabhe
vṛṣākapāyī3.3.164FeminineSingularkriyā, devatā, dhanādibhiḥbhedyaḥ
vyadhaḥ03.04.2008MasculineSingularvedhaḥ
vyāghrapucchaḥ2.2.50MasculineSingularvyaḍambakaḥ, pañcāṅgulaḥ, rucakaḥ, gandharvahastakaḥ, varddhamānaḥ, cañcuḥ, erubūkaḥ, maṇḍaḥ, citrakaḥ, eraṇḍaḥ
vyājaḥMasculineSingularapadeśaḥ, lakṣyamdisguise
vyālaḥ3.3.204MasculineSingularśilpam, kālabhedaḥ
vyutthānam3.3.125NeuterSingulartithibhedaḥ, kṣaṇaḥ
yatiḥ2.7.47MasculineSingularnirjitendriyagrāmaḥ, yatī
yātrā3.3.183FeminineSingularsaraghā, kaṇṭakārikā, krūraḥ, vyaṅgā, adhanaḥ, naṭī, alpaḥ, veśyā
yāvāgū2.9.50FeminineSingularśrāṇā, ‍vile, taralā, uṣṇikā
gaṇadevatāḥ1.1.10MasculinePluraldivinity,coming from aadityas
devayonayaḥ1.1.11FemininePluraldemigods
vasudevaḥ1.1.22MasculineSingularvasudeva, father of krishna
kārtikeyaḥMasculineSingularmahāsenaḥ, kumāraḥ, śikhivāhanaḥ, bāhuleyaḥ, senānīḥ, ṣaḍānanaḥ, śaktidharaḥ, viśākhaḥ, guhaḥ, skandaḥ, śarajanmā, krauñcadāruṇaḥ, ṣāṇmāturaḥ, tārakajit, agnibhūḥ, pārvatīnandanaḥkaarttik
meruḥ1.1.52MasculineSingularsumeruḥ, hemādriḥ, ratnasānuḥ, surālayaḥmountain
devataruḥ1.1.53-55MasculineSingularcelestial tree
pracetāḥ1.1.63MasculineSingularpāśī, yādasāmpatiḥ, appatiḥ, varuṇaḥvaruna
kuberaḥ1.1.68-69MasculineSingularekapiṅgaḥ, paulastyaḥ, dhanādhipaḥ, manuṣyadharmā, tryambakasakhaḥ, śrīdaḥ, yakṣaḥ, vaiśravaṇaḥ, rājarājaḥ, guhyakeśvaraḥ, aiḍaviḍaḥ, naravāhanaḥ, kinnareśaḥ, dhanadaḥ, yakṣarāṭ, puṇyajaneśvaraḥkuber
meghajyotiḥMasculineSingularirammadaḥa flash of lighting
rauhiṇeyaḥMasculineSingularbudhaḥ, saumyaḥmercury
pariveṣaḥ1.3.32MasculineSingularparidhiḥ, upasūryakam, maṇḍalamhalo
hemantaḥMasculineSingularhementa
śvaḥśreyasamNeuterSingularśivam, kuśalam, bhāvukam, kalyāṇam, śastam, bhavyam, śubham, bhadram, kṣemam, bhavikam, maṅgalamhappy, well,or right
hetuḥMasculineSingularkāraṇam, bījamcause
kṣetrajñaḥMasculineSingularātmā, puruṣaḥthe soul
medhāFeminineSingularretentive intellect
karmendriyamNeuterSingularpādaḥ, pāyuḥ, upasthaḥ, vāk, pāṇiḥorgan of action
śruteraṅgamNeuterSingularone of the vedanga among six
āmreḍitamNeuterSingulardvistriruktamrepettition
sandeśavācFeminineSingularvācikammessage
bheFeminineSingularānakaḥ, dundubhiḥa kettle drum
vādyaprabhedāḥMasculinePluralpaṇavaḥ, ḍamaruḥ, maḍḍuḥ, ḍiṇḍimaḥ, jharjharaḥ, mardavaḥa sort of small drum shaped like an hour-glass and generally used by kaapaalikas
deFeminineSingulara queen
haṇḍeFeminineSingularappropriate vocative for female servant
hañjeFeminineSingularappropriate vocative for female servant
preMasculineSingularprema, snehaḥ, priyatā, hārdamafllection or kindness
saṃvegaḥMasculineSingularsambhramaḥhurry
vepathuḥMasculineSingularkampaḥa tremour
śeṣaḥMasculineSingularanantaḥsnake
kṣveḍaḥ1.8.9MasculineSingularviṣam, garalamthe venom of a snake
viṣabhedāḥ1.8.10MasculinePluralone of the poison among nine
narakabhedāḥ1.9.1MasculinePluraldifferent types of hell
pretāḥMasculinePluraldeparted soul
bhekaḥMasculineSingularmaṇḍūkaḥ, varṣābhūḥ, śālūraḥ, plavaḥ, darduraḥa frog
bheFeminineSingularvarṣābhvīa female frog
nemiḥFeminineSingulartrikāthe land near to the well
veśantaḥMasculineSingularpallavam, alpasaramsmall pond
kheyamNeuterSingularparikhāa moat or ditch
re1.10.32FeminineSingularnarmadā, somodbhavā, mekalakanyakānarmada(river)
saṃbhedaḥMasculineSingularsindhusaṅgamaḥthe mouth of a river
madhyadeśaḥ2.1.7MasculineSingularmadhyamaḥ
deśaḥ2.1.8MasculineSingularviṣayaḥ, upavartanam
vetasvān2.1.9MasculineSingular
nadīmātṛkaḥ add devamātṛkaḥ both are different2.1.12MasculineSingular
devamātṛkaḥMasculineSingular
setuḥMasculineSingularāliḥ
veśaḥMasculineSingularveśyājanasamāśrayaḥ
āveśanamNeuterSingularśilpiśālā
īśvarasadmaprabhedāḥ2.2.10MasculinePlural
niśreṇiḥFeminineSingularadhirohaṇī
sanniveśaḥMasculineSingularnikarṣaṇaḥ
veśmabhūḥ2.2.19FeminineSingularvāstuḥ
devakhātamNeuterSingularbilam, guhā, gahvaram
lekhāFeminineSingularrājiḥ
vetasaḥ2.4.29MasculineSingularvānīraḥ, vañjulaḥ, rathaḥ, abhrapuṣpaḥ, bidulaḥ, śītaḥ
śeluḥ2.4.34MasculineSingularśleṣmātakaḥ, śītaḥ, uddālaḥ, bahuvārakaḥ
nādeFeminineSingularbhūmijambukā
kākenduḥMasculineSingularkulakaḥ, kākapīlukaḥ, kākatindukaḥ
arimedaḥ2.2.50MasculineSingularviṭkhadiraḥ
cāmpeyaḥ2.2.63MasculineSingularcampakaḥ, hemapuṣpakaḥ
kesaraḥ2.2.64MasculineSingularvakulaḥ
cāmpeyaḥ2.2.65MasculineSingularkesaraḥ, nāgakesaraḥ, kāñcanāhvayaḥ
veṇī2.2.69FeminineSingularkharā, garī, devatāḍaḥ, jīmūtaḥ
śephālikāFeminineSingularnīlikā, suvahā, nirguṇḍī
śvetasurasāFeminineSingularbhūtaveśī
hemapuṣpikāFeminineSingular
saireyakaḥMasculineSingularjhiṇṭī
śāleyaḥMasculineSingularśītaśivaḥ, chatrā, madhurikā, misiḥ, miśreyaḥ
vellamNeuterSingularcitrataṇḍulā, taṇḍulaḥ, kṛmighnaḥ, viḍaṅgam, amoghā
tuṇḍikeFeminineSingularsamudrāntā, kārpāsī, badarā
gāṅgerukīFeminineSingularnāgabālā, jhaṣā, hrasvagavedhukā
tuṇḍikeFeminineSingularraktaphalā, bimbikā, pīluparṇī
cāṅgeFeminineSingularcukrikā, dantaśaṭhā, ambaṣṭhā, amlaloṇikā
sahasravedhīFeminineSingularamlavetasaḥ, śatavedhī, cukraḥ
viṣvaksenapriyāFeminineSingularbadarā, gṛṣṭiḥ, vārāhī
kāravellaḥMasculineSingularkaṭillakaḥ, suṣavī
śākabhedāḥMasculineSingular
nārikelaḥ1.4.168MasculineSingularlāṅgalī
udvegam2.4.169NeuterSingular
aiṇeyamMasculineSingular
karkareṭuḥ2.5.21MasculineSingularkareṭuḥ
ke2.5.33FeminineSingular
peśī2.5.40Ubhaya-lingaSingularaṇḍam, koṣaḥ
vṛndabhedāḥMasculinePlural
chekaḥ2.2.45MasculineSingulargṛhyakaḥ
agredidhiṣūḥ2.6.23MasculineSingular
pārastraiṇeyaḥ2.6.24MasculineSingular
paitṛṣvaseyaḥ2.6.25MasculineSingularpaitṛṣvasrīya
bāndhakineyaḥ2.6.26MasculineSingularbandhulaḥ, asatīsutaḥ, ‍kaulaṭeraḥ, ‍kaulaṭeyaḥ
kaulaṭineyaḥ2.6.26MasculineSingular‍kaulaṭeyaḥ
devaraḥ2.6.32MasculineSingulardevāḥ
bhāgineyaḥ2.6.32MasculineSingularsvasrīya
jñāteyam2.6.35NeuterSingular
keśavaḥ2.6.45MasculineSingularkeśikaḥ, keśī
bheṣajam2.6.50NeuterSingularjāyuḥ, auṣadham, bhaiṣajyam, agadaḥ
śleṣmalaḥ2.6.61MasculineSingularśleṣmaṇaḥ, kaphī
medaḥ2.6.65NeuterSingularvasā, vapā
kaśerukā2.6.70FeminineSingular
pradeśinī2.6.83FeminineSingular
prādeśaḥ2.6.84MasculineSingular
capeṭaḥ2.6.84MasculineSingularpratalaḥ, prahastaḥ
keśaḥ2.6.96MasculineSingularkacaḥ, śiroruhaḥ, cikuraḥ, kuntalaḥ, bālaḥ
veṇiḥ2.6.99FeminineSingularpraveṇī
nepathyam2.6.100MasculineSingularākalpaḥ, veṣaḥ, pratikarma, prasādhanam
graiveyakam2.6.105NeuterSingularkaṇṭhabhūṣā
hārabhedaḥ2.6.106MasculineSingular
keyūram2.6.108NeuterSingularaṅgadam
mekhalā2.6.109FeminineSingularkāñcī, saptakī, raśanā, sārasanam
kauśeyam2.6.112MasculineSingularkṛmikośottham
sucelakaḥ2.6.117MasculineSingularpaṭaḥ
patralekhā2.6.123FeminineSingularpattrāṅguliḥ
gātrānulepanī1.2.134FeminineSingularvarttiḥ
śekharaḥ1.2.137MasculineSingularāpīḍaḥ
sarvavedāḥ2.7.11MasculineSingular
vediḥ2.7.20FeminineSingular
tre2.7.21FeminineSingular
sāmidhe2.7.24FeminineSingulardhāyyā
paryeṣaṇā2.7.34FeminineSingularparīṣṭiḥ
adhyeṣaṇā2.7.35FeminineSingularsaniḥ
āveśikaḥ2.7.36MasculineSingularāgantuḥ, atithiḥ
vivekaḥ2.7.42MasculineSingularpṛthagātmatā
tapaḥkleśasahaḥ2.7.46MasculineSingulardāntaḥ
parivettā2.7.59MasculineSingular
maṇḍaleśvaraḥ2.8.2MasculineSingular
sevakaḥ2.8.9MasculineSingulararthī, anujīvī
lekhakaḥ2.8.15MasculineSingularakṣaracaṇaḥ, akṣaracuñcuḥ, lipiṃkaraḥ
nītivedināṃ trivargaḥ2.8.19MasculineSingular
bhedaḥ2.8.20MasculineSingularupajāpaḥ
bhreṣaḥ2.8.23MasculineSingular
nirdeśaḥ2.8.25MasculineSingularavavādaḥ, nideśaḥ, śāsanam, śiṣṭiḥ, ājñā
senāṅgam2.8.34NeuterSingular
praveṇī2.8.43FeminineSingularvarṇaḥ, paristomaḥ, ‍kuthaḥ, āstaraṇam
ājāneyaḥ2.8.44MasculineSingular
aśvamedhīyaḥ2.8.45MasculineSingularyayuḥ
hreṣā2.8.48FeminineSingularheṣā
nemiḥ2.8.56FeminineSingularpradhiḥ
senānīḥ2.8.63MasculineSingularvahinīpatiḥ
asihetiḥ2.8.71MasculineSingularnaistriṃśikaḥ
agresaraḥ2.8.73MasculineSingularpurogamaḥ, purogāmī, purogaḥ, praṣṭhaḥ, agrataḥsaraḥ, puraḥsaraḥ
ve2.8.74MasculineSingulartvaritaḥ, prajavī, javanaḥ, javaḥ, tarasvī
jeyaḥ2.8.76MasculineSingular
je2.8.79MasculineSingularjiṣṇuḥ, jitvaraḥ
se2.8.79FeminineSingularsainyam, camūḥ, ‍vāhinī, anīkam, balam, anīkanī, dhvajinī, cakram, ‍varūthinī, pṛtanā
mekhalā2.8.91FeminineSingular
senābhigamanam2.8.96NeuterSingular
se2.9.2FeminineSingularśvavṛttiḥ
vraiheyaśāleyam2.9.6MasculineSingular
kṣetram2.9.11NeuterSingular‍kedāraḥ, vapraḥ
medhiḥ2.9.15MasculineSingularkhaledāru
vrīhibhedaḥ2.9.21MasculineSingular
gavedhuḥ2.9.25FeminineSingulargavedhukā
velljam2.9.36NeuterSingularkṛṣṇam, ūṣaṇam, dharmapattanam, marīcam, kolakam
uttemanam2.9.45NeuterSingularniṣṭhānam
sarvarasāgre2.9.49MasculineSingularmaṇḍam
phe2.9.57FeminineSingular‍bhuktasamujjhitam
skandadeśaḥ2.9.64MasculineSingular‍galakambalaḥ
vṛṣabhedaḥ2.9.65MasculineSingularhālikaḥ
māhe2.9.67FeminineSingular
varṇabhedaḥ2.9.68MasculineSingulardvihāyanī
prajane2.9.71FeminineSingularbālagarbhiṇī
meḍhraḥ2.9.77MasculineSingularkrayavikrayikaḥ, ‍naigamaḥ, vāṇijaḥ, vaṇik, ‍paṇyājīvaḥ, āpaṇikaḥ, ‍sārthavāhaḥ
vaidehakaḥ2.9.79MasculineSingularvikrayikaḥ
vikre2.9.80MasculineSingularkrāyakaḥ
kreyam2.9.82MasculineSingularpaṇitavyam, paṇyam
vikreyam2.9.83MasculineSingular‍satyākṛtiḥ, ‍satyaṅkāraḥ
meṣakambalam2.9.108MasculineSingular‍śaśaloma
bhūtakeśaḥ2.9.112MasculineSingularraktacandanam
vaidehakaḥ2.10.3MasculineSingular
śreṇī2.10.5MasculineSingular
devalaḥ2.10.11MasculineSingulardevājīvaḥ
ve2.10.28FeminineSingularvāpadaṇḍaḥ
carmaprasevikā2.10.33FeminineSingularbhastrā
carmaprabhedikā2.10.35NeuterSingularārā
mahecchaḥ3.1.1MasculineSingularmahāśayaḥ
vārāṅgarūpopetaḥ3.1.11MasculineSingularsiṃhahananaḥ
vidheyaḥ3.1.23MasculineSingularvinayagrāhī, vacanesthitaḥ, āśravaḥ
devānañcitaḥ3.1.32MasculineSingular
dveṣyaḥ3.1.43MasculineSingularkaśārhaḥ
viṣeṇaḥ3.1.44MasculineSingular
karṇejapaḥ3.1.45MasculineSingularsūcakaḥ
svedjāḥ3.1.50MasculineSingular
śreṣṭhaḥ3.1.58MasculineSingularpuṣkalaḥ, sattamaḥ, atiśobhanaḥ, śreyān
pelavam3.1.66MasculineSingularviralam, tanu
‍vellitaḥ3.1.86MasculineSingularpreṅkhitaḥ, ādhūtaḥ, calitaḥ, ākampitaḥ, dhutaḥ
preritaḥ3.1.86MasculineSingularkṣiptaḥ, nuttaḥ, nunnaḥ, astaḥ, niṣṭhyūtaḥ, āviddhaḥ
udgūrṇodyate3.1.88MasculineSingularudyataḥ
veṣṭitam3.1.90MasculineSingularruddham, āvṛtam, valayitam, saṃvītam
tejitaḥ3.1.90MasculineSingularśātaḥ, niśitaḥ, kṣṇutaḥ
vedhitaḥ3.1.98MasculineSingularchidritaḥ, viddhaḥ
anveṣitam3.1.105MasculineSingularmṛgitam, gaveṣitam, anviṣṭam, mārgitam
kṣepiṣṭhaḥMasculineSingular
hetuśūnyā3.2.2FeminineSingularvilakṣaṇam
sevanam03.04.2005NeuterSingularsīvanam, syūtiḥ
samvedaḥ03.04.2006MasculineSingularvedanā
kṣepaṇam3.4.11NeuterSingularkṣipā
udvegaḥ3.4.12MasculineSingularudbhramaḥ
saṃkṣepaṇam2.4.21NeuterSingularsamasanam
avekṣā2.4.28FeminineSingularpratijāgaraḥ
melakaḥ2.4.29MasculineSingularsaṅgaḥ, saṅgamaḥ
niṣṭhevanam2.4.38NeuterSingularniṣṭhyūtiḥ, niṣṭhīvanam, niṣṭhevaḥ
bhe3.3.3FeminineSingularmārutaḥ, vedhāḥ, bradhnaḥ
pecakaḥ3.3.6MasculineSingularekadeśaḥ, pratikūlaḥ
dhenukā3.3.15FeminineSingularmukhyaḥ, anyaḥ, kevalaḥ
peṭakaḥ3.3.20MasculineSingularstrīdhanam
deśikaḥ3.3.20MasculineSingularkallolam
kheṭakaḥ3.3.20MasculineSingularbhāvaḥ, vṛndaḥ
vegaḥ3.3.25MasculineSingularsṛṣṭiḥ, svabhāvaḥ, nirmokṣaḥ, niścayaḥ, adhyāsaḥ
kṣetrajñaḥ3.3.39MasculineSingulardevaśilpī
jyeṣṭhaḥ3.3.47MasculineSingulargauḥ, bhūḥ, vāk
kṣveḍā3.3.49FeminineSingular
kareṇuḥ3.3.58FeminineSingularpramātā, hetuḥ, maryādā, śāstreyattā
dhūmaketuḥ3.3.65MasculineSingulardhātā, poṣṭā
pretaḥ3.3.66MasculineSingularbhūpaḥ
ketuḥ3.3.67MasculineSingularstrīkusumam
tre3.3.75FeminineSingularkṣayaḥ, vāsaḥ
hetiḥ3.3.77FeminineSingularpakṣamūlam
śvetam3.3.86MasculineSingularbaddhaḥ, arjunaḥ
utsedhaḥ3.3.103MasculineSingularsamarthanam, nīvākaḥ, niyamaḥ
ketanam3.3.121NeuterSingularlokavādaḥ, paśvahipakṣiṇāṃyuddham
devanam3.3.124NeuterSingularvipat, bhraṃśaḥ, kāmajaḥdoṣaḥ, krodhajaḥdoṣaḥ
gāṅgeyam3.3.163NeuterSingularpratibimbam, anātapaḥ, sūryapriyā, kāntiḥ
netram3.3.188NeuterSingularviṣayaḥ, kāyaḥ
kṣetram3.3.188NeuterSingularvāsāḥ, vyoma
ve3.3.206FeminineSingularśiphā, bham, ādyam
kevalam3.3.211MasculineSingulardakṣaḥ, cāruḥ
peśalaḥ3.3.213MasculineSingularmantrī, sahāyaḥ
nirveśaḥ3.3.223MasculineSingulartṛṣṇā, āyatā
apadeśaḥ3.3.224MasculineSingularjñātā, jñānam
prekṣā3.3.232FeminineSingularaprema, acikkaṇaḥ
vedhā3.3.236MasculineSingulardyauḥ, bhūḥ
tejaḥ3.3.242NeuterSingularvaraḥ, uruḥ
pretya2.4.8MasculineSingularamutra
cet2.4.12MasculineSingularyadi
ubhayedyuḥ2.4.21MasculineSingularubhayadyuḥ
śeफ़ाlikā3.5.7FeminineSingular
meghaḥ3.5.11MasculineSingular
keśaḥ3.5.12MasculineSingular
śrīveṣṭaḥ3.5.13MasculineSingular
kedaraḥ3.5.20MasculineSingular
vetālaḥ3.5.21MasculineSingular
vājapeyam3.5.31NeuterSingular
kṣveḍitam3.5.34MasculineSingular
kṣemaḥ3.5.34MasculineSingular
se3.5.40MasculineSingular
nṛsenam3.5.40MasculineSingular
Monier-Williams Search
25941 results for e
Devanagari
BrahmiEXPERIMENTAL
ethe eleventh vowel of the alphabet (corresponding to the lettereas pronounced inprey,grey). View this entry on the original dictionary page scan.
eind. an interjection View this entry on the original dictionary page scan.
eind. a particle of recollection View this entry on the original dictionary page scan.
eind. addressing View this entry on the original dictionary page scan.
eind. censure View this entry on the original dictionary page scan.
eind. contempt View this entry on the original dictionary page scan.
eind. compassion View this entry on the original dictionary page scan.
em. viṣṇu- View this entry on the original dictionary page scan.
e( ā-i-) P. -eti-, to come near or towards, go near, approach etc. ; (with and without punar-) to come back, come again to etc. ; to reach, attain, enter, come into (a state or position) etc. ; to submit, fall to one's share (āyayanti-?) : Intensive A1. (3. dual number -iyāte-;1. plural -īmahe-) to hasten near ; to request View this entry on the original dictionary page scan.
edind. (according to to some = 2. ā-+ /id-) behold! (followed by a particular with an accusative and preceded by a verb of motion, e. gaRa /eyāya- vāy/ur- / ed- dhat-/ am- vṛtrā- m-,"Vayur went [to see, and] behold vṛtra- was slain"; sometimes the verb of motion must be supplied, sometimes the substantive, and sometimes the participle), View this entry on the original dictionary page scan.
eḍam. a kind of sheep View this entry on the original dictionary page scan.
eḍamfn. deaf View this entry on the original dictionary page scan.
eḍagajam. the plant Cassia Tora or Alata (used for the cure of ringworm) View this entry on the original dictionary page scan.
eḍakam. a kind of sheep, ram, wild goat etc. View this entry on the original dictionary page scan.
eḍakam. a kind of medicinal plant View this entry on the original dictionary page scan.
eḍakaf(ā-, ikā-). (ā- gaRa ajādi- ikā-) the female of the above sheep, a ewe (see aiḍaka-.) View this entry on the original dictionary page scan.
eḍakīyaNom. P. eḍakīyati-, to behave like a sheep on View this entry on the original dictionary page scan.
eḍamūkam. deaf and dumb View this entry on the original dictionary page scan.
eḍamūkam. blind View this entry on the original dictionary page scan.
eḍamūkam. wicked, perverse View this entry on the original dictionary page scan.
edh cl.1 A1. /edhate- (rarely P. -ti-), edhāṃ-cakre-, edhitā-, edhiṣyate-, aidhiṣṭa-, to prosper, increase, become happy, grow strong ; to grow big with self-importance, become insolent ; to become intense, extend, spread, gain ground (as fire or passions) ; to swell, rise (as waters) : Causal edhayati-, to cause to prosper or increase, wish for the welfare or happiness (of any one), bless View this entry on the original dictionary page scan.
edhāf. idem or 'n. happiness, prosperity ' View this entry on the original dictionary page scan.
edham. ( indh-), fuel
edhamfn. in fine compositi or 'at the end of a compound' kindling See agny-edha- View this entry on the original dictionary page scan.
edhamfn. ([ confer, compare Greek , ; Hibernian or Irish aodh; O. H. G.eit; Anglo-Saxon a7d.]) View this entry on the original dictionary page scan.
edhamānamfn. (present tense parasmE-pada of edh-). View this entry on the original dictionary page scan.
edhamānadviṣmfn. hating those who have become insolent or impious (through prosperity) View this entry on the original dictionary page scan.
edhanīyamfn. to be increased or enlarged. View this entry on the original dictionary page scan.
edhasn. happiness, prosperity View this entry on the original dictionary page scan.
edhasn. fuel View this entry on the original dictionary page scan.
edhatumf. (for 2.See), us- prosperity, happiness etc. View this entry on the original dictionary page scan.
edhatum. (us-) man View this entry on the original dictionary page scan.
edhatumfn. increased, grown View this entry on the original dictionary page scan.
edhatu(for. 1.See) m. fire ; ([ confer, compare Latin aestus.]) View this entry on the original dictionary page scan.
edhavatmfn. kept up with fuel (as fire) View this entry on the original dictionary page scan.
edhinif. the earth (= medinī-), View this entry on the original dictionary page scan.
edhitamfn. grown, increased, enlarged, made big, made to spread, filled up View this entry on the original dictionary page scan.
edhitṛmfn. one who increases etc. View this entry on the original dictionary page scan.
edhodakan. fuel and water View this entry on the original dictionary page scan.
eḍīf. a female sheep, ewe View this entry on the original dictionary page scan.
eḍīf. Name of a woman in the retinue of skanda- View this entry on the original dictionary page scan.
edidhiṣuḥpatim. the husband of a younger sister whose elder sister has not yet been married (see agre-didhiṣu-and didhiṣu-.) View this entry on the original dictionary page scan.
eḍikākṣīf. Name of a certain plant (equals eḍa-gaja-?) commentator or commentary on View this entry on the original dictionary page scan.
eḍokan. idem or '(and eḍuka- ) m. (n. ) a building constructed of or enclosing rubbish or bones or hard substances resembling bones, a Buddhist shrine (filled with relics) (see buddhaiḍūka-).' View this entry on the original dictionary page scan.
eḍokamfn. deaf. View this entry on the original dictionary page scan.
eḍūka(and eḍuka- ) m. (n. ) a building constructed of or enclosing rubbish or bones or hard substances resembling bones, a Buddhist shrine (filled with relics) (see buddhaiḍūka-).
ehamf(ā-)n. desirous, wishing View this entry on the original dictionary page scan.
ehasn. anger View this entry on the original dictionary page scan.
ehasn. emulation, rivalry (see an-eh/as-.) View this entry on the original dictionary page scan.
ehi(imperative 2. sg. of ā-i-), come near! View this entry on the original dictionary page scan.
ehim. Name of a man gaRa śārṅgaravādi- View this entry on the original dictionary page scan.
ehibhikṣukāf. the call e- hi- bhikṣo-,"come, monk!", View this entry on the original dictionary page scan.
ehidvitīyāf. etc. gaRa mayūra-vyaṃsakādi-. View this entry on the original dictionary page scan.
ehikaṭāf. View this entry on the original dictionary page scan.
ehimāyamfn. () erroneous for /ahi-māya- ([ ]),of all-pervading intelligence View this entry on the original dictionary page scan.
ehimāyamfn. ([ hi mā yāsīr!' iti yad avocan&iencoding=iast&lang=sans'>yad vā saucīkam agnim apsu praviṣṭam 'ehi mā yāsīr!' iti yad avocan-, tadanukaraṇahetuko 'yaṃ viśveṣāṃ devānāṃ vyapadeśa ehimāyāsa iti- ]) View this entry on the original dictionary page scan.
ehivatmfn. containing the word ehi- View this entry on the original dictionary page scan.
ej cl.1 P. /ejati-, to stir, move, tremble, shake : cl.1 A1. ejate-, ejāṃ-cakre-, ejitā-, to shine : Causal P. A1. ejayati-, -te-, to agitate, shake View this entry on the original dictionary page scan.
ejanan. tremor, View this entry on the original dictionary page scan.
ejatmfn. (present tense parasmE-pada of the above) View this entry on the original dictionary page scan.
ejatn. (t-) anything moving or living View this entry on the original dictionary page scan.
ejathum. trembling, motion, shaking (of the earth) View this entry on the original dictionary page scan.
ejatkamfn. trembling, moving (the head) View this entry on the original dictionary page scan.
ejatkam. a kind of insect View this entry on the original dictionary page scan.
ejayamfn. causing to shake or tremble (forming irregular compounds with preceding accusative ; see janam-ejaya-). View this entry on the original dictionary page scan.
ejim. Name of a man gaRa kurv-ādi- ) View this entry on the original dictionary page scan.
ejitavyamfn. to be shaken. View this entry on the original dictionary page scan.
ejitṛmfn. a shaker, causing to tremble. View this entry on the original dictionary page scan.
ejyamf(ā-)n. (irregular future > Passive voice parasmE-pada fr. ā-yaj-) to be offered (as an oblation) View this entry on the original dictionary page scan.
ekamfn. ( i- ,probably fr. a base e-; confer, compare Zend ae-va; Greek , ; Gothic ai-n-s; also Latin aequu-s; gaRa sarvādi- ;See grammar 200) , one (eko'pi-,or ekaś-cana-,with na-preceding or following, no one, nobody;the words ekayā na-or ekān na-are used before decade numerals to lessen them by one exempli gratia, 'for example' ekān na triṃśat-,twenty-nine) etc. View this entry on the original dictionary page scan.
ekamfn. (with and without eva-) alone, solitary, single, happening only once, that one only (frequently in fine compositi or 'at the end of a compound'; see dharmaika-rakṣa-,etc.) etc. View this entry on the original dictionary page scan.
ekamfn. the same, one and the same, identical etc. View this entry on the original dictionary page scan.
ekamfn. one of two or many (eka-- eka-, eka-- dvitīya-,the one - the other; especially plural eke-,some, eke-- apare-some - others, etc.) etc. View this entry on the original dictionary page scan.
ekamfn. (eka-repeated twice, either as a compound[ see ekaika-]or uncompounded, may have the sense"one and one","one by one" etc.) View this entry on the original dictionary page scan.
ekamfn. single of its kind, unique, singular, chief, pre-eminent, excellent etc. View this entry on the original dictionary page scan.
ekamfn. sincere, truthful View this entry on the original dictionary page scan.
ekamfn. little, small View this entry on the original dictionary page scan.
ekamfn. (sometimes used as an indefinite article) , a, an etc. (the fem. of eka-before a taddhita- suffix and as first member of a compound is eka-not ekā- ) View this entry on the original dictionary page scan.
ekam. Name of a teacher View this entry on the original dictionary page scan.
ekam. of a son of raya- View this entry on the original dictionary page scan.
ef. Name of durgā- View this entry on the original dictionary page scan.
ekan. unity, a unit (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
ekābdāf. a heifer one year old. View this entry on the original dictionary page scan.
ekabhāgam. one part, one-fourth, View this entry on the original dictionary page scan.
ekabhakṣam. sole food. View this entry on the original dictionary page scan.
ekabhaktamf(ā-)n. devoted or faithful to only one (husband), faithful View this entry on the original dictionary page scan.
ekabhaktan. the eating only one meal (a day) View this entry on the original dictionary page scan.
ekabhaktif. idem or 'n. the eating only one meal (a day) ' View this entry on the original dictionary page scan.
ekabhaktikamfn. eating only one meal (a day) View this entry on the original dictionary page scan.
ekabhāvam. the being one, oneness View this entry on the original dictionary page scan.
ekabhāvam. simplicity, sincerity View this entry on the original dictionary page scan.
ekabhāvamfn. of the same nature, agreeing View this entry on the original dictionary page scan.
ekabhāvamfn. simple, sincere View this entry on the original dictionary page scan.
ekabhāvinmfn. becoming one, being combined View this entry on the original dictionary page scan.
ekabhogam. sole and entire right of enjoyment, View this entry on the original dictionary page scan.
ekabhogya n. sole and entire right of enjoyment, View this entry on the original dictionary page scan.
ekabhojanan. the eating only one meal (a day)
ekabhojanan. eating together View this entry on the original dictionary page scan.
ekabhojinmfn. eating only one meal (a day) View this entry on the original dictionary page scan.
ekabhūmikamfn. one-storied View this entry on the original dictionary page scan.
ekabhūtamfn. become one, concentrated (as the mind) View this entry on the original dictionary page scan.
ekabhūyan. the becoming one, union View this entry on the original dictionary page scan.
ekabhūyasmfn. having one over, odd, View this entry on the original dictionary page scan.
ekabuddhimfn. of one mind, unanimous View this entry on the original dictionary page scan.
ekabuddhimfn. "having only one idea", Name of a fish View this entry on the original dictionary page scan.
ekacakramf(ā-)n. having one wheel (said of the sun's chariot) View this entry on the original dictionary page scan.
ekacakramf(ā-)n. possessing only one army, governed by one king (as the earth) View this entry on the original dictionary page scan.
ekacakram. Name of a dānava- etc. View this entry on the original dictionary page scan.
ekacakrāf. Name of a town of the kīcaka-s View this entry on the original dictionary page scan.
ekacakram. the state of being sole master, supremacy (of a king) View this entry on the original dictionary page scan.
ekacakravartitāf. the state of revolving on one wheel (said of the sun) View this entry on the original dictionary page scan.
ekacakṣusmfn. one-eyed (said of an animal or of a needle). View this entry on the original dictionary page scan.
ekacandrāf. Name of one of the mothers in the retinue of skanda- View this entry on the original dictionary page scan.
ekacaramf(ā-)n. wandering or living alone, not living in company, solitary, segregarious View this entry on the original dictionary page scan.
ekacaramf(ā-)n. (said of certain animals) View this entry on the original dictionary page scan.
ekacaramf(ā-)n. (Name of a thief) View this entry on the original dictionary page scan.
ekacaramf(ā-)n. moving at the same time View this entry on the original dictionary page scan.
ekacaramf(ā-)n. Name of śiva-rudra- View this entry on the original dictionary page scan.
ekacaramf(ā-)n. of bala-deva- View this entry on the original dictionary page scan.
ekacaram. a rhinoceros View this entry on the original dictionary page scan.
ekacaraṇamfn. one-footed View this entry on the original dictionary page scan.
ekacaraṇam. plural Name of a fabulous race View this entry on the original dictionary page scan.
ekacārinmfn. living alone, solitary View this entry on the original dictionary page scan.
ekacārinm. a pratyeka-buddha- View this entry on the original dictionary page scan.
ekacāriṇīf. a woman who goes after one man only, a faithful woman View this entry on the original dictionary page scan.
ekacatvāriṃśamf(ī-)n. the forty-first. View this entry on the original dictionary page scan.
ekacatvāriṃśatf. forty-one. View this entry on the original dictionary page scan.
ekacchannāf. a kind of riddle View this entry on the original dictionary page scan.
ekacchattramfn. having only one (royal) umbrella, ruled by one king solely View this entry on the original dictionary page scan.
ekacchāyamfn. having shadow only, quite darkened View this entry on the original dictionary page scan.
ekacchāyāpraviṣṭamfn. jointly liable, View this entry on the original dictionary page scan.
ekacchāyāśritamfn. involved in similarity (of debt) with one debtor (said of a surety who binds himself to an equal liability with one debtor id est to the payment of the whole debt, Mit.) View this entry on the original dictionary page scan.
ekacetasmfn. of one mind, unanimous View this entry on the original dictionary page scan.
ekacinmaya(cit-m-) mfn. consisting of intelligence only View this entry on the original dictionary page scan.
ekacintanan. unanimous or joint consideration View this entry on the original dictionary page scan.
ekacitimfn. having one layer (of wood or bricks etc.) View this entry on the original dictionary page scan.
ekacitikamfn. idem or 'mfn. having one layer (of wood or bricks etc.) ' View this entry on the original dictionary page scan.
ekacitīkamfn. idem or 'mfn. idem or 'mfn. having one layer (of wood or bricks etc.) ' ' View this entry on the original dictionary page scan.
ekacitīkatvan. the state of having one layer commentator or commentary on View this entry on the original dictionary page scan.
ekacittan. fixedness of thought on one single object View this entry on the original dictionary page scan.
ekacittan. one and the same thought, unanimity View this entry on the original dictionary page scan.
ekacittamfn. thinking of one thing only, intent upon, absorbed in, View this entry on the original dictionary page scan.
ekacittamfn. having the same mind, agreeing, concurring
ekacittatāf. unanimity, agreement View this entry on the original dictionary page scan.
ekacittībhūto become unanimous View this entry on the original dictionary page scan.
ekacodanan. a rule concerning one act only View this entry on the original dictionary page scan.
ekacodanamfn. having one and the same rule View this entry on the original dictionary page scan.
ekacūrṇim. Name of an author. View this entry on the original dictionary page scan.
ekadāind. at the same time, at once View this entry on the original dictionary page scan.
ekadāind. sometimes, once, one time, some time ago View this entry on the original dictionary page scan.
ekadaṃṣṭram. "single-tusked", Name of gaṇeśa- View this entry on the original dictionary page scan.
ekadaṃṣṭram. a kind of fever View this entry on the original dictionary page scan.
ekadaṇḍinm. "bearing one staff", Name of a class of monks commentator or commentary on View this entry on the original dictionary page scan.
ekadaṇḍinm. plural Name of a Vedantic school View this entry on the original dictionary page scan.
ekadaṇḍisaṃnyāsavidhim. Name of work View this entry on the original dictionary page scan.
ekadantam. "one-toothed", Name of gaṇeśa- View this entry on the original dictionary page scan.
ekādaśamf(ī-)n. the eleventh etc. View this entry on the original dictionary page scan.
ekādaśamf(ī-)n. ([v]ṛṣabhaikādaśā gāvas-,"cows that have a bull as the eleventh" id est ten cows and one bull etc.) View this entry on the original dictionary page scan.
ekādaśamf(ī-)n. together with eleven, plus eleven View this entry on the original dictionary page scan.
ekādaśamf(ī-)n. consisting of eleven, lasting eleven (exempli gratia, 'for example' months) etc. View this entry on the original dictionary page scan.
ekādaśan. the number eleven View this entry on the original dictionary page scan.
ekādaśa(in compound for /ekādaśan-below) View this entry on the original dictionary page scan.
ekādaśacchadimfn. having eleven roofs View this entry on the original dictionary page scan.
ekādaśadhāind. eleven-fold, in eleven parts View this entry on the original dictionary page scan.
ekādaśadvāramfn. having eleven doors View this entry on the original dictionary page scan.
ekādaśāhan. duration or period of eleven days View this entry on the original dictionary page scan.
ekādaśāham. a sacrifice lasting eleven days View this entry on the original dictionary page scan.
ekādaśakamfn. the eleventh View this entry on the original dictionary page scan.
ekādaśakamfn. consisting of eleven View this entry on the original dictionary page scan.
ekādaśakan. the number eleven View this entry on the original dictionary page scan.
ekādaśakapālamfn. distributed in eleven dishes View this entry on the original dictionary page scan.
ekādaśakṛtvasind. eleven times View this entry on the original dictionary page scan.
ekādaśākṣam. Name of a man View this entry on the original dictionary page scan.
ekādaśākṣaramfn. consisting of eleven syllables View this entry on the original dictionary page scan.
ekādaśamamfn. the eleventh. View this entry on the original dictionary page scan.
ekādaśamārikāf. "killing eleven", Name of a woman View this entry on the original dictionary page scan.
ekādaśanmfn. eleven. View this entry on the original dictionary page scan.
ekādaśarāśikan. (in mathematics) the rule of eleven View this entry on the original dictionary page scan.
ekādaśāratnimfn. eleven cubits long View this entry on the original dictionary page scan.
ekādaśarātran. duration of eleven nights (and days;the period of a kṣatriya-'s impurity through the death of a relative) View this entry on the original dictionary page scan.
ekādaśarca(from ṛc-), a hymn of 11 verses, View this entry on the original dictionary page scan.
ekādaśaskandhārthanirūpaṇakārikāf. Name of a kārikā- on the View this entry on the original dictionary page scan.
ekādaśatvan. the number eleven View this entry on the original dictionary page scan.
ekādaśavarṣamfn. 11 years old, View this entry on the original dictionary page scan.
ekādaśavidhamfn. eleven-fold View this entry on the original dictionary page scan.
ekādaśaviṣṇugaṇaśrāddhan. a particular śrāddha- View this entry on the original dictionary page scan.
ekādaśavyūhamfn. appearing in 11 forms (rudra-), View this entry on the original dictionary page scan.
ekādaśīf. the eleventh day of a fortnight (on which fasting is considered an indispensable observance and very efficacious) etc. View this entry on the original dictionary page scan.
ekādaśīf. presentation of offerings to pitṛ-s or deceased ancestors on the eleventh day after their death (on which occasion Brahmans are fed, and the period of impurity for a Brahman terminates) View this entry on the original dictionary page scan.
ekādaśinmfn. consisting of eleven View this entry on the original dictionary page scan.
ekādaśinīf. the number eleven View this entry on the original dictionary page scan.
ekādaśīvratan. fasting on the eleventh day of a fortnight. View this entry on the original dictionary page scan.
ekādaśottamam. "chief among (the) eleven (rudra-s)", Name of śiva- View this entry on the original dictionary page scan.
ekadehamfn. having a similar body or descended from the same person (as a family) View this entry on the original dictionary page scan.
ekadehamfn. having as it were one body View this entry on the original dictionary page scan.
ekadeham. "having a singular or beautiful form", Name of the planet Mercury View this entry on the original dictionary page scan.
ekadehaum. dual number husband and wife View this entry on the original dictionary page scan.
ekadeśam. one spot or place, one passage, a certain spot or passage, some place etc. View this entry on the original dictionary page scan.
ekadeśam. a part, portion or division of the whole etc. View this entry on the original dictionary page scan.
ekadeśam. one and the same place View this entry on the original dictionary page scan.
ekadeśamfn. being in the same place View this entry on the original dictionary page scan.
ekādeśam. substitution of one sound for two or more View this entry on the original dictionary page scan.
ekādeśam. the one sound substituted for two or more (as in contraction of vowels etc.),
ekadeśasthamfn. situated in the same place View this entry on the original dictionary page scan.
ekadeśasthamfn. standing or occurring in a certain place or passage. View this entry on the original dictionary page scan.
ekadeśatvan. the state of being a part or portion of the whole
ekadeśavibhāvitamfn. convicted of one part of a charge View this entry on the original dictionary page scan.
ekadeśavikāram. change of only a part (of a word) View this entry on the original dictionary page scan.
ekadeśavikṛtamfn. changed in only a part View this entry on the original dictionary page scan.
ekadeśavivartinmfn. extending or relating to one part only, partial View this entry on the original dictionary page scan.
ekadeśinmfn. consisting of single parts or portions, divided into parts (as a whole) commentator or commentary on View this entry on the original dictionary page scan.
ekadeśinmfn. a sectary commentator or commentary on View this entry on the original dictionary page scan.
ekadeśinm. a disputant who knows only part of the true state of a case. View this entry on the original dictionary page scan.
ekadevam. the only God, supreme Lord View this entry on the original dictionary page scan.
ekadevatamfn. devoted or offered to one deity, directed to one deity, View this entry on the original dictionary page scan.
ekadevatyamfn. idem or 'mfn. devoted or offered to one deity, directed to one deity, ' View this entry on the original dictionary page scan.
ekadhāind. simply, singly View this entry on the original dictionary page scan.
ekadhāind. in one way, together, at once etc. View this entry on the original dictionary page scan.
ekadhābhūyan. the becoming one or simple View this entry on the original dictionary page scan.
ekadhanan. a choice portion of wealth View this entry on the original dictionary page scan.
ekadhanan. (/eka-dhana-),"put down in an odd number", Name of particular water-vessels by means of which water is taken up at certain sacrificial observances etc. View this entry on the original dictionary page scan.
ekadhanaf. plural (scilicet āpas-) the water taken up by means of those vessels etc. View this entry on the original dictionary page scan.
ekadhanavidmfn. obtaining the chief portion of wealth View this entry on the original dictionary page scan.
ekadhaninmfn. carrying the above water-vessels View this entry on the original dictionary page scan.
ekadhaninmfn. having one part of wealth, having the choice portion of wealth View this entry on the original dictionary page scan.
ekadhāram. a single or uninterrupted current View this entry on the original dictionary page scan.
ekadhārakam. Name of a mountain. View this entry on the original dictionary page scan.
ekadharmamfn. of the same properties or kind, View this entry on the original dictionary page scan.
ekadharminmfn. of the same properties or kind, View this entry on the original dictionary page scan.
ekadhātumfn. consisting of one part or element. View this entry on the original dictionary page scan.
ekadhenuf. a unique or excellent cow View this entry on the original dictionary page scan.
ekādhipatim. a sole monarch. View this entry on the original dictionary page scan.
ekadhiṣṇyamfn. having the same place for the sacred fire View this entry on the original dictionary page scan.
ekadhura mfn. bearing the same burden, fit for the same burden, equal, apt View this entry on the original dictionary page scan.
ekadhurāvaha mfn. bearing the same burden, fit for the same burden, equal, apt View this entry on the original dictionary page scan.
ekadhurīṇamfn. bearing the same burden, fit for the same burden, equal, apt View this entry on the original dictionary page scan.
ekādhyāyinm. a single pupil View this entry on the original dictionary page scan.
ekadīkṣamfn. (a sacrificial observance) at which only one dīkṣā- or consecration takes place View this entry on the original dictionary page scan.
ekadiśmfn. being in the same quarter or direction View this entry on the original dictionary page scan.
ekadravyan. a single object View this entry on the original dictionary page scan.
ekadravyan. one and the same object View this entry on the original dictionary page scan.
ekadṛśmfn. one-eyed View this entry on the original dictionary page scan.
ekadṛśmfn. a crow View this entry on the original dictionary page scan.
ekadṛśmfn. Name of śiva- View this entry on the original dictionary page scan.
ekadṛśmfn. equals tattva-jña- View this entry on the original dictionary page scan.
ekadṛṣṭif. gaze fixed upon one object View this entry on the original dictionary page scan.
ekadṛṣṭimfn. one-eyed View this entry on the original dictionary page scan.
ekadṛṣṭim. a crow View this entry on the original dictionary page scan.
ekadṛśyamfn. alone worthy of being beheld, sole object of vision View this entry on the original dictionary page scan.
ekadugdhan. equals -kṣīra- above. View this entry on the original dictionary page scan.
ekaduḥkhamfn. having the same sorrows View this entry on the original dictionary page scan.
ekaduḥkhasukhamfn. having the same sorrows and joys, sympathizing. View this entry on the original dictionary page scan.
ekadvāramf(ā-)n. having (only) one access or approach, View this entry on the original dictionary page scan.
ekadyūm. Name of a ṛṣi- View this entry on the original dictionary page scan.
ekagamfn. attentive to only one object, View this entry on the original dictionary page scan.
ekagarbhamfn. bringing forth only one child, View this entry on the original dictionary page scan.
ekāgnim. one and the same fire View this entry on the original dictionary page scan.
ekāgnimfn. keeping only one fire View this entry on the original dictionary page scan.
ekāgnikam. one and the same fire View this entry on the original dictionary page scan.
ekāgnikāṇḍan. Name of a section of the kāṭhaka-. View this entry on the original dictionary page scan.
ekāgramfn. one-pointed, having one point, fixing one's attention upon one point or object, closely attentive, intent, absorbed in etc. View this entry on the original dictionary page scan.
ekāgramfn. undisturbed, unperplexed View this entry on the original dictionary page scan.
ekāgramfn. known, celebrated View this entry on the original dictionary page scan.
ekāgran. (in mathematics) the whole of the long side of a figure which is subdivided View this entry on the original dictionary page scan.
ekāgracittamfn. having the mind intent on one object View this entry on the original dictionary page scan.
ekāgradhīmfn. fixing one's mind on one object, closely attentive View this entry on the original dictionary page scan.
ekāgradṛṣṭimfn. fixing one's eyes on one spot View this entry on the original dictionary page scan.
ekāgramind. with undivided attention View this entry on the original dictionary page scan.
ekagrāmam. the same village gaRa gahādi- View this entry on the original dictionary page scan.
ekāgramanasmfn. fixing one's mind on one object, closely attentive View this entry on the original dictionary page scan.
ekāgramatimfn. idem or 'mfn. fixing one's mind on one object, closely attentive ' View this entry on the original dictionary page scan.
ekāgramatim. Name of a man View this entry on the original dictionary page scan.
ekagrāmīṇamfn. inhabiting the same village View this entry on the original dictionary page scan.
ekagrāmīyamfn. idem or 'mfn. inhabiting the same village ' View this entry on the original dictionary page scan.
ekagrantham. an aggregate of 32 letters, View this entry on the original dictionary page scan.
ekāgratāf. intentness in the pursuit of one object, close and undisturbed attention View this entry on the original dictionary page scan.
ekāgratasind. with undivided attention View this entry on the original dictionary page scan.
ekāgratvan. intentness in the pursuit of one object, close and undisturbed attention View this entry on the original dictionary page scan.
ekāgryamfn. closely attentive View this entry on the original dictionary page scan.
ekāgryan. close attention View this entry on the original dictionary page scan.
ekagum. a particular agni-ṣṭoma- (q.v) View this entry on the original dictionary page scan.
ekaguru m. having the same teacher, pupil of the same preceptor. View this entry on the original dictionary page scan.
ekagurukam. having the same teacher, pupil of the same preceptor. View this entry on the original dictionary page scan.
ekāham. the period or duration of one day View this entry on the original dictionary page scan.
ekāham. a ceremony or religious festival lasting one day View this entry on the original dictionary page scan.
ekāham. a soma- sacrifice in which soma- is prepared during one day only (as the agniṣṭoma- etc.) etc. View this entry on the original dictionary page scan.
ekāhadhaninmfn. having food for one day, View this entry on the original dictionary page scan.
ekāhagamam. a day's journey View this entry on the original dictionary page scan.
ekahalyamfn. once ploughed View this entry on the original dictionary page scan.
ekāhamind. during one day View this entry on the original dictionary page scan.
ekahaṃsam. "the only destroyer of ignorance"[ śaṃkara- on ; see haṃsa-], the Supreme Soul View this entry on the original dictionary page scan.
ekahaṃsan. "inhabited by a solitary or unique swan", Name of a tīrtha- View this entry on the original dictionary page scan.
ekāhann. a single day (= ekā- ha-), . View this entry on the original dictionary page scan.
ekāhāram. a single meal during the day View this entry on the original dictionary page scan.
ekāhāramfn. taking food only once a day View this entry on the original dictionary page scan.
ekahāryamfn. varia lectio for ekāhārya- q.v View this entry on the original dictionary page scan.
ekāhāryamfn. having but one kind of food, eating anything, making no difference between allowed and forbidden food ([ ]) (edition Bombay) View this entry on the original dictionary page scan.
ekahastamfn. one hand long View this entry on the original dictionary page scan.
ekāhātānan. the continued series of ekāha-s View this entry on the original dictionary page scan.
ekahāyanamf(ī-)n. one year old View this entry on the original dictionary page scan.
ekahāyanan. the duration or period of one year View this entry on the original dictionary page scan.
ekahāyanīf. a heifer one year old View this entry on the original dictionary page scan.
ekahef. See eka-helayā- View this entry on the original dictionary page scan.
ekahelayā(instrumental case) ind. by one stroke, at once View this entry on the original dictionary page scan.
ekāhnāind. during one day View this entry on the original dictionary page scan.
ekaikamfn. one by one, single, every single one etc. View this entry on the original dictionary page scan.
ekaikamind. singly, one by one etc. View this entry on the original dictionary page scan.
ekaikaśasind. one by one, severally, seriatim View this entry on the original dictionary page scan.
ekaikaśyan. single state, severalty View this entry on the original dictionary page scan.
ekaikaśyenaind. seriatim, severally View this entry on the original dictionary page scan.
ekaikataramfn. one by one (out of many) View this entry on the original dictionary page scan.
ekaikatraind. singly, , Scholiast or Commentator View this entry on the original dictionary page scan.
ekaikavatmfn. possessing (only) one (of several things), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
ekaikavṛttimfn. existing in only one object View this entry on the original dictionary page scan.
ekaiṣikāf. Name of a medicinal plant View this entry on the original dictionary page scan.
ekaiśvaryan. sole monarchy View this entry on the original dictionary page scan.
ekajamfn. born or produced alone or single, solitary, single, alone of its kind View this entry on the original dictionary page scan.
ekajanmanm. "once-born", a śūdra- View this entry on the original dictionary page scan.
ekajanmanm. "having pre-eminent birth", a king View this entry on the original dictionary page scan.
ekajaṭam. Name of a being 84, 3 View this entry on the original dictionary page scan.
ekajaṭam. Name of a being in the retinue of skanda- View this entry on the original dictionary page scan.
ekajaṭāf. Name of a goddess ([ ]) View this entry on the original dictionary page scan.
ekajātamfn. of one parentage, born of the same parents View this entry on the original dictionary page scan.
ekajātimfn. once-born (as a śūdra-) View this entry on the original dictionary page scan.
ekajātimfn. of the same species or kind (as animals) View this entry on the original dictionary page scan.
ekajātim. a śūdra- View this entry on the original dictionary page scan.
ekajātīyamfn. of the same species View this entry on the original dictionary page scan.
ekajātīyamfn. of the same family View this entry on the original dictionary page scan.
ekajīvavādam. (in philosophy) the assertion of a living soul only. View this entry on the original dictionary page scan.
ekajyāf. the cord of an arc View this entry on the original dictionary page scan.
ekajyāf. sine of 30 degrees or of the radius View this entry on the original dictionary page scan.
ekajyotisn. "the only light", Name of śiva-. View this entry on the original dictionary page scan.
ekakamf(ā-, ikā-)n. single, alone, solitary View this entry on the original dictionary page scan.
ekakālam. happening at the same time, simultaneous View this entry on the original dictionary page scan.
ekakālamind. at one time only, once a day View this entry on the original dictionary page scan.
ekakālikamind. once a day View this entry on the original dictionary page scan.
ekakālinmfn. happening only once a day View this entry on the original dictionary page scan.
ekakalpamfn. having the same method of performing ceremonial, observing the same ritual (as priests). View this entry on the original dictionary page scan.
ekakaṇṭakam. a species of Silurus View this entry on the original dictionary page scan.
ekakaṇṭhamfn. "having one throat", uttering simultaneously. View this entry on the original dictionary page scan.
ekakapālamfn. contained in one cup, one cup-full View this entry on the original dictionary page scan.
ekakaramf(ī-)n. doing or effecting one View this entry on the original dictionary page scan.
ekakaramf(ā-)n. one-handed, one-rayed View this entry on the original dictionary page scan.
ekakarmakārakamfn. doing the same thing, having the same profession. View this entry on the original dictionary page scan.
ekakarman() mfn. having one and the same business View this entry on the original dictionary page scan.
ekakāryan. the same business or work View this entry on the original dictionary page scan.
ekakāryamfn. executing the same work, performing the same business View this entry on the original dictionary page scan.
ekakaśatan. one percent.
ekakhuram. a one-hoofed animal View this entry on the original dictionary page scan.
ekākinmfn. () alone, solitary View this entry on the original dictionary page scan.
ekakriya (), mfn. having one and the same business View this entry on the original dictionary page scan.
ekakriyāvidhim. employment of the same verb, View this entry on the original dictionary page scan.
ekakṛṣṭamfn. once ploughed View this entry on the original dictionary page scan.
ekākṣamfn. (fr. 1. akṣa-with eka-), having only one axle View this entry on the original dictionary page scan.
ekākṣamfn. (fr. akṣi-with eka-), one-eyed View this entry on the original dictionary page scan.
ekākṣamfn. having an excellent eye View this entry on the original dictionary page scan.
ekākṣam. a crow View this entry on the original dictionary page scan.
ekākṣam. Name of śiva- View this entry on the original dictionary page scan.
ekākṣam. of a dānava- View this entry on the original dictionary page scan.
ekākṣam. of a being attending on skanda-. View this entry on the original dictionary page scan.
ekākṣaran. the sole imperishable thing View this entry on the original dictionary page scan.
ekākṣaran. a single syllable View this entry on the original dictionary page scan.
ekākṣaran. a monosyllabic word etc. View this entry on the original dictionary page scan.
ekākṣaran. the sacred monosyllable om- View this entry on the original dictionary page scan.
ekākṣaran. Name of an upaniṣad- View this entry on the original dictionary page scan.
ekākṣaramfn. of an upaniṣad- View this entry on the original dictionary page scan.
ekākṣaramfn. monosyllabic
ekākṣarābhidhānakośam. Name of vocabulary of monosyllabic words. View this entry on the original dictionary page scan.
ekākṣaragaṇapatistotran. a hymn in honour of gaṇeśa- (a portion of the rudrayāmala-) View this entry on the original dictionary page scan.
ekākṣarakośam. Name of a vocabulary of monosyllabic words View this entry on the original dictionary page scan.
ekākṣaramālikāf. Name of vocabulary of monosyllabic words. View this entry on the original dictionary page scan.
ekākṣaranāmamālāf. Name of vocabulary of monosyllabic words. View this entry on the original dictionary page scan.
ekākṣaranighaṇṭam. Name of vocabulary of monosyllabic words. View this entry on the original dictionary page scan.
ekākṣarībhāvam. "the becoming one syllable", contraction of two syllables into one View this entry on the original dictionary page scan.
ekākṣipiṅgalinm. Name (also title or epithet) of kubera-, View this entry on the original dictionary page scan.
ekakṣīran. the milk of one and the same cow on View this entry on the original dictionary page scan.
ekakuṇḍalam. "having one ear-ring or ring", Name of kuvera- View this entry on the original dictionary page scan.
ekakuṇḍalam. of śeṣa- View this entry on the original dictionary page scan.
ekakuṇḍalam. of bala-rāma- View this entry on the original dictionary page scan.
ekakuṣṭhan. a kind of leprosy View this entry on the original dictionary page scan.
ekalamfn. alone, solitary View this entry on the original dictionary page scan.
ekalamfn. (in mus.) a solo singer. View this entry on the original dictionary page scan.
ekalakṣyatāf. the state of being the only aim View this entry on the original dictionary page scan.
ekālāpakamfn. having one sound, sounding as one (but expressing more than one thing) View this entry on the original dictionary page scan.
ekalavyam. Name of a son of hiraṇya-dhanus- and king of the niṣāda-s View this entry on the original dictionary page scan.
ekalavyāf. Name of a town. View this entry on the original dictionary page scan.
ekaliṅgan. (scilicet kṣetra-) a field or place in which (for the distance of five krośa-s) there is but one liṅga- or landmark View this entry on the original dictionary page scan.
ekaliṅgan. "having a singular śiva-liṅga- (q.v) ", Name of a tīrtha- View this entry on the original dictionary page scan.
ekaliṅgam. Name of kuvera- View this entry on the original dictionary page scan.
ekalokamfn. possessing one world, View this entry on the original dictionary page scan.
ekalūm. Name of a ṛṣi- gaRa gargādi- View this entry on the original dictionary page scan.
ekamanasmfn. fixing the mind upon one object, concentrated, attentive etc. View this entry on the original dictionary page scan.
ekamanasmfn. unanimous View this entry on the original dictionary page scan.
ekamatif. concentration of mind View this entry on the original dictionary page scan.
ekamatimfn. unanimous View this entry on the original dictionary page scan.
ekamātramfn. consisting of one syllabic instant View this entry on the original dictionary page scan.
ekamayamf(ī-)n. consisting of one, uniform View this entry on the original dictionary page scan.
ekāmracandrikāf. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ekāmranātham. "matchless lord of the mango", Name of śiva- as worshipped at Kanjivaram. View this entry on the original dictionary page scan.
ekāmranātha(confer, compare ) n. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ekāmrapurāṇan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ekāmravaṇan. "matchless mango grove", Name of a sacred grove. View this entry on the original dictionary page scan.
ekāmravanamāhātmyan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ekāṃśam. a single part, one part View this entry on the original dictionary page scan.
ekamukhamfn. having one mouth View this entry on the original dictionary page scan.
ekamukhamfn. having the face turned towards the same direction View this entry on the original dictionary page scan.
ekamukhamfn. having one chief or superintendent View this entry on the original dictionary page scan.
ekamukhamfn. belonging to the same category on View this entry on the original dictionary page scan.
ekamūlamfn. having one root View this entry on the original dictionary page scan.
ekamūlāf. Linum Usitatissimum View this entry on the original dictionary page scan.
ekamūlāf. Desmodium Gangeticum View this entry on the original dictionary page scan.
ekamūrdhanmf(dhnī-)n. having the head or face turned towards the same direction View this entry on the original dictionary page scan.
ekamūrtif. one person, View this entry on the original dictionary page scan.
ekanakṣatran. a lunar mansion consisting of only one star or one whose name occurs but once View this entry on the original dictionary page scan.
ekānaṃśāf. (scilicet kalā-) "the single portionless one", Name of kuhū- or the new moon View this entry on the original dictionary page scan.
ekānaṃśāf. personified as durgā- View this entry on the original dictionary page scan.
ekānaṃśāf. Name of durgā- View this entry on the original dictionary page scan.
ekānarthamfn. having the same evils View this entry on the original dictionary page scan.
ekanaṭam. the principal actor in a drama, the manager (who recites the prologue) View this entry on the original dictionary page scan.
ekanātham. "having one master", Name of an author View this entry on the original dictionary page scan.
ekanāthīf. Name of his work. View this entry on the original dictionary page scan.
ekanavatamfn. the ninety-first. View this entry on the original dictionary page scan.
ekanavatif. ninety-one View this entry on the original dictionary page scan.
ekanavatitamamfn. the ninety-first. View this entry on the original dictionary page scan.
ekanāyakam. "the only Ruler", Name of śiva-. View this entry on the original dictionary page scan.
ekanayanam. the planet Venus View this entry on the original dictionary page scan.
ekāṇḍam. "having only one testicle", a kind of horse View this entry on the original dictionary page scan.
ekānekasvarūpamfn. simple yet manifold View this entry on the original dictionary page scan.
ekanemimfn. having one felly View this entry on the original dictionary page scan.
ekanemimfn. View this entry on the original dictionary page scan.
ekanetram. "one-eyed", Name of śiva- View this entry on the original dictionary page scan.
ekanetram. (with śaiva-s) one of the eight forms of vidyeśvara- View this entry on the original dictionary page scan.
ekanetrakam. idem or 'm. (with śaiva-s) one of the eight forms of vidyeśvara- ' View this entry on the original dictionary page scan.
ekāṅgan. a single member, single part etc. View this entry on the original dictionary page scan.
ekāṅgan. the most excellent member of the body, the head View this entry on the original dictionary page scan.
ekāṅgan. sandal-wood View this entry on the original dictionary page scan.
ekāṅgam. "having a unique or beautiful shape", Name of the planet Mercury View this entry on the original dictionary page scan.
ekāṅgam. of the planet Mars View this entry on the original dictionary page scan.
ekāṅgam. of viṣṇu- View this entry on the original dictionary page scan.
ekāṅgam. plural "constituting one body", body-guard View this entry on the original dictionary page scan.
ekāṅgamfn. relating to or extending over one part only, incomplete View this entry on the original dictionary page scan.
ekāṅgagraham. paralysis, View this entry on the original dictionary page scan.
ekāṅgarūpakan. an incomplete simile View this entry on the original dictionary page scan.
ekāṅgaum. dual number "forming a single body", a married couple View this entry on the original dictionary page scan.
ekāṅgīf. a particular perfume View this entry on the original dictionary page scan.
ekanibhamfn. uniform, View this entry on the original dictionary page scan.
ekanīḍamfn. having a common abode View this entry on the original dictionary page scan.
ekanīḍamfn. having only one seat View this entry on the original dictionary page scan.
ekanipātam. a particle which is a single word. View this entry on the original dictionary page scan.
ekaniścayam. one and the same resolution, common resolution View this entry on the original dictionary page scan.
ekaniścayamfn. having the same intention or resolution View this entry on the original dictionary page scan.
ekāñjalim. a handful. View this entry on the original dictionary page scan.
ekānnan. one and the same food View this entry on the original dictionary page scan.
ekānnan. only one meal View this entry on the original dictionary page scan.
ekānnan. food given by only one person View this entry on the original dictionary page scan.
ekānnamfn. having or eating the same food, a messmate View this entry on the original dictionary page scan.
ekānnanaktabhojanamfn. taking one's only meal at night View this entry on the original dictionary page scan.
ekānnanaktabhojinmfn. taking food but once a day View this entry on the original dictionary page scan.
ekānnanaktabhojinādinmfn. eating food given by only one person View this entry on the original dictionary page scan.
ekānnapañcāśadrātram. n. a sacrifice lasting 49 nights (and days) View this entry on the original dictionary page scan.
ekānnaviṃsam. a stoma- consisting of 19 parts View this entry on the original dictionary page scan.
ekānnaviṃsatidhāind. 19-fold, in 19 parts View this entry on the original dictionary page scan.
ekānṛca atharva-- veda- xix, 23. View this entry on the original dictionary page scan.
ekāntam. a lonely or retired or secret place, ( ekānte e- ind.in a lonely or solitary place, alone, apart, privately) etc. View this entry on the original dictionary page scan.
ekāntam. a single part, part, portion View this entry on the original dictionary page scan.
ekāntam. the only end or aim, exclusiveness, absoluteness, necessity etc. View this entry on the original dictionary page scan.
ekāntam. devotion to one object, worship of one Being, monotheistic doctrine View this entry on the original dictionary page scan.
ekāntamfn. directed towards or devoted to only one object or person etc. View this entry on the original dictionary page scan.
ekāntabhāvam. devotedness to only one object View this entry on the original dictionary page scan.
ekāntabhūtamfn. one who is alone or solitary View this entry on the original dictionary page scan.
ekāntaduḥkhamfn. absolutely unhappy, . View this entry on the original dictionary page scan.
ekāntaduḥṣamāf. "containing only bad years", (with jaina-s) Name of two spokes in the wheel of time (the sixth of the avasarpiṇī- and the first of the utsarpiṇī-, qq.v.) View this entry on the original dictionary page scan.
ekāntagrahaṇan. partial comprehension View this entry on the original dictionary page scan.
ekāntagrāhinmfn. comprehending partially View this entry on the original dictionary page scan.
ekāntakaruṇamfn. wholly and solely compassionate, wholly charitable View this entry on the original dictionary page scan.
ekāntamind. solely, only, exclusively, absolutely, necessarily, by all means, in every respect, invariably etc. View this entry on the original dictionary page scan.
ekāntamatimfn. having the mind fixed on one object View this entry on the original dictionary page scan.
ekāntaramfn. separated by one intermediate (caste) View this entry on the original dictionary page scan.
ekāntaramfn. next but one, one removed from View this entry on the original dictionary page scan.
ekāntarahasyan. Name of work View this entry on the original dictionary page scan.
ekāntarājm. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
ekāntarin mfn. one who fasts every second day, View this entry on the original dictionary page scan.
ekāntaritin(?) mfn. one who fasts every second day, L View this entry on the original dictionary page scan.
ekāntaśīlamfn. fond of loneliness View this entry on the original dictionary page scan.
ekāntasthitamfn. staying or remaining alone or apart. View this entry on the original dictionary page scan.
ekāntasuṣamāf. "containing only good years", (with jaina-s) Name of two spokes in the wheel of time (the first of avasarpiṇī- and the sixth of utsarpiṇī-, qq. v.) View this entry on the original dictionary page scan.
ekāntātind. solely, only, exclusively, absolutely, necessarily, by all means, in every respect, invariably etc. View this entry on the original dictionary page scan.
ekāntatāf. exclusive worship View this entry on the original dictionary page scan.
ekāntatāf. the state of being a part or portion View this entry on the original dictionary page scan.
ekāntatasind. lonely, alone View this entry on the original dictionary page scan.
ekāntatasind. solely, exclusively, invariably, etc. View this entry on the original dictionary page scan.
ekāntatvan. exclusive worship View this entry on the original dictionary page scan.
ekāntatvan. the state of being a part or portion View this entry on the original dictionary page scan.
ekāntavihārinmfn. wandering alone View this entry on the original dictionary page scan.
ekānteind. ekānta
ekāntenaind. solely, only, exclusively, absolutely, necessarily, by all means, in every respect, invariably etc. View this entry on the original dictionary page scan.
ekāntikamfn. devoted to one aim or object or person or theory. View this entry on the original dictionary page scan.
ekāntinmfn. idem or 'mfn. devoted to one aim or object or person or theory.' View this entry on the original dictionary page scan.
ekāntintitvan. devotion to only one object or thing View this entry on the original dictionary page scan.
ekānudiṣṭan. N. (scilicet śrāddha-) a funeral ceremony having reference to only one ancestor recently dead View this entry on the original dictionary page scan.
ekānugānan. Name of a sāman- View this entry on the original dictionary page scan.
ekānvayamfn. of the same family View this entry on the original dictionary page scan.
ekāpacayam. diminution (of one's food) by one (mouthful) View this entry on the original dictionary page scan.
ekapadmfn. (pāt-, padī-, pat-and pāt-) having only one foot, limping, lame etc. View this entry on the original dictionary page scan.
ekapadmfn. incomplete View this entry on the original dictionary page scan.
ekapadmfn. (with 1. aja-Name of one of the marut-s ) View this entry on the original dictionary page scan.
ekapadm. (pāt-) Name of viṣṇu- View this entry on the original dictionary page scan.
ekapadm. of śiva- View this entry on the original dictionary page scan.
ekapadm. of a dānava- View this entry on the original dictionary page scan.
ekapadan. one and the same place or spot View this entry on the original dictionary page scan.
ekapadan. the same panel View this entry on the original dictionary page scan.
ekapadan. a single word View this entry on the original dictionary page scan.
ekapadan. a simple word, a simple nominal formation View this entry on the original dictionary page scan.
ekapadan. one and the same word View this entry on the original dictionary page scan.
ekapadamf(ā-and ī-[ ])n. taking one step View this entry on the original dictionary page scan.
ekapadamf(ā-and ī-[ ])n. having only one foot View this entry on the original dictionary page scan.
ekapadamf(ā-and ī-[ ])n. occupying only one panel
ekapadamf(ā-and ī-[ ])n. consisting of a single word, named with a single word etc. View this entry on the original dictionary page scan.
ekapadam. a kind of coitus View this entry on the original dictionary page scan.
ekapadāf. (scilicet ṛc-) a verse consisting of only one pāda- or quarter stanza View this entry on the original dictionary page scan.
ekapadāf. Name of the twenty-fifth lunar mansion (equals pūrva-bhādra-padā-) View this entry on the original dictionary page scan.
ekapadam. plural Name of a fabulous race View this entry on the original dictionary page scan.
ekapādam. a single foot View this entry on the original dictionary page scan.
ekapādam. one quarter View this entry on the original dictionary page scan.
ekapādam. the same pāda- or quarter stanza View this entry on the original dictionary page scan.
ekapādamfn. having or using only one foot View this entry on the original dictionary page scan.
ekapādam. plural Name of a fabulous people View this entry on the original dictionary page scan.
ekapādan. Name of a country (see eka-p/ad-, column 2.) View this entry on the original dictionary page scan.
ekapādakam. plural Name of a fabulous people View this entry on the original dictionary page scan.
ekapadamind. (= - pade-), View this entry on the original dictionary page scan.
ekapadasthamfn. being in the same word. View this entry on the original dictionary page scan.
ekapadavatind. like one word View this entry on the original dictionary page scan.
ekapadeind. on the spot, in one moment, at once etc. View this entry on the original dictionary page scan.
ekapadīf. (padī-) a foot-path View this entry on the original dictionary page scan.
ekapadiind. upon or with only one foot gaRa dvidaṇḍy-ādi- View this entry on the original dictionary page scan.
ekapadikamfn. occupying only one panel View this entry on the original dictionary page scan.
ekapādikāf. a single foot View this entry on the original dictionary page scan.
ekapādikāf. Name of the second book of the śatapatha-brāhmaṇa-. View this entry on the original dictionary page scan.
ekapākopajīvinmfn. living on food prepared by the same cooking (as a family) commentator or commentary on View this entry on the original dictionary page scan.
ekapakṣam. one side or party, the one case or alternative, the one side of an argument View this entry on the original dictionary page scan.
ekapakṣamfn. being of the same side or party, siding with, an associate View this entry on the original dictionary page scan.
ekapakṣamfn. partial, taking one view only View this entry on the original dictionary page scan.
ekapakṣeind. in one point of view View this entry on the original dictionary page scan.
ekapakṣībhāvam. the state of being the one alternative commentator or commentary on View this entry on the original dictionary page scan.
ekapakṣībhūto be only one side or alternative View this entry on the original dictionary page scan.
ekapalādhikan. one Pala more, View this entry on the original dictionary page scan.
ekapalāśam. a tree with one leaf gaRa gahādi- View this entry on the original dictionary page scan.
ekapalāśīyamfn. being on or belonging to the above tree View this entry on the original dictionary page scan.
ekapāṇam. a single wager or stake. View this entry on the original dictionary page scan.
ekapañcāśamfn. the fifty-first. View this entry on the original dictionary page scan.
ekapañcāśatf. fifty-one View this entry on the original dictionary page scan.
ekapañcāśattamamfn. the fifty-first. View this entry on the original dictionary page scan.
ekaparamfn. of singular importance, more important than any other, first of all (said of dice) View this entry on the original dictionary page scan.
ekapariind. with exception of one (die) View this entry on the original dictionary page scan.
ekaparṇāf. "living upon one leaf", Name of a younger sister of durgā- View this entry on the original dictionary page scan.
ekaparṇāf. Name of durgā- View this entry on the original dictionary page scan.
ekaparṇikāf. Name of durgā- View this entry on the original dictionary page scan.
ekapārthivam. sole ruler or king View this entry on the original dictionary page scan.
ekaparvatakam. Name of a mountain View this entry on the original dictionary page scan.
ekapaśukamfn. having the same victim View this entry on the original dictionary page scan.
ekapātamfn. happening at once, sudden, rapid View this entry on the original dictionary page scan.
ekapātam. the pratīka- or first word of a mantra- on View this entry on the original dictionary page scan.
ekapāṭalāf. "living upon a single blossom", Name of a younger sister of durgā- View this entry on the original dictionary page scan.
ekapāṭalāf. Name of durgā- View this entry on the original dictionary page scan.
ekapatim. one and the same husband View this entry on the original dictionary page scan.
ekapatif. having only one husband, View this entry on the original dictionary page scan.
ekapatikamfn. having the same husband commentator or commentary on View this entry on the original dictionary page scan.
ekapātinmfn. having a common or the same appearance, appearing together, belonging to each other etc. View this entry on the original dictionary page scan.
ekapātinmfn. having a single or common pratīka- or first word, quoted together as one verse (as mantra-s) View this entry on the original dictionary page scan.
ekapātinflying (only) in one manner, View this entry on the original dictionary page scan.
ekapātinbeing alone or solitary, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
ekapatitva(n.) View this entry on the original dictionary page scan.
ekapatnīf. a woman who has only one husband or lover, a faithful wife, one devoted to her husband or lover etc. View this entry on the original dictionary page scan.
ekapatnīf. plural (yas-)women who have the same husband View this entry on the original dictionary page scan.
ekapatnīf. a single wife, an only wife View this entry on the original dictionary page scan.
ekapatnīkamfn. having only one wife. View this entry on the original dictionary page scan.
ekapatnitāf. the state of having the same wife, (with bahūnām-) polyandry View this entry on the original dictionary page scan.
ekapātramfn. being in one and the same vessel View this entry on the original dictionary page scan.
ekapattram. Name of a plant View this entry on the original dictionary page scan.
ekapattrikāf. Ocimum Gratissimum View this entry on the original dictionary page scan.
ekāpāyam. diminution by one. View this entry on the original dictionary page scan.
ekaphalāf. producing only one fruit, Name of a plant View this entry on the original dictionary page scan.
ekapiṇḍamfn. equals sa-piṇḍa- q.v View this entry on the original dictionary page scan.
ekapiṅga m. "having a yellow mark (in the place of one eye)", Name of kuvera- etc. View this entry on the original dictionary page scan.
ekapiṅgalam. "having a yellow mark (in the place of one eye)", Name of kuvera- etc. View this entry on the original dictionary page scan.
ekapiṅgalācalam. " kuvera-'s mountain", Name of the himavat- View this entry on the original dictionary page scan.
ekapītamfn. quite yellow, View this entry on the original dictionary page scan.
ekaprabhutvan. the sovereignty of one, monarchy. View this entry on the original dictionary page scan.
ekapradānamfn. receiving the offerings at the same time or sacrifice (as deities) View this entry on the original dictionary page scan.
ekaprādeśamf(ā-)n. one span long View this entry on the original dictionary page scan.
ekaprahārikamfn. (killed) by one blow. View this entry on the original dictionary page scan.
ekaprakāramfn. of the same kind or manner. View this entry on the original dictionary page scan.
ekaprakhyamfn. having the same appearance, similar. View this entry on the original dictionary page scan.
ekaprāṇabhāvam. the act of breathing once View this entry on the original dictionary page scan.
ekaprāṇayogam. union (of sounds) in one breath View this entry on the original dictionary page scan.
ekaprastham. "having one table-land", Name of a mountain ([ ]) gaRa mālādi- View this entry on the original dictionary page scan.
ekapratihāramfn. having only one pratihāra- (q.v) syllable View this entry on the original dictionary page scan.
ekaprayatnam. one effort (of the voice). View this entry on the original dictionary page scan.
ekapṛthaktvan. unity and distinctness. View this entry on the original dictionary page scan.
ekapuṇḍarīkan. "the only lotus" id est the only or very best View this entry on the original dictionary page scan.
ekapuroḍāśamfn. receiving the same sacrificial cake View this entry on the original dictionary page scan.
ekapuruṣam. the one supreme Spirit : one man only View this entry on the original dictionary page scan.
ekapuruṣam. a unique or excellent man View this entry on the original dictionary page scan.
ekapuruṣamfn. having or consisting of only one man View this entry on the original dictionary page scan.
ekapuṣkalam. (-puṣkara- edition Bombay) a kind of musical instrument (equals kāhala- ) View this entry on the original dictionary page scan.
ekapuṣpāf. "producing only one blossom", Name of a plant View this entry on the original dictionary page scan.
ekaputramfn. having only one son View this entry on the original dictionary page scan.
ekaputram. an only son. View this entry on the original dictionary page scan.
ekaputrakam. a species of bird View this entry on the original dictionary page scan.
ekāram. the letter or sound e- View this entry on the original dictionary page scan.
ekaradam. "one-tusked", Name of gaṇeśa- View this entry on the original dictionary page scan.
ekarājmfn. shining alone, alone visible View this entry on the original dictionary page scan.
ekarājm. (-) the only king or ruler, monarch etc. View this entry on the original dictionary page scan.
ekarājm. the king alone View this entry on the original dictionary page scan.
ekarajam. Verbesina Scandens View this entry on the original dictionary page scan.
ekarājam. the only king, monarch View this entry on the original dictionary page scan.
ekarājñīf. the only queen, absolute queen. View this entry on the original dictionary page scan.
ekārāmamfn. having but one object of pleasure View this entry on the original dictionary page scan.
ekārāmatāf. the state of the above View this entry on the original dictionary page scan.
ekarasam. the only pleasure, only object of affection View this entry on the original dictionary page scan.
ekarasamfn. having only one pleasure or object of affection, relishing or finding pleasure in only one thing or person etc. View this entry on the original dictionary page scan.
ekarasamfn. having (always) the same object of affection, unchangeable View this entry on the original dictionary page scan.
ekarāśif. one heap, a quantity heaped together View this entry on the original dictionary page scan.
ekarāśibhūtamfn. heaped or collected together, mingled. View this entry on the original dictionary page scan.
ekarāśigatamfn. heaped or collected together, mingled. View this entry on the original dictionary page scan.
ekaratham. an eminent warrior View this entry on the original dictionary page scan.
ekāratnimfn. one cubit long View this entry on the original dictionary page scan.
ekarātran. duration of one night, one night, one day and night View this entry on the original dictionary page scan.
ekarātram. a particular observance or festival View this entry on the original dictionary page scan.
ekarātramfn. during one night. View this entry on the original dictionary page scan.
ekarātrikamfn. lasting for one night View this entry on the original dictionary page scan.
ekarātrikamfn. lasting for one day and night (as food) View this entry on the original dictionary page scan.
ekarātrikamfn. staying one night View this entry on the original dictionary page scan.
ekarātrīṇamfn. during one night View this entry on the original dictionary page scan.
ekarcam. (eka-ṛca-) n. a single verse gaRa ardharcādi- ([ ]) View this entry on the original dictionary page scan.
ekarcamfn. consisting of only one verse View this entry on the original dictionary page scan.
ekarcan. a sūkta- of only one verse View this entry on the original dictionary page scan.
ekarikthinmfn. sharing the same heritage, co-heir View this entry on the original dictionary page scan.
ekārṇavam. only one ocean, nothing but ocean, general inundation View this entry on the original dictionary page scan.
ekārṣeyamfn. having only one sacred ancestor, View this entry on the original dictionary page scan.
ekaṛṣim. the only or chief ṛṣi- View this entry on the original dictionary page scan.
ekaṛṣim. Name of a ṛṣi- View this entry on the original dictionary page scan.
ekarṣiSee -ṛṣ/i- View this entry on the original dictionary page scan.
ekārtham. one and the same object View this entry on the original dictionary page scan.
ekārtham. one and the same purpose View this entry on the original dictionary page scan.
ekārtham. one and the same meaning View this entry on the original dictionary page scan.
ekārthamfn. having the same purpose or aim etc. View this entry on the original dictionary page scan.
ekārthamfn. having the same meaning, denoting the same thing, synonymous View this entry on the original dictionary page scan.
ekārthamfn. (in rhetoric) tautological (as a sentence) View this entry on the original dictionary page scan.
ekārthamfn. expressing one thing, forming only one notion (as a compound) View this entry on the original dictionary page scan.
ekārtham. Name of a glossary of synonymous words
ekārthadīpakan. a dīpaka- (quod vide) of simple meaning, . View this entry on the original dictionary page scan.
ekārthanāmamālāf. Name of a glossary of synonymous words View this entry on the original dictionary page scan.
ekārthasamupetamfn. arrived at one object. View this entry on the original dictionary page scan.
ekārthatāf. the state of having the same object or purpose View this entry on the original dictionary page scan.
ekārthatāf. the act of expressing only one thing or notion View this entry on the original dictionary page scan.
ekārthatvan. the state of having the same object or purpose View this entry on the original dictionary page scan.
ekārthatvan. the act of expressing only one thing or notion View this entry on the original dictionary page scan.
ekārthībhāvam. the act of conveying only one idea commentator or commentary on View this entry on the original dictionary page scan.
ekaṛtum. the only time, only season View this entry on the original dictionary page scan.
ekartuSee -ṛt/u-, . View this entry on the original dictionary page scan.
ekarudram. rudra- alone View this entry on the original dictionary page scan.
ekarudram. (with śaiva-s) one of the eight forms of vidyeśvara- View this entry on the original dictionary page scan.
ekarūpan. one form, one kind View this entry on the original dictionary page scan.
ekarūpamfn. having the same colour or form, one-coloured, of one kind, uniform etc. View this entry on the original dictionary page scan.
ekarūpan. Name of a metre View this entry on the original dictionary page scan.
ekarūpatāf. uniformity, invariableness View this entry on the original dictionary page scan.
ekarūpatasind. in one form, unalterably View this entry on the original dictionary page scan.
ekarūpyamfn. descended from one and the same man or woman commentator or commentary on View this entry on the original dictionary page scan.
ekasabhan. the only meeting-place or resort View this entry on the original dictionary page scan.
ekasahasran. 1001 View this entry on the original dictionary page scan.
ekasahasran. ([v]ṛṣabhaikasahasraṃ-[ ] or hasrās- scilicet gāvas-,a thousand cows and one bull ) View this entry on the original dictionary page scan.
ekaśākhamfn. being of the same branch or school (as a Brahman)
ekaśākhamfn. having but one branch (as a tree) View this entry on the original dictionary page scan.
ekaśākhamfn. gaRa gahādi- View this entry on the original dictionary page scan.
ekaśākhīyamfn. belonging to the above View this entry on the original dictionary page scan.
ekasākṣikamfn. witnessed by one. View this entry on the original dictionary page scan.
ekaśālāf. a single hall or room View this entry on the original dictionary page scan.
ekaśālāf. Name of a place, View this entry on the original dictionary page scan.
ekaśālān. a house consisting of one hall View this entry on the original dictionary page scan.
ekaśālān. Name of a town View this entry on the original dictionary page scan.
ekasālan. Name of a place (varia lectio for -śāla-) edition Bombay. View this entry on the original dictionary page scan.
ekaśalākāf. a single staff View this entry on the original dictionary page scan.
ekaśālikamfn. like a single hall or room View this entry on the original dictionary page scan.
ekasampratyayam. having the same signification, View this entry on the original dictionary page scan.
ekasaṃśrayamfn. keeping together, closely allied View this entry on the original dictionary page scan.
ekasaṃvatsaram. duration of one year View this entry on the original dictionary page scan.
ekāsanikamfn. having only one seat. View this entry on the original dictionary page scan.
ekaśaphamfn. whole-hoofed, not cloven-hoofed, solidungulate etc. View this entry on the original dictionary page scan.
ekaśapham. a whole-hoofed animal (as a horse etc.) View this entry on the original dictionary page scan.
ekaśaphan. the race of solidungulate animals View this entry on the original dictionary page scan.
ekasaptatamfn. the 71st. View this entry on the original dictionary page scan.
ekasaptatif. 71 View this entry on the original dictionary page scan.
ekasaptatignṇamfn. multiplied by 71, View this entry on the original dictionary page scan.
ekasaptatikamfn. consisting of 71. View this entry on the original dictionary page scan.
ekasaptatitamamfn. the 71st. View this entry on the original dictionary page scan.
ekasargamfn. closely attentive, having the mind intent upon one object View this entry on the original dictionary page scan.
ekaśarīramfn. descended from one body, consanguineous View this entry on the original dictionary page scan.
ekaśarīrānvayam. consanguineous descent View this entry on the original dictionary page scan.
ekaśarīrārambham. beginning of consanguinity (by union of father and mother) View this entry on the original dictionary page scan.
ekaśarīrāvayavam. a descendant in right line, kinsman by blood View this entry on the original dictionary page scan.
ekaśarīrāvayavatvan. consanguineous descent or connexion. View this entry on the original dictionary page scan.
ekaśarīrinmfn. standing alone, id est having no relatives, View this entry on the original dictionary page scan.
ekasārthaprayātamfn. going after one and the same object, having the same aim View this entry on the original dictionary page scan.
ekaśasSee . View this entry on the original dictionary page scan.
ekaśasind. one by one, singly View this entry on the original dictionary page scan.
ekaṣaṣṭamfn. (fr. the next) , the 61st View this entry on the original dictionary page scan.
ekaṣaṣṭamfn. connected or together with 61 View this entry on the original dictionary page scan.
ekaṣaṣṭif. 61 View this entry on the original dictionary page scan.
ekaṣaṣṭitamamfn. the 61st. View this entry on the original dictionary page scan.
ekaśatan. 101 View this entry on the original dictionary page scan.
ekaśatamf(ā-)n. the 101st View this entry on the original dictionary page scan.
ekaśatadhāind. 101-fold, in 101 parts View this entry on the original dictionary page scan.
ekaśatatamamf(ī-)n. the 101st View this entry on the original dictionary page scan.
ekaśatavidhamfn. 101-fold. View this entry on the original dictionary page scan.
ekasatīf. the only satī- or faithful wife View this entry on the original dictionary page scan.
ekaśāyinmfn. sleeping alone, chaste View this entry on the original dictionary page scan.
ekaśepam. Name of a man. View this entry on the original dictionary page scan.
ekaśeṣam. the only remainder View this entry on the original dictionary page scan.
ekaśeṣam. "the remaining of one", (in grammar) a term denoting that of two or more stems (alike in form and followed by the same termination) only one remains (exempli gratia, 'for example' the plural vṛkṣās-is the only remainder of vṛkṣas- vṛkṣas- vṛkṣas- ) View this entry on the original dictionary page scan.
ekaśeṣamfn. of which only one is left, View this entry on the original dictionary page scan.
ekaśilāf. Name of a town. View this entry on the original dictionary page scan.
ekaśīlamfn. of one and the same nature or character View this entry on the original dictionary page scan.
ekāśinmfn. eating alone View this entry on the original dictionary page scan.
ekaśīrṣanmfn. having the face turned towards the same direction View this entry on the original dictionary page scan.
ekāśītamfn. the 81st. View this entry on the original dictionary page scan.
ekāśītif. 81 View this entry on the original dictionary page scan.
ekaśitipad(pāt-, padī-, pat-) mfn. having one white foot View this entry on the original dictionary page scan.
ekāśītitamamfn. the 81st. View this entry on the original dictionary page scan.
ekaśnuṣṭi varia lectio for - śruṣṭi-, View this entry on the original dictionary page scan.
ekasphyāf. (scilicet lekhā-) a line scratched with one piece of wood View this entry on the original dictionary page scan.
ekāśramam. a solitary hermitage. View this entry on the original dictionary page scan.
ekāśraya mfn. resting upon or clinging to one object or person (see an-ekāśr-), View this entry on the original dictionary page scan.
ekāśrayaguṇam. a simple attribute or predicate (as form, smell, taste, etc.) View this entry on the original dictionary page scan.
ekāśritamfn. resting upon or clinging to one object or person (see an-ekāśr-), View this entry on the original dictionary page scan.
ekāśritaguṇam. a simple attribute or predicate (as form, smell, taste, etc.) View this entry on the original dictionary page scan.
ekasṛkam. a kind of jackal (having solitary habits) View this entry on the original dictionary page scan.
ekaśṛṅgamfn. having but one horn, unicorn View this entry on the original dictionary page scan.
ekaśṛṅgamfn. having but one peak (as a mountain) View this entry on the original dictionary page scan.
ekaśṛṅgamfn. being of singular eminence, pre-eminent View this entry on the original dictionary page scan.
ekaśṛṅgam. Name of viṣṇu- View this entry on the original dictionary page scan.
ekaśṛṅgam. plural a class of Manes View this entry on the original dictionary page scan.
ekaśṛṅgāf. Name of the first wife of śuka- View this entry on the original dictionary page scan.
ekaśruṣṭimfn. obedient to one command View this entry on the original dictionary page scan.
ekaśrutadharamfn. keeping in mind what one has heard once View this entry on the original dictionary page scan.
ekaśrutif. an only śruti- or Vedic passage, the same śruti- View this entry on the original dictionary page scan.
ekaśrutif. an enunciation in the singular View this entry on the original dictionary page scan.
ekaśrutif. the hearing of only one sound, monotony commentator or commentary on commentator or commentary on View this entry on the original dictionary page scan.
ekaśrutif. the neutral accentless tone View this entry on the original dictionary page scan.
ekaśrutimfn. of only one sound, monotonous View this entry on the original dictionary page scan.
ekaśrutimūlatvan. the state of being based on the same Vedic passage View this entry on the original dictionary page scan.
ekaśrutyupadeśam. Name of work View this entry on the original dictionary page scan.
ekāṣṭakāf. the eighth day after full moon (especially of the month māgha-;personified as śacī- ) View this entry on the original dictionary page scan.
ekastambhamfn. resting upon one pillar View this entry on the original dictionary page scan.
ekasthamfn. standing together, remaining in the same place, conjoined, combined, assembled etc. View this entry on the original dictionary page scan.
ekasthamfn. standing in or occupying only one panel View this entry on the original dictionary page scan.
ekasthānan. one place, one and the same place View this entry on the original dictionary page scan.
ekasthānamfn. having the same place of production, uttered by the same organ of speech commentator or commentary on View this entry on the original dictionary page scan.
ekasthānāśrayamfn. sthānāśraya
ekasthānāśrayasee sthān-, page 1263. View this entry on the original dictionary page scan.
ekasthāneind. locative case together View this entry on the original dictionary page scan.
ekāṣṭhīlam. "having one kernel", Agati Grandiflora View this entry on the original dictionary page scan.
ekāṣṭhīlāf. a species of Calotropis View this entry on the original dictionary page scan.
ekāṣṭhīlāf. Clypea Hernandifolia View this entry on the original dictionary page scan.
ekāṣṭīf. a pod or seed of cotton View this entry on the original dictionary page scan.
ekastomamfn. accompanied or celebrated by only one stoma- View this entry on the original dictionary page scan.
ekaśūlamfn. onepointed, View this entry on the original dictionary page scan.
ekaśulkan. one and the same purchase-money (given to the parents of a bride) View this entry on the original dictionary page scan.
ekaśuṅgamfn. having but one sheath (as a bud) View this entry on the original dictionary page scan.
ekasūnum. an only son. View this entry on the original dictionary page scan.
ekasūtran. a small double drum (played by a string and ball attached to the body of it) View this entry on the original dictionary page scan.
ekāsyamfn. one-faced View this entry on the original dictionary page scan.
ekatāf. oneness, unity, union, coincidence, identity etc. View this entry on the original dictionary page scan.
ekatāf. (ekatām api--,to become one with [instr.] ) View this entry on the original dictionary page scan.
ekatam. Name of one of the three āptya-s etc. View this entry on the original dictionary page scan.
ekatam. of a Brahman View this entry on the original dictionary page scan.
ekatālam. harmony, unison (of song, dance, and instrumental music) View this entry on the original dictionary page scan.
ekatālam. accurate adjustment View this entry on the original dictionary page scan.
ekatālamfn. having a single palm tree (as a mountain) View this entry on the original dictionary page scan.
ekatālīf. a particular time (in mus.) View this entry on the original dictionary page scan.
ekatālīf. an instrument for beating time View this entry on the original dictionary page scan.
ekatālīf. any instrument having but one note View this entry on the original dictionary page scan.
ekatālikāf. a particular time (in mus.) View this entry on the original dictionary page scan.
ekatamamfn. (n. -at-) one of many, one (used sometimes as indef. article) View this entry on the original dictionary page scan.
ekatānamfn. directed to one object only, having the mind fixed on one object only, closely attentive View this entry on the original dictionary page scan.
ekatānamfn. of the same or equal extent View this entry on the original dictionary page scan.
ekatānam. attention fixed on one object only View this entry on the original dictionary page scan.
ekatānam. harmonious tone or song (see tāna-) View this entry on the original dictionary page scan.
ekatantrīf. a lute with one chord. View this entry on the original dictionary page scan.
ekatantrikā f. a lute with one chord. View this entry on the original dictionary page scan.
ekātapatramfn. having only one royal umbrella, ruled by one king only View this entry on the original dictionary page scan.
ekataramfn. (n. am-,not at-by vArttika on ) one of two, either, other etc. View this entry on the original dictionary page scan.
ekataramfn. (rarely) one of many, View this entry on the original dictionary page scan.
ekatasSee . View this entry on the original dictionary page scan.
ekatasind. from one, from one and the same View this entry on the original dictionary page scan.
ekatasind. from one view, from one side, on one side, on one part, on the one hand etc. View this entry on the original dictionary page scan.
ekatasind. (the correlative to ekatas-is either ekatas-repeated or aparatas-or anyatas-or - exempli gratia, 'for example' ekatas-- ekatas-or ekatas-- aparatas-,on the one hand - on the other) View this entry on the original dictionary page scan.
ekatasind. in one body, all together View this entry on the original dictionary page scan.
ekatatparamfn. solely intent on View this entry on the original dictionary page scan.
ekatayamfn. single, one by one View this entry on the original dictionary page scan.
ekatejanamfn. having a single shaft (as an arrow) View this entry on the original dictionary page scan.
ekatīrthinmfn. inhabiting the same hermitage View this entry on the original dictionary page scan.
ekatīrthin(lexicographers (i.e. a word or meaning which although give in native lexicons, has not yet been met with in any published text)), m. one who has the same teacher, fellow-student View this entry on the original dictionary page scan.
ekatīrthya (), m. one who has the same teacher, fellow-student View this entry on the original dictionary page scan.
ekātmanm. the one spirit View this entry on the original dictionary page scan.
ekātmanmfn. depending solely on one's self, being without any friend, only, alone View this entry on the original dictionary page scan.
ekātmanmfn. having the same nature, of one and the same nature View this entry on the original dictionary page scan.
ekātmapakṣam. the vedānta- doctrine, Sa1m2khyas., Scholiast or Commentator View this entry on the original dictionary page scan.
ekātmapakṣavādam. a teacher of the vedānta-, ibidem or 'in the same place or book or text' as the preceding 2. View this entry on the original dictionary page scan.
ekātmatāf. the unity of spiritual essence, the doctrine of one universal spirit. View this entry on the original dictionary page scan.
ekātmyamfn. only, alone View this entry on the original dictionary page scan.
ekātmyamfn. homogeneous (see aikātmya-.) 1. View this entry on the original dictionary page scan.
ekato(by saṃdhi- for ekatas-). View this entry on the original dictionary page scan.
ekatodatmfn. having teeth in only one (id est the lower) jaw View this entry on the original dictionary page scan.
ekatomukhamf(ā-)n. turned to one side, View this entry on the original dictionary page scan.
ekatomukha(a vessel) having a spout only on one side, , Scholiast or Commentator View this entry on the original dictionary page scan.
ekatraind. in one, in one and the same etc. View this entry on the original dictionary page scan.
ekatraind. in one place, in the same place, in a single spot (with the force of the locative) etc. View this entry on the original dictionary page scan.
ekatraind. on the one side View this entry on the original dictionary page scan.
ekatraind. (the correlative is aparatra-or sometimes anyasmin-,on the one side - on the other side, here - there) View this entry on the original dictionary page scan.
ekatraind. in one and the same place, all together View this entry on the original dictionary page scan.
ekatrikam. Name of a particular ekāha- sacrifice View this entry on the original dictionary page scan.
ekatṛṃśamf(ī-)n. the thirty-first. View this entry on the original dictionary page scan.
ekatṛṃśa śaka-, śat- (read /eka-- triṃśa-, saka-, śat-) View this entry on the original dictionary page scan.
ekatṛṃśadakṣaramf(ā-)n. consisting of thirty-one syllables View this entry on the original dictionary page scan.
ekatṛṃśakamfn. consisting of thirty-one elements. View this entry on the original dictionary page scan.
ekatṛṃśatf. thirty-one View this entry on the original dictionary page scan.
ekatumbamf(ī-)n3. having a single bottle-gourd (for a sounding-board). View this entry on the original dictionary page scan.
ekatvan. oneness, unity, union, coincidence, identity etc. View this entry on the original dictionary page scan.
ekatvan. (in grammar) the singular number View this entry on the original dictionary page scan.
ekatvan. singleness, soleness View this entry on the original dictionary page scan.
ekaugham. a single flight (of arrows) View this entry on the original dictionary page scan.
ekaughabhūtamfn. collected into one mass, heaped or crowded together. View this entry on the original dictionary page scan.
ekavācakamfn. denoting the same thing, synonymous commentator or commentary on View this entry on the original dictionary page scan.
ekavacanan. the singular number View this entry on the original dictionary page scan.
ekavādam. a kind of drum View this entry on the original dictionary page scan.
ekavādam. (with vedāntin-s) a particular theory (establishing the identity of all objects with brahman-) View this entry on the original dictionary page scan.
ekavadbhāvam. the being or becoming like one, aggregation commentator or commentary on View this entry on the original dictionary page scan.
ekavādyāf. a kind of spirit or demon ([ ]) View this entry on the original dictionary page scan.
ekavaktram. "one-faced", Name of a dānava- View this entry on the original dictionary page scan.
ekavaktrāf. Name of a mother in the retinue of skanda- , (varia lectio -candrā-) View this entry on the original dictionary page scan.
ekavaktran. a kind of berry View this entry on the original dictionary page scan.
ekavaktrakamfn. one-faced View this entry on the original dictionary page scan.
ekavākyan. a single expression or word View this entry on the original dictionary page scan.
ekavākyan. a single sentence commentator or commentary on View this entry on the original dictionary page scan.
ekavākyan. the same sentence, an identical sentence (either by words or meanings) View this entry on the original dictionary page scan.
ekavākyan. a speech not contradicted, unanimous speech View this entry on the original dictionary page scan.
ekavākyaf. (in grammar) the being one sentence. View this entry on the original dictionary page scan.
ekavākyatāf. unanimity View this entry on the original dictionary page scan.
ekāvali f. a single row, single string of pearls or beads or flowers, etc. etc. View this entry on the original dictionary page scan.
ekāvalif. (in rhetoric) a series of sentences where the subject of each following sentence has some characteristic of the predicate of the preceding one View this entry on the original dictionary page scan.
ekāvalif. Name of work on rhetoric View this entry on the original dictionary page scan.
ekāvalīf. a single row, single string of pearls or beads or flowers, etc. etc. View this entry on the original dictionary page scan.
ekāvalīf. (in rhetoric) a series of sentences where the subject of each following sentence has some characteristic of the predicate of the preceding one View this entry on the original dictionary page scan.
ekāvalīf. Name of work on rhetoric View this entry on the original dictionary page scan.
ekāvaliprakāśam. Name of commentary on the above works. View this entry on the original dictionary page scan.
ekāvalīprakāśam. Name of commentaries on the above work. View this entry on the original dictionary page scan.
ekāvalitaralam. Name of commentary on the above works. View this entry on the original dictionary page scan.
ekāvalītaralam. Name of commentaries on the above work. View this entry on the original dictionary page scan.
ekāvamamfn. inferior or less by one, diminishing by one View this entry on the original dictionary page scan.
ekāvāñcmfn. diminishing by one. View this entry on the original dictionary page scan.
ekavāramind. only once, at one time commentator or commentary on View this entry on the original dictionary page scan.
ekavāramind. at once, suddenly View this entry on the original dictionary page scan.
ekavāreind. idem or 'ind. at once, suddenly ' View this entry on the original dictionary page scan.
ekavarṇam. a single sound or letter, etc. View this entry on the original dictionary page scan.
ekavarṇamfn. of one colour, one-coloured, uniform etc. View this entry on the original dictionary page scan.
ekavarṇamfn. having one caste only, being all one caste View this entry on the original dictionary page scan.
ekavarṇamfn. consisting of one sound only View this entry on the original dictionary page scan.
ekavarṇakamfn. consisting of one syllable. View this entry on the original dictionary page scan.
ekavarṇasamīkaraṇan. equalization of two uniform quantities, a kind of equation (in mathematics) View this entry on the original dictionary page scan.
ekavarṇīf. a kind of musical instrument View this entry on the original dictionary page scan.
ekavarṣikāf. a heifer one year old View this entry on the original dictionary page scan.
ekāvartamfn. forming one whirl View this entry on the original dictionary page scan.
ekavartaninmfn. one-wheeled, View this entry on the original dictionary page scan.
ekavartmann. a by-way, path View this entry on the original dictionary page scan.
ekavāsamfn. living on the same place. View this entry on the original dictionary page scan.
ekavāsasmfn. clothed in only one garment View this entry on the original dictionary page scan.
ekavastramfn. having but a single garment, clothed in only one garment etc.
ekavastrasnānavidhim. Name of work View this entry on the original dictionary page scan.
ekavastratāf. the state of having but a single garment View this entry on the original dictionary page scan.
ekavatind. like one, simple View this entry on the original dictionary page scan.
ekavatind. as one, as in the case of one etc. View this entry on the original dictionary page scan.
ekāvayavamfn. made up of the same members or constituent parts. View this entry on the original dictionary page scan.
ekavedamfn. knowing (or studying) only one veda-, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
ekaveṇi f. a single braid of hair (worn by women, as a sign of mourning, when their husbands are dead or absent for a long period) View this entry on the original dictionary page scan.
ekaveṇif. a woman wearing her hair in the above manner. View this entry on the original dictionary page scan.
ekaveṇīf. a single braid of hair (worn by women, as a sign of mourning, when their husbands are dead or absent for a long period) View this entry on the original dictionary page scan.
ekaveṇīf. a woman wearing her hair in the above manner. View this entry on the original dictionary page scan.
ekaveśmann. a unique building View this entry on the original dictionary page scan.
ekaveśmann. one and the same house View this entry on the original dictionary page scan.
ekaveśmann. a solitary house or room View this entry on the original dictionary page scan.
ekavibhaktimfn. that (member of a compound) which (when the compound is resolved) appears throughout in one and the same case View this entry on the original dictionary page scan.
ekavidhamfn. of one kind, simple View this entry on the original dictionary page scan.
ekavidhamfn. identical View this entry on the original dictionary page scan.
ekavilocanam. plural "one-eyed", Name of a fabulous people View this entry on the original dictionary page scan.
ekaviṃśamf(ī-)n. the twenty-first etc. View this entry on the original dictionary page scan.
ekaviṃśamf(ī-)n. consisting of twenty-one parts (as the ekaviṃśa-stoma-) etc. View this entry on the original dictionary page scan.
ekaviṃśam. the ekaviṃśa-stoma- etc. View this entry on the original dictionary page scan.
ekaviṃśam. Name of one of the six pṛṣṭhya-stoma-s View this entry on the original dictionary page scan.
ekaviṃśakamf(ikā-)n. the twenty-first View this entry on the original dictionary page scan.
ekaviṃśakamf(ikā-)n. consisting of twenty-one (syllables) View this entry on the original dictionary page scan.
ekaviṃśakan. the number twenty-one View this entry on the original dictionary page scan.
ekaviṃśasaṃpadf. accomplishing the number twenty-one View this entry on the original dictionary page scan.
ekaviṃśastomam. a stoma- (q.v) consisting of twenty-one parts View this entry on the original dictionary page scan.
ekaviṃśatf. twenty-one View this entry on the original dictionary page scan.
ekaviṃśatif. twenty-one, a collection or combination of twenty-one View this entry on the original dictionary page scan.
ekaviṃśaticchadi(/eka--), mfn. having 21 roofs, View this entry on the original dictionary page scan.
ekaviṃśatidhāind. twenty-one-fold, in twenty-one parts View this entry on the original dictionary page scan.
ekaviṃśatitamamfn. the twenty-first View this entry on the original dictionary page scan.
ekaviṃśatividhamfn. twenty-one times, twenty-one-fold View this entry on the original dictionary page scan.
ekaviṃśatkan. the number twenty-one View this entry on the original dictionary page scan.
ekaviṃśavatmfn. accompanied with the ekaviṃśa-stoma- View this entry on the original dictionary page scan.
ekaviṃśinīf. idem or 'n. the number twenty-one ' View this entry on the original dictionary page scan.
ekavīram. a unique or pre-eminent hero etc. View this entry on the original dictionary page scan.
ekavīram. a species of tree View this entry on the original dictionary page scan.
ekavīrāf. Name of a daughter of śiva- View this entry on the original dictionary page scan.
ekavīrāf. a species of gourd View this entry on the original dictionary page scan.
ekavīrakalpam. Name of work View this entry on the original dictionary page scan.
ekavīryamfn. of equal strength View this entry on the original dictionary page scan.
ekaviṣayinmfn. having one common object or aim, a rival. View this entry on the original dictionary page scan.
ekavratamfn. obedient or devoted to one person only View this entry on the original dictionary page scan.
ekavratamfn. keeping a fast in which food is taken only once a day View this entry on the original dictionary page scan.
ekavrātyam. the only or supreme vrātya- (q.v) View this entry on the original dictionary page scan.
ekavṛkam. a solitary wolf commentator or commentary on View this entry on the original dictionary page scan.
ekavṛkīhīyamfn. derived trom the same tree or wood, View this entry on the original dictionary page scan.
ekavṛkṣam. an isolated tree View this entry on the original dictionary page scan.
ekavṛkṣam. one and the same tree View this entry on the original dictionary page scan.
ekavṛkṣam. a country or place in which (for the distance of four krośa-s) there is but one tree View this entry on the original dictionary page scan.
ekavṛkṣīyamfn. belonging to an isolated tree or to one and the same tree, belonging to a country like the above gaRa gahādi- View this entry on the original dictionary page scan.
ekavṛndam. a particular disease of the throat View this entry on the original dictionary page scan.
ekavṛṣam. the chief bull, the best or most excellent of a number View this entry on the original dictionary page scan.
ekavṛṣan. Name of a sāman-. View this entry on the original dictionary page scan.
ekavṛtmfn. "being one", simple View this entry on the original dictionary page scan.
ekavṛttan. the same metre View this entry on the original dictionary page scan.
ekavyākhyānamfn. having the same explanation View this entry on the original dictionary page scan.
ekavyāvahārikam. plural "living solitary (?)", Name of a Buddhist school. View this entry on the original dictionary page scan.
ekavyavasāyinmfn. following the same employment. View this entry on the original dictionary page scan.
ekavyūhamfn. appearing (only) in one form, View this entry on the original dictionary page scan.
ekayajñam. a sacrifice offered by one person View this entry on the original dictionary page scan.
ekayakāramfn. containing only one ya-. View this entry on the original dictionary page scan.
ekayamamfn. monotonous View this entry on the original dictionary page scan.
ekāyanan. a narrow way or path accessible for only one person View this entry on the original dictionary page scan.
ekāyanan. the only way or manner of conduct, worldly wisdom View this entry on the original dictionary page scan.
ekāyanan. meeting-place, centre of union View this entry on the original dictionary page scan.
ekāyanan. absorption in one, absolute devotedness to one, unity View this entry on the original dictionary page scan.
ekāyanamfn. passable for only one (as a foot-path) View this entry on the original dictionary page scan.
ekāyanamfn. fixing one's thoughts on one object, closely attentive, absorbed in View this entry on the original dictionary page scan.
ekāyanagatamfn. walking on a foot-path only wide enough for one View this entry on the original dictionary page scan.
ekāyanagatamfn. one who has fixed all his thoughts on one object View this entry on the original dictionary page scan.
ekāyanībhāvam. unanimity, View this entry on the original dictionary page scan.
ekāyanībhū(see ekāyana-), to become the centre of union, become the only object (of affection etc.) View this entry on the original dictionary page scan.
ekayaṣṭi f. any ornament consisting of a single pearl View this entry on the original dictionary page scan.
ekayaṣṭikāf. any ornament consisting of a single pearl View this entry on the original dictionary page scan.
ekayāvanm. Name of a king View this entry on the original dictionary page scan.
ekayogam. one rule (opposed to yoga-vibhāga-, q.v) View this entry on the original dictionary page scan.
ekayonif. the same womb View this entry on the original dictionary page scan.
ekayonimfn. of the same mother View this entry on the original dictionary page scan.
ekayonimfn. of the same origin or caste View this entry on the original dictionary page scan.
ekāyumfn. affording excellent food or the chief vigour of life View this entry on the original dictionary page scan.
ekayūpam. one and the same sacrificial post View this entry on the original dictionary page scan.
ekekṣaṇam. "one-eyed", Name of śukra- or Venus (the teacher of the asura-s) View this entry on the original dictionary page scan.
ekendriyamfn. having but one organ of sense View this entry on the original dictionary page scan.
ekeṣamfn. furnished with only one pole View this entry on the original dictionary page scan.
ekeṣṭakamfn. (fr. the next) , having but one sacrificial brick View this entry on the original dictionary page scan.
ekeṣṭakāf. a single sacrificial brick View this entry on the original dictionary page scan.
e(in compound for eka-). View this entry on the original dictionary page scan.
ekībhāvam. the becoming one, coalition View this entry on the original dictionary page scan.
ekībhāvastottran. Name (also title or epithet) of a stotra-. View this entry on the original dictionary page scan.
ekībhāvinmfn. relating to coalition or blending (of vowels) View this entry on the original dictionary page scan.
ekībhūto become one, be blended or combined View this entry on the original dictionary page scan.
ekīkaraṇan. the act of making one, uniting, combination commentator or commentary on View this entry on the original dictionary page scan.
ekīkṛto unite, combine, associate View this entry on the original dictionary page scan.
ekinmfn. simple, consisting of one View this entry on the original dictionary page scan.
ekīyamfn. belonging to or proceeding from or resting upon one View this entry on the original dictionary page scan.
ekīyamfn. belonging to the same party, a partisan, associate, companion. View this entry on the original dictionary page scan.
ekīyasingle in its kind, View this entry on the original dictionary page scan.
ekoccayam. increase (of food) by one (mouthful) View this entry on the original dictionary page scan.
ekodakamfn. offering water as funeral oblation to the same deceased ancestor, a kind of relative View this entry on the original dictionary page scan.
ekodāttamfn. having one udātta- accent View this entry on the original dictionary page scan.
ekoddiṣṭan. (scilicet śrāddha-) a funeral ceremony having reference to one individual recently dead (not including ancestors generally) View this entry on the original dictionary page scan.
ekoddiṣṭaśrāddhapaddhatif. Name of work View this entry on the original dictionary page scan.
ekoktif. a single expression, single word. View this entry on the original dictionary page scan.
ekolmukan. a single fire-brand View this entry on the original dictionary page scan.
ekonamfn. less by one, minus one (used in compound with viṃśati-and the succeeding decade numerals, thus ekonaviṃśati -viṃśat/i- f.nineteen etc.) View this entry on the original dictionary page scan.
ekonaviṃśatif. ekona
ekonnatamfn. having one elevation View this entry on the original dictionary page scan.
ekotimfn. having one and the same object of desire or aim (course), tending to one single purpose View this entry on the original dictionary page scan.
ekotibhāvam. (the thread-like continuity of personality or individual life running through the whole cycle of re-births), () View this entry on the original dictionary page scan.
ekottaramfn. greater or more by one, increasing by one View this entry on the original dictionary page scan.
ekottarikāf. Name of the fourth āgama- or sacred book of the Buddhists View this entry on the original dictionary page scan.
ekottarikāgamam. idem or 'f. Name of the fourth āgama- or sacred book of the Buddhists' View this entry on the original dictionary page scan.
ekṣ( ā-īkṣ-). View this entry on the original dictionary page scan.
ekṣya ind.p. having looked at, looking at View this entry on the original dictionary page scan.
elaand elada- n. a particular number () View this entry on the original dictionary page scan.
ef. any species of Cardamom View this entry on the original dictionary page scan.
ef. Name of a metre (consisting of four lines of fifteen syllables each) View this entry on the original dictionary page scan.
ef. Name of a river View this entry on the original dictionary page scan.
ef. (varia lectio arlā-.) View this entry on the original dictionary page scan.
ef. sport, pastime, merriness gaRa kaṇḍv-ādi- View this entry on the original dictionary page scan.
elāgandhikan. the fragrant bark of Feronia Elephantum. View this entry on the original dictionary page scan.
elaka equals eḍaka-, q.v
elākam. Name of a man gaRa gargādi- View this entry on the original dictionary page scan.
elākan. equals elā- above. View this entry on the original dictionary page scan.
elākapuran. Name of a town. View this entry on the original dictionary page scan.
elānan. orange View this entry on the original dictionary page scan.
elaṅga equals eraṅga-, column 1 View this entry on the original dictionary page scan.
elāparṇīf. Mimosa Octandra. View this entry on the original dictionary page scan.
elāpattram. Name of a nāga- View this entry on the original dictionary page scan.
elāphalan. equals elavālu-. View this entry on the original dictionary page scan.
elāpuran. Name of a town. View this entry on the original dictionary page scan.
elārasālakamf(ikā-)n. astringent (and) pungent (and) bitter, View this entry on the original dictionary page scan.
elāvalif. a species of plant View this entry on the original dictionary page scan.
elavālun. the fragrant bark of Feronia Elephantum View this entry on the original dictionary page scan.
elavālun. a granular substance (apparently a vegetable of a reddish-brown colour;used as a drug and perfume). View this entry on the original dictionary page scan.
elavālukan. the above fragrant bark View this entry on the original dictionary page scan.
elāvālukan. a kind of perfume (confer, compare elav-), View this entry on the original dictionary page scan.
elavilam. Name of kuvera- (see ailavila-.) View this entry on the original dictionary page scan.
elāyaNom. P. elāyati-, to be wanton or playful, be merry. View this entry on the original dictionary page scan.
elīkāf. small Cardamom View this entry on the original dictionary page scan.
elun. a particular number View this entry on the original dictionary page scan.
elukan. a kind of fragrant substance View this entry on the original dictionary page scan.
elvālun. View this entry on the original dictionary page scan.
elvālukan. idem or 'n.' View this entry on the original dictionary page scan.
elvavālukan. equals elavālu- View this entry on the original dictionary page scan.
ema am- n. course, way ; ([ confer, compare Greek $, $ Lithuanian eisme.]) View this entry on the original dictionary page scan.
ema /eman- See . View this entry on the original dictionary page scan.
emann. course, way ; ([ confer, compare Greek , Lithuanian eisme.]) View this entry on the original dictionary page scan.
emūṣam. (formed fr. the above) Name of the boar which raised up the earth View this entry on the original dictionary page scan.
emuṣam(accusative sg. of the perf. p. of 3. am-,) . View this entry on the original dictionary page scan.
eṇamf(-). a species of deer or antelope (described as being of a black colour with beautiful eyes and short legs) View this entry on the original dictionary page scan.
eṇam. (in astronomy) Capricorn. View this entry on the original dictionary page scan.
enaa pronominal base (used for certain cases of the 3rd personal pronoun, thus in the accusative singular dual number plural [ enam-, enām-, enad-,etc.] , inst. singular [ enena-, enayā-] genitive case locative case dual number [ enayos-,Ved. enos-];the other cases are formed fr. the pronominal base a-See under idam-), he, she, it View this entry on the original dictionary page scan.
enathis, that, (this pronoun is enclitic and cannot begin a sentence;it is generally used alone, so that enam puruṣam-,"that man", would be very unusual if not incorrect. mmarians assert that the substitution of enam-etc. for imam-or etam-etc. takes place when something is referred to which has already been mentioned in a previous part of the sentence;See grammar 223 and 836) View this entry on the original dictionary page scan.
ena([ confer, compare Greek ,; Gothic ains; Old Pruss.ains; Latin oinos,unus.]) View this entry on the original dictionary page scan.
enaand enā-, Ved. instrumental case of idam- q.v View this entry on the original dictionary page scan.
eind. here, there View this entry on the original dictionary page scan.
eind. in this manner, thus View this entry on the original dictionary page scan.
eind. then, at that time View this entry on the original dictionary page scan.
e(en/ā par/as- ind.further on ; par/a en/ā- ind.beyond here;there;beyond [with instrumental case ] ; y/atra-- en/ā-,whither - thither.) View this entry on the original dictionary page scan.
ena(see eṇa-), a stag. See an-ena-. View this entry on the original dictionary page scan.
eṇabhṛtm. "bearing an antelope", the moon View this entry on the original dictionary page scan.
eṇadṛśf. the eye of an antelope View this entry on the original dictionary page scan.
eṇadṛśm. (k-) (in astronomy) Capricorn. View this entry on the original dictionary page scan.
eṇajaṅgham. "deer-legged", Name of a running messenger View this entry on the original dictionary page scan.
eṇājinan. deer-skin. View this entry on the original dictionary page scan.
eṇakam. a species of deer (equals eṇa-above) View this entry on the original dictionary page scan.
eṇākṣamf(ī-)n. deer-eyed, View this entry on the original dictionary page scan.
eṇamadam. the juice of the antelope, musk View this entry on the original dictionary page scan.
eṇanetramf(ā-)n. deer-eyed. View this entry on the original dictionary page scan.
eṇāṅkam. "deer-marked", the moon View this entry on the original dictionary page scan.
eṇāṅkamaṇim. the moon-gem View this entry on the original dictionary page scan.
enasn. ( i- ; in- ), mischief, crime, sin, offence, fault etc. View this entry on the original dictionary page scan.
enasn. evil, unhappiness, misfortune, calamity View this entry on the original dictionary page scan.
enasn. censure, blame ; ([ confer, compare Zend aenaGh; Greek .]) View this entry on the original dictionary page scan.
eṇaśirasn. Name of the nakṣatra- mṛgaśiras-. View this entry on the original dictionary page scan.
enasvatmfn. wicked, sinful, a sinner View this entry on the original dictionary page scan.
enasvinmfn. wicked, sinful, a sinner View this entry on the original dictionary page scan.
enasyamfn. produced by sin View this entry on the original dictionary page scan.
enasyamfn. counted a sin or crime, wicked, sinful View this entry on the original dictionary page scan.
eṇatilakam. "deer-marked", the moon View this entry on the original dictionary page scan.
eṇavilocanamf(ā-)n. deer-eyed. View this entry on the original dictionary page scan.
endh( ā-indh-) A1. (subjunctive -idhate-and -in/adhate-; perfect tense īdhe-) to inflame, kindle ; to be inflamed, flame View this entry on the original dictionary page scan.
eekṣaṇamf(ā-)n. deer-eyed View this entry on the original dictionary page scan.
eṇīf. See eṇa- above. View this entry on the original dictionary page scan.
ef. a river View this entry on the original dictionary page scan.
ef. See under 2. /eta-. View this entry on the original dictionary page scan.
eṇīdāham. a kind of fever View this entry on the original dictionary page scan.
eṇīdṛśmfn. deer-eyed View this entry on the original dictionary page scan.
eṇikāf. Name of a woman. View this entry on the original dictionary page scan.
eṇīka on . View this entry on the original dictionary page scan.
eṇīkīya on . View this entry on the original dictionary page scan.
eṇīnayanamf(ā-)n. idem or 'mfn. deer-eyed ' View this entry on the original dictionary page scan.
eṇīpacanam. plural "cooking antelopes for food", Name of a tribe. View this entry on the original dictionary page scan.
eṇīpacanīyamfn. belonging to the above tribe on View this entry on the original dictionary page scan.
eṇīpadam. a kind of snake View this entry on the original dictionary page scan.
eṇīpadīf. a kind of poisonous insect View this entry on the original dictionary page scan.
eno(in compound for enas-). View this entry on the original dictionary page scan.
enomucmfn. rescuing from sin or evil View this entry on the original dictionary page scan.
env( ā-inv-) P. -invati-, to drive near ; to procure, bestow View this entry on the original dictionary page scan.
er( ā-īr-), Causal P. A1. -īrayati-, -te- (perfect tense 3. plural /erire-and /erire-) to bring near, cause to obtain, procure ; to procure for one's self, obtain ; to raise (as the voice in singing) View this entry on the original dictionary page scan.
ef. a ewe (eḍakā-), View this entry on the original dictionary page scan.
erakam. Name of a nāga- View this entry on the original dictionary page scan.
erakāf. a kind of grass of emollient and diluent properties etc. View this entry on the original dictionary page scan.
erakaf. ([ confer, compare Greek ]) View this entry on the original dictionary page scan.
erakan. a woollen carpet () View this entry on the original dictionary page scan.
erakīf. a species of plant View this entry on the original dictionary page scan.
erakīf. Name of a river View this entry on the original dictionary page scan.
eramattakam. Name of a man View this entry on the original dictionary page scan.
eraṇḍam. the castor-oil plant, Ricinus Communis or Palma Christi etc. View this entry on the original dictionary page scan.
eraṇḍāf. long pepper View this entry on the original dictionary page scan.
eraṇḍā Name (also title or epithet) of a charm, View this entry on the original dictionary page scan.
eraṇḍakam. Ricinus Communis View this entry on the original dictionary page scan.
eraṇḍapalla Name (also title or epithet) of a town, View this entry on the original dictionary page scan.
eraṇḍapattrakam. Ricinus Communis View this entry on the original dictionary page scan.
eraṇḍapattrikāf. Croton Polyandron View this entry on the original dictionary page scan.
eraṇḍaphalāf. idem or ' Name (also title or epithet) of a town, ' View this entry on the original dictionary page scan.
eraṇḍatailan. castor-oil View this entry on the original dictionary page scan.
eraṇḍītīrthan. Name of a tīrtha-. View this entry on the original dictionary page scan.
eraṅgam. a kind of fish View this entry on the original dictionary page scan.
erumfn. (fr. ā-īr-) equals gantṛ- (?) View this entry on the original dictionary page scan.
eru according to to some,"the penis". View this entry on the original dictionary page scan.
ervārumf. Cucumis Utilissimus View this entry on the original dictionary page scan.
ervārun. the fruit of the above plant. View this entry on the original dictionary page scan.
ervārukam. Cucumis Utilissimus View this entry on the original dictionary page scan.
e (probably connected with 3. iṣ-) cl.1 P. A1. eṣati- (imperative /eṣatu- parasmE-pada /eṣat- infinitive mood /eṣe-), -te-, eṣāṃ-cakre-, eṣitā-, etc., to go, move ; to creep, glide ; to glide or hasten towards, attain, obtain View this entry on the original dictionary page scan.
e( ā-īṣ-) P. A1. -īṣati-, -te-, to hasten near or towards, fly at ; to endeavour to reach or obtain ; to desire, request View this entry on the original dictionary page scan.
eṣamfn. gliding, running, hastening View this entry on the original dictionary page scan.
eṣa(Nominal verb m.of et/ad- q.v) View this entry on the original dictionary page scan.
eṣamfn. (fr.3. iṣ-) in fine compositi or 'at the end of a compound' seeking View this entry on the original dictionary page scan.
eṣam. the act of seeking or going after View this entry on the original dictionary page scan.
eṣam. (eṣ/a-), wish, option , (see svaīṣ/a-) View this entry on the original dictionary page scan.
eṣāf. wish ; ([ confer, compare Zend ae7sha; O. H. G.e1ra1.]) View this entry on the original dictionary page scan.
eṣaiṣyamfn. to be sought for, desirable View this entry on the original dictionary page scan.
eṣaiṣya according to to some the word is eṣai- ṣā-,"impetuous", and ṣy/ā- the instrumental case of the fem. ṣi-. View this entry on the original dictionary page scan.
eṣakā f. sg. of the diminutive of etad- View this entry on the original dictionary page scan.
eṣaṇaf(ā-)n. impulse, ardent desire View this entry on the original dictionary page scan.
eṣaṇamfn. seeking for, wishing View this entry on the original dictionary page scan.
eṣaṇam. an iron arrow View this entry on the original dictionary page scan.
eṣaṇāf. seeking with, desire, begging, solicitation, request etc. View this entry on the original dictionary page scan.
eṣaṇam. (with jaina-s) right behaviour when begging food View this entry on the original dictionary page scan.
eṣaṇam. a goldsmith's scale View this entry on the original dictionary page scan.
eṣaṇan. the act of seeking, begging, solicitation View this entry on the original dictionary page scan.
eṣaṇan. medical examination, probing View this entry on the original dictionary page scan.
eṣaṇāsamitif. correct behaviour when begging food View this entry on the original dictionary page scan.
eṣaṇīf. an iron or steel probe View this entry on the original dictionary page scan.
eṣaṇikāf. a goldsmith's scale View this entry on the original dictionary page scan.
eṣaṇinmfn. seeking, striving View this entry on the original dictionary page scan.
eṣaṇīyamfn. to be sought or aimed at, desirable View this entry on the original dictionary page scan.
eṣaṇīyamfn. in fine compositi or 'at the end of a compound' belonging to the medical examination of View this entry on the original dictionary page scan.
eṣavīram. Name of a despised Brahmanic family on View this entry on the original dictionary page scan.
eṣikāf. sg. of the diminutive of etad- View this entry on the original dictionary page scan.
eṣinmfn. (generally in fine compositi or 'at the end of a compound') going after, seeking, striving for, desiring View this entry on the original dictionary page scan.
eṣitavyamfn. to be sought commentator or commentary on View this entry on the original dictionary page scan.
eṣitavyamfn. to be approved commentator or commentary on View this entry on the original dictionary page scan.
eṣitṛmfn. one who seeks or strives after, desiring View this entry on the original dictionary page scan.
eṣṭamfn. (ā-+ iṣṭa-) obtained by offerings or oblations View this entry on the original dictionary page scan.
eṣṭamfn. (for 2. eṣṭa-See under /eṣ- equals ā--2. iṣ-.) View this entry on the original dictionary page scan.
eṣṭamfn. (or fr. ā-iṣ-), that which is desired or asked for View this entry on the original dictionary page scan.
eṣṭavai(Ved.inf. of ā--3. iṣ-), View this entry on the original dictionary page scan.
eṣṭavyamfn. (See above) to be striven after, desirable, wished for etc. View this entry on the original dictionary page scan.
eṣṭavyamfn. to be approved View this entry on the original dictionary page scan.
eṣṭif. (See above) seeking to go towards, wish, desire
eṣṭṛmfn. hastening on, advancing, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
eṣṭṛ equals eṣitṛ- above View this entry on the original dictionary page scan.
eṣyamfn. (See the last) to be striven after, to be sought for View this entry on the original dictionary page scan.
eṣyamfn. (fr. the Causal) , to be examined medically or probed View this entry on the original dictionary page scan.
eṣyamfn. ( i- future), what is to come, future View this entry on the original dictionary page scan.
eṣyatmfn. (fut.p. of i-) idem or 'mfn. ( i- future), what is to come, future ' View this entry on the original dictionary page scan.
eṣyatkālīyamfn. belonging to future time, future. View this entry on the original dictionary page scan.
eta(for 2.See sub voce, i.e. the word in the Sanskrit order) mfn. come near, approached
eta(for 1.See 4. e-) mf(ā-and /enī- )n. ( i- ),"rushing","darting" View this entry on the original dictionary page scan.
etamf(ā-and /enī- )n. of a variegated colour, varying the colour, shining, brilliant etc. View this entry on the original dictionary page scan.
etam. a kind of deer or antelope View this entry on the original dictionary page scan.
etam. the hide of the same View this entry on the original dictionary page scan.
etam. variegated colour View this entry on the original dictionary page scan.
ef. a hind View this entry on the original dictionary page scan.
etadmfn. (grammar 223; gaRa sarvādi- ) this, this here, here (especially as pointing to what is nearest to the speaker exempli gratia, 'for example' eṣa bāṇaḥ-,this arrow here in my hand; eṣa yāti panthāḥ-,here passes the way; eṣa kālaḥ-,here id est now, is the time; etad-,this here id est this world here below) View this entry on the original dictionary page scan.
etadmfn. sometimes used to give emphasis to the personal pronouns (exempli gratia, 'for example' eṣo'ham-,I, this very person here) or with omission of those pronouns (exempli gratia, 'for example' eṣa tvāṃ svargaṃ nayāmi-,I standing here will convey thee to heaven; etau praviṣṭau svaḥ-,we two here have entered) View this entry on the original dictionary page scan.
etadmfn. as the subject of a sentence it agrees in gender and number with the predicate without reference to the noun to be supplied (exempli gratia, 'for example' etad eva hi me dhanam-,for this [ scilicet cow] is my only wealth ) View this entry on the original dictionary page scan.
etadmfn. but sometimes the neuter singular remains (exempli gratia, 'for example' etad guruṣu vṛttiḥ-,this is the custom among guru-s ) View this entry on the original dictionary page scan.
etadmfn. etad- generally refers to what precedes, especially when connected with idam-, the latter then referring to what follows (exempli gratia, 'for example' eṣa vai prathamaḥ kalpaḥ- anukalpas tv ayaṃ jñeyaḥ-,this before-mentioned is the principal rule, but this following may be considered a secondary rule ) View this entry on the original dictionary page scan.
etadmfn. it refers also to that which follows, especially when connected with a relative clause (exempli gratia, 'for example' eṣa caiva gurur dharmo yam pravakṣyāmy ahaṃ tava-,this is the important law, which I will proclaim to you ) etc. View this entry on the original dictionary page scan.
etadind. in this manner, thus, so, here, at this time, now (exempli gratia, 'for example' n/a v/ā u et/an mriyase-,thou dost not die in this manner or by that ) ; ([ confer, compare Zend ae7ta; Old Persian aita; Armenian aid; Osk.eiso.]) View this entry on the original dictionary page scan.
etadādimfn. beginning with this, and so forth. View this entry on the original dictionary page scan.
etadantamfn. terminating with this, ending thus View this entry on the original dictionary page scan.
etadarthamind. on this account, for this end, therefore etc. View this entry on the original dictionary page scan.
etadarthamind. (etad-- arthaṃ yad-,to this end - that ) View this entry on the original dictionary page scan.
etadatiriktamfn. besides this. View this entry on the original dictionary page scan.
etadātmyan. , misprint for aitadātmya- (q.v; see śaṃkara-'s commentator or commentary on the passage) .
etadavadhiind. to this limit, so far. View this entry on the original dictionary page scan.
etadavasthamfn. of such a state or condition View this entry on the original dictionary page scan.
etaddāmfn. granting or bestowing this View this entry on the original dictionary page scan.
etaddevatyamfn. having this as deity View this entry on the original dictionary page scan.
etaddvitīyamfn. doing this for the second time View this entry on the original dictionary page scan.
etadīyamfn. belonging or relating to this (person or thing) View this entry on the original dictionary page scan.
etādṛkṣamf(ī-)n. such, such like, so formed, of this kind, similar to this View this entry on the original dictionary page scan.
etādṛś mf(ī-)n. such, such like, so formed, of this kind, similar to this View this entry on the original dictionary page scan.
etādṛśamf(ī-)n. such, such like, so formed, of this kind, similar to this View this entry on the original dictionary page scan.
etadupaniṣadmfn. following this upaniṣad-, View this entry on the original dictionary page scan.
etadvatind. like this, thus. View this entry on the original dictionary page scan.
etadyonimfn. of this origin View this entry on the original dictionary page scan.
etagvamfn. of variegated colour, shining (said of horses) View this entry on the original dictionary page scan.
etaj(in compound for etad-). View this entry on the original dictionary page scan.
etajjamfn. arising from this. View this entry on the original dictionary page scan.
etakamf(ikā-, enikā-)n. equals /eta- above View this entry on the original dictionary page scan.
etan(by saṃdhi- for etad-). View this entry on the original dictionary page scan.
etanam. expiration, breathing out, discharging air from the lungs View this entry on the original dictionary page scan.
etanam. the fish Silurus Pelorius View this entry on the original dictionary page scan.
etanmayamf(ī-)n. made or consisting of this, of such a kind View this entry on the original dictionary page scan.
etarhiind. now, at this time, at present, now-a-days etc. View this entry on the original dictionary page scan.
etarhiind. then (correlating to y/arhi-) View this entry on the original dictionary page scan.
etarhin. (i-) a measure of time (fifteen idāni-s, or the fifteenth part of a kṣipra-) View this entry on the original dictionary page scan.
etaśa mfn. of variegated colour, shining, brilliant (said of brahmaṇas-pati-) View this entry on the original dictionary page scan.
etaśam. a horse of variegated colour, dappled horse (especially said of the Sun's horse) View this entry on the original dictionary page scan.
etaśam. Name of a man (protected by indra-) View this entry on the original dictionary page scan.
etaśam. a Brahman View this entry on the original dictionary page scan.
etaśamfn. of variegated colour, shining, brilliant (said of brahmaṇas-pati-) View this entry on the original dictionary page scan.
etaśam. a horse of variegated colour, dappled horse (especially said of the Sun's horse) View this entry on the original dictionary page scan.
etaśam. Name of a man (protected by indra-) View this entry on the original dictionary page scan.
etaśam. a Brahman View this entry on the original dictionary page scan.
etaśasm. a Brahman View this entry on the original dictionary page scan.
etat(in compound for etad-). View this entry on the original dictionary page scan.
etatkālamind. now. View this entry on the original dictionary page scan.
etatkālīnamfn. belonging to or happening in the present time. View this entry on the original dictionary page scan.
etatkṣaṇātind. from this moment, henceforth View this entry on the original dictionary page scan.
etatkṣaṇeind. in this moment, now. View this entry on the original dictionary page scan.
etatparamfn. intent on or absorbed in this commentator or commentary on View this entry on the original dictionary page scan.
etatprabhṛtimfn. beginning with this, View this entry on the original dictionary page scan.
etatprathamamfn. doing this for the first time View this entry on the original dictionary page scan.
etatsamamfn. equal to this. View this entry on the original dictionary page scan.
etatsamīpan. presence of this one. View this entry on the original dictionary page scan.
etattṛtīyamfn. doing this for the third time View this entry on the original dictionary page scan.
etattulyamfn. similar to this. View this entry on the original dictionary page scan.
etāvac(by saṃdhi- for et/āvat-below) . View this entry on the original dictionary page scan.
etāvacchas(t-śas-) ind. so many times, so often View this entry on the original dictionary page scan.
etāvad(by saṃdhi- for et/āvat-). View this entry on the original dictionary page scan.
etāvadāvāsamfn. having so many abodes, View this entry on the original dictionary page scan.
etāvaddhāind. so many fold View this entry on the original dictionary page scan.
etāvan(by saṃdhi- for et/āvat-). View this entry on the original dictionary page scan.
etāvanmātramfn. of this measure, of this quantity, so great, such View this entry on the original dictionary page scan.
etāvatmfn. so great, so much, so many, of such a measure or compass, of such extent, so far, of such quality or kind etc. View this entry on the original dictionary page scan.
etāvatmfn. (often in connection with a relative clause, the latter generally following; etāvān eva puruṣo yaj jāyātmā prajā-,a man is of such measure as [i.e. made complete by] his wife, himself, and his progeny ) etc. View this entry on the original dictionary page scan.
etāvatind. so far, thus far, so much, in such a degree, thus View this entry on the original dictionary page scan.
etāvatithamf(ī-)n. the so-manieth (varia lectio tima-), , Scholiast or Commentator View this entry on the original dictionary page scan.
etāvattvan. the being so great or so much, quantity, number, size View this entry on the original dictionary page scan.
etāvattvan. (with following yad-,such a state or quantity etc., that.) View this entry on the original dictionary page scan.
eṭh cl.1 A1. eṭhate-, eṭhāṃ-cakre-, eṭhitā-, etc., to be a rogue or rascal ; to cheat View this entry on the original dictionary page scan.
etif. arrival, approach View this entry on the original dictionary page scan.
etivatmfn. containing a form of 5. i- (eti-), View this entry on the original dictionary page scan.
etṛm. (et/arī- et/ari- locative case ) ( i-), one who goes or approaches (for anything) View this entry on the original dictionary page scan.
etṛm. asking, requesting View this entry on the original dictionary page scan.
etṛmfn. in fine compositi or 'at the end of a compound' one who goes (see p/arāparaitṛ-etc.) View this entry on the original dictionary page scan.
etya ind.p. having come near etc. View this entry on the original dictionary page scan.
evaind. (in the saṃhitā- also ev/ā-) ( i- ;fr. pronominal base e- , probably connected with 2. /eva-), so, just so, exactly so (in the sense of the later evam-) View this entry on the original dictionary page scan.
evaind. indeed, truly, really (often at the beginning of a verse in conjunction with other particles, as id-, hi-) View this entry on the original dictionary page scan.
evaind. (in its most frequent use of strengthening the idea expressed by any word, eva-must be variously rendered by such adverbs as) just, exactly, very, same, only, even, alone, merely, immediately on, still, already, etc. (exempli gratia, 'for example' tvam eva yantā nānyo 'sti pṛthivyām-,thou alone art a charioteer, no other is on earth, i.e. thou art the best charioteer ; tāvatīm eva rātrim-,just so long as a night; evam- eva-or tathaiva-,exactly so, in this manner only;in the same manner as above; tenaiva mantreṇa-,with the same mantra- as above; apaḥ spṛṣṭvaiva-,by merely touching water; tān eva-,these very persons; na cirād eva-,in no long time at all; japyenaiva-,by sole repetition; abhuktvaiva-,even without having eaten; iti vadann eva-,at the very moment of saying so; sa jīvann eva-,he while still living, etc.) etc. View this entry on the original dictionary page scan.
evaind. (sometimes, especially in connection with other adverbs, eva-is a mere expletive without any exact meaning and not translatable exempli gratia, 'for example' tv eva-, caiva-, eva ca-,etc.;according to native authorities eva-implies emphasis, affirmation, detraction, diminution, command, restrainment) ; ([ confer, compare Zend aeva; Gothic aiv; Old German eo,io; modern German je.]) View this entry on the original dictionary page scan.
evamfn. ( i-), going, moving, speedy, quick View this entry on the original dictionary page scan.
evam. course, way (generally instrumental case plural) View this entry on the original dictionary page scan.
evam. the earth, world ([ ]) View this entry on the original dictionary page scan.
evam. a horse ([ ]) View this entry on the original dictionary page scan.
evam. plural way or manner of acting or proceeding, conduct, habit, usage, custom View this entry on the original dictionary page scan.
evam. ([ confer, compare Greek , ; Latin aevu-m; Gothic aivs; O.H.Ge7waand Anglo-Saxon e7u,e7o,"custom","law"; German ehe.]) View this entry on the original dictionary page scan.
evamind. (fr. pronominal base e- ;probably connected with 1. ev/a-), thus, in this way, in such a manner, such, (it is not found in the oldest hymns of the veda-, where its place is taken by 1. ev/a-,but occurs in later hymns ind. in the brāhmaṇa-s, especially in connection with vid-,"to know", and its derivatives[ exempli gratia, 'for example' ya evaṃ veda-,he who knows so; see evaṃ-v/id-, column 3];in classical Sanskrit evam-occurs very frequently, especially in connection with the roots vac-,"to speak", and śru-,"to hear", and refers to what precedes as well as to what follows[ exempli gratia, 'for example' evam uktvā-,having so said; evam evaitat-,this is so; evam astu-or evam bhavatu-,be it so, I assent; asty evam-,it is so; yady evam-,if this be so; kim evam-,how so? what is the meaning of it? what does this refer to? maivam-,not so! evam-- yathā-or yathā-- evam-,so - as]) etc.
evamind. (it is also often used like an adjective[ exempli gratia, 'for example' evaṃ te vacane rataḥ-,rejoicing in such words of thine; where evam- equals evaṃ-vidhe-]) View this entry on the original dictionary page scan.
evamind. sometimes evam- is merely an expletive View this entry on the original dictionary page scan.
evamind. according to lexicographers evam- may imply likeness (so) View this entry on the original dictionary page scan.
evamind. sameness of manner (thus) View this entry on the original dictionary page scan.
evamind. assent (yes, verily) View this entry on the original dictionary page scan.
evamind. affirmation (certainly, indeed, assuredly) View this entry on the original dictionary page scan.
evamind. command (thus, etc.) View this entry on the original dictionary page scan.
evamind. and be used as an expletive. View this entry on the original dictionary page scan.
evamabhyanūktamfn. so stated or spoken about View this entry on the original dictionary page scan.
evamācāramfn. behaving or acting in such a manner View this entry on the original dictionary page scan.
evamādi mfn. beginning with such a one, of such qualities or kind, such View this entry on the original dictionary page scan.
evamādyamfn. beginning with such a one, of such qualities or kind, such View this entry on the original dictionary page scan.
evamākṛtimfn. so shaped View this entry on the original dictionary page scan.
evamarthīyamfn. relating to that View this entry on the original dictionary page scan.
evamātmakamf(ikā-)n. of such a nature, so conditioned View this entry on the original dictionary page scan.
evamavasthamfn. so situated View this entry on the original dictionary page scan.
evambhūtamfn. of such a quality or nature, such View this entry on the original dictionary page scan.
evambhūtavatmfn. furnished with anything of this kind. View this entry on the original dictionary page scan.
evaṃdravyamfn. consisting of such substances View this entry on the original dictionary page scan.
evaṃgatamfn. being in such a condition or state, so circumstanced, of such kind View this entry on the original dictionary page scan.
evaṃgateind. under such circumstances View this entry on the original dictionary page scan.
evaṃgotramfn. of such a family, View this entry on the original dictionary page scan.
evaṃguṇamfn. possessing such qualities or good qualities etc. View this entry on the original dictionary page scan.
evaṃguṇajātīyamfn. idem or 'mfn. possessing such qualities or good qualities etc.' View this entry on the original dictionary page scan.
evaṃguṇasaṃpannamfn. idem or 'mfn. idem or 'mfn. possessing such qualities or good qualities etc.' ' View this entry on the original dictionary page scan.
evaṃguṇopetamfn. idem or 'mfn. idem or 'mfn. idem or 'mfn. possessing such qualities or good qualities etc.' ' ' View this entry on the original dictionary page scan.
evaṃjāti mfn. of such a family, View this entry on the original dictionary page scan.
evaṃjātīyamfn. of such a kind or nature, such View this entry on the original dictionary page scan.
evaṃkālamfn. containing so many syllabic instants on View this entry on the original dictionary page scan.
evaṃkāramind. in this manner View this entry on the original dictionary page scan.
evaṃkarmanmfn. one who has done so, View this entry on the original dictionary page scan.
evaṃkāryamfn. having such an aim, aiming at that View this entry on the original dictionary page scan.
evaṃkḷptamfn. so prescribed or enjoined, View this entry on the original dictionary page scan.
evaṃkratumfn. thus minded View this entry on the original dictionary page scan.
evaṃnāmanmfn. so called View this entry on the original dictionary page scan.
evaṃnyaṅgamfn. having such a characteristic, of such a kind View this entry on the original dictionary page scan.
evaṃnyāyamfn. following this manner or rule of performance View this entry on the original dictionary page scan.
evampariṇāmamfn. having such a conclusion, View this entry on the original dictionary page scan.
evamprabhāvamfn. possessed of such power View this entry on the original dictionary page scan.
evamprakāra mfn. of such a kind, such View this entry on the original dictionary page scan.
evampratyayamfn. having such a belief, View this entry on the original dictionary page scan.
evampravādamfn. having such a grammatical form, View this entry on the original dictionary page scan.
evamprāyamfn. of such a kind, such View this entry on the original dictionary page scan.
evampūrvamfn. preceded by this View this entry on the original dictionary page scan.
evaṃrūpamf(ā-)n. of such a form or kind View this entry on the original dictionary page scan.
evaṃsaṃjñakamfn. having such a name or term, named thus View this entry on the original dictionary page scan.
evaṃsamṛddhamfn. so complete View this entry on the original dictionary page scan.
evaṃsaṃsthitikamfn. of such a nature or kind View this entry on the original dictionary page scan.
evaṃśīlamfn. of such a character or disposition, View this entry on the original dictionary page scan.
evaṃtarkinmfn. concluding, reasoning thus View this entry on the original dictionary page scan.
evaṃvidmfn. knowing so or thus, well instructed, familiar with what is right View this entry on the original dictionary page scan.
evaṃvidhamfn. of such a kind, in such a form or manner, such View this entry on the original dictionary page scan.
evaṃvidusmfn. (= vidvas-), View this entry on the original dictionary page scan.
evaṃvidvas(once -vidv/as- ) idem or 'mfn. (= vidvas-), ' View this entry on the original dictionary page scan.
evaṃvīryamfn. strong in that respect View this entry on the original dictionary page scan.
evaṃvīryamfn. possessed of such a power View this entry on the original dictionary page scan.
evaṃviṣayamfn. having such an object, referring to that commentator or commentary on View this entry on the original dictionary page scan.
evaṃviśeṣaṇamfn. having such an attribute, thus defined commentator or commentary on View this entry on the original dictionary page scan.
evaṃvratamfn. fulfilling such duties View this entry on the original dictionary page scan.
evaṃvratamfn. of such a behaviour, acting thus View this entry on the original dictionary page scan.
evaṃvṛtta mfn. acting or behaving in such a manner, of such a kind View this entry on the original dictionary page scan.
evaṃvṛttimfn. acting or behaving in such a manner, of such a kind View this entry on the original dictionary page scan.
evaṃyuktam(-yuktam-) ind. in such a manner View this entry on the original dictionary page scan.
evāram. (etymology doubtful) Name of a kind of soma- ([ ]) View this entry on the original dictionary page scan.
evāsham. a kind of small animal (confer, compare y/ev- and yav-), View this entry on the original dictionary page scan.
evathāind. so, just so, like View this entry on the original dictionary page scan.
evāvadam. (fr. 1. eva-and ā-vad- ?), Name of a ṛṣi- ([ ]) View this entry on the original dictionary page scan.
evayāmfn. going quickly (said of viṣṇu-) View this entry on the original dictionary page scan.
evayāmfn. (of the marut-s) View this entry on the original dictionary page scan.
evayāmarutm. "accompanied or protected by the quick marut-s", Name of a ṛṣi- View this entry on the original dictionary page scan.
evayāmarutm. Name of a hymn () View this entry on the original dictionary page scan.
evayāvanmf(arī-)n. going quickly (said of viṣṇu- and the marut-s) View this entry on the original dictionary page scan.
abālendum. "not the infantine moon", full moon View this entry on the original dictionary page scan.
abdhiphenam. cuttle fish bone. View this entry on the original dictionary page scan.
abhāgadheyamfn. receiving no share, View this entry on the original dictionary page scan.
abhaṅgaśleṣam. an ambiguity without any different analysis of the words, View this entry on the original dictionary page scan.
abhedam. non-fracture, compactness, closeness of array etc. View this entry on the original dictionary page scan.
abhedam. absence of difference or distinction, identity View this entry on the original dictionary page scan.
abhedamfn. not different, identical View this entry on the original dictionary page scan.
abhedakamfn. not dividing, not causing any distinction View this entry on the original dictionary page scan.
abhedinmfn. not different View this entry on the original dictionary page scan.
abhedyamfn. not to be divided or broken or pierced View this entry on the original dictionary page scan.
abhedyamfn. indivisible View this entry on the original dictionary page scan.
abhedyamfn. not to be betrayed (as a secret formula) View this entry on the original dictionary page scan.
abhedyanot to be seduced, View this entry on the original dictionary page scan.
abhedyan. a diamond View this entry on the original dictionary page scan.
abhedyatāf. ([ ]) indivisibility, impenetrability. View this entry on the original dictionary page scan.
abhedyatvan. ([ ]) indivisibility, impenetrability.
ābhef. Name of one of the rāgiṇī-s or modes of music (personified as a female) View this entry on the original dictionary page scan.
abhiceṣṭāf. activity, View this entry on the original dictionary page scan.
abhidevanan. a board for playing at dice View this entry on the original dictionary page scan.
abhidheyamfn. to be named or mentioned View this entry on the original dictionary page scan.
abhidheyamfn. to be expressed, to be spoken of etc. View this entry on the original dictionary page scan.
abhidheyamfn. being, spoken of, being expressed View this entry on the original dictionary page scan.
abhidheyan. signification, meaning View this entry on the original dictionary page scan.
abhidheyan. "that which is expressed or referred to", the substantive. View this entry on the original dictionary page scan.
abhidheyarahitamfn. having no sense or meaning, unmeaning, nonsensical. View this entry on the original dictionary page scan.
abhidheyatāf. signification, meaning. View this entry on the original dictionary page scan.
abhidhyeyamfn. deserving attention View this entry on the original dictionary page scan.
abhidhyeyamfn. (negative an--) View this entry on the original dictionary page scan.
abhigeṣṇamfn. calling to View this entry on the original dictionary page scan.
abhihe(parasmE-pada dative case m. -heṣate-) to neigh towards View this entry on the original dictionary page scan.
abhihveto call near View this entry on the original dictionary page scan.
abhijñetaramfn. not familiar with (compound), View this entry on the original dictionary page scan.
abhīkeind. in the presence of (genitive case), near, towards View this entry on the original dictionary page scan.
abhikṣepam. a particular manner of handling a club, View this entry on the original dictionary page scan.
abhilekhanan. writing upon, inscribing. View this entry on the original dictionary page scan.
abhilekhitan. a written document View this entry on the original dictionary page scan.
abhimethanan. insulting or injurious speech View this entry on the original dictionary page scan.
abhimethikāf. idem or 'n. insulting or injurious speech ' View this entry on the original dictionary page scan.
abhimukheind. in front or presence of (genitive case;or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
abhināmadheyan. a surname, View this entry on the original dictionary page scan.
abhinetavyamfn. to be represented dramatically. View this entry on the original dictionary page scan.
abhinetṛm. one who brings near View this entry on the original dictionary page scan.
abhineyamfn. equals abhi-netavya-. View this entry on the original dictionary page scan.
abhinīlanetratāf. having dark-blue eyes (one of the 32 signs of perfection), . View this entry on the original dictionary page scan.
abhiniveśam. application, intentness, study, affection, devotion (with locative case or in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
abhiniveśam. determination (to effect a purpose or attain an object), tenacity, adherence to (locative case) View this entry on the original dictionary page scan.
abhiniveśanan. application to, intentness on (compound), View this entry on the original dictionary page scan.
abhiniveśinmfn. intent upon, devoted to View this entry on the original dictionary page scan.
abhiniveśinmfn. determined. View this entry on the original dictionary page scan.
abhiniveśitamfn. made to enter into, plunged into. View this entry on the original dictionary page scan.
abhinnavelamfn. not breaking bounds, View this entry on the original dictionary page scan.
abhipale( i-) to follow after any one running away (accusative), PBr. (see pale-.) View this entry on the original dictionary page scan.
abhipare( i-), (Imper. 2. sg. -p/arehi-) to go away towards (accusative) View this entry on the original dictionary page scan.
abhiparye( i-), (said of the time)"to pass round" (accusative) id est to pass away or elapse View this entry on the original dictionary page scan.
abhipratyave( i-) to move down towards View this entry on the original dictionary page scan.
abhipratye( i-) to come back towards (accusative) View this entry on the original dictionary page scan.
abhipraveśam. entering into View this entry on the original dictionary page scan.
abhipre( i-), -praiti- (Imper. 2. sg. -pr/ehi-2. plural pr/eta- ; ) to go near to, approach ; to approach with one's mind, to think of ; to aim at, intend. View this entry on the original dictionary page scan.
abhiprekṣ( īkṣ-), (generally ind.p. -preṣya-) to look at, to see, view View this entry on the original dictionary page scan.
abhiprepsumfn. desirous of gaining View this entry on the original dictionary page scan.
abhiprepsuSee abhi-prāp-. View this entry on the original dictionary page scan.
abhiprer( īr-), Causal -preayati- to drive forwards, push on View this entry on the original dictionary page scan.
abhipreraṇan. pushing, setting in motion (as a see-saw). View this entry on the original dictionary page scan.
abhipre(1 iṣ-), (1. sg. -preṣyāmi-) to summon, command View this entry on the original dictionary page scan.
abhipreṣaṇan. sending out (messengers), View this entry on the original dictionary page scan.
abhipreṣitamfn. that which has been commanded or ordered, (/an-- negative) View this entry on the original dictionary page scan.
abhipretamfn. meant, intended etc. View this entry on the original dictionary page scan.
abhipretamfn. accepted, approved etc.
abhipretamfn. to whom one's heart is devoted, dear View this entry on the original dictionary page scan.
abhipretyaind. intending, meaning by View this entry on the original dictionary page scan.
abhipṛṣṭheind. at the back of, behind View this entry on the original dictionary page scan.
abhipūrveṇaind. in regular order, successively. [PBr.] View this entry on the original dictionary page scan.
abhisaṃdehan. organ of generation, (dual number accusative he-) (varia lectio abhisaṃdoha-). View this entry on the original dictionary page scan.
abhisame( -ā-i-), Ved. (Imper. abh/i-... sam-/aitu-[ ] or -.. abh/i s/am-etu-[ ]) to join in coming near (accusative), approach together. View this entry on the original dictionary page scan.
abhisametamfn. assembled View this entry on the original dictionary page scan.
abhisaṃkhyeyamfn. to be enumerated View this entry on the original dictionary page scan.
abhisaṃkṣepam. compressing View this entry on the original dictionary page scan.
abhisamprekṣ( īkṣ-), (ind.p. -prekṣya-) to look at, perceive View this entry on the original dictionary page scan.
abhiśastenyaetc. See /an-abhiśasta-. View this entry on the original dictionary page scan.
abhiṣecanan. sprinkling View this entry on the original dictionary page scan.
abhiṣecanan. initiation, inauguration View this entry on the original dictionary page scan.
ābhiṣecanikamfn. idem or 'mfn. serving for it ' View this entry on the original dictionary page scan.
abhiṣecanīyamfn. worthy of inauguration View this entry on the original dictionary page scan.
abhiṣecanīyamfn. belonging to inauguration (as vessels, etc.) etc. View this entry on the original dictionary page scan.
abhiṣecanīyam. Name of a sacrificial ceremony performed at the inauguration of a king View this entry on the original dictionary page scan.
abhiṣecitamfn. caused to be sprinkled, watered, wetted View this entry on the original dictionary page scan.
abhiṣecitamfn. inaugurated. View this entry on the original dictionary page scan.
abhiṣecyamfn. to be anointed View this entry on the original dictionary page scan.
abhiṣekam. anointing, inaugurating or consecrating (by sprinkling water), inauguration of a king, royal unction
abhiṣekam. the water or liquid used at an inauguration etc. View this entry on the original dictionary page scan.
abhiṣekam. religious bathing, ablution etc. View this entry on the original dictionary page scan.
abhiṣekam. bathing of the divinity to whom worship is offered (see mahābhiṣeka-and mūrdhābhiṣeka-.) View this entry on the original dictionary page scan.
ābhiṣekamfn. (fr. abhi-ṣeka-), relating to the inauguration of a king View this entry on the original dictionary page scan.
ābhiṣekamfn. serving for it View this entry on the original dictionary page scan.
abhiṣekabhūmipratilambham. attainment of the royal station, . View this entry on the original dictionary page scan.
abhiṣekāham. day of inauguration. View this entry on the original dictionary page scan.
abhiṣekārdraśirasmfn. wet on the head with the royal unction. View this entry on the original dictionary page scan.
abhiṣekaśālāf. the hall of coronation. View this entry on the original dictionary page scan.
abhiṣektavyamfn. to be consecrated or anointed View this entry on the original dictionary page scan.
abhiṣektṛm. one who consecrates (by sprinkling) View this entry on the original dictionary page scan.
abhiṣekyamfn. worthy of inauguration (abhiṣeka-) View this entry on the original dictionary page scan.
abhiṣekyamfn. (said of the elephant) used for the inauguration (Prakritabhisekka). View this entry on the original dictionary page scan.
abhiṣeṇam. directing arrows against View this entry on the original dictionary page scan.
abhiṣeṇanan. marching against (in compound) with an army View this entry on the original dictionary page scan.
abhiṣeṇayaNom. P. -ṣeṇayati-, (imperfect tense -aṣeṇayat- ), to assail with an army, to march with an army against (accusative) etc.: Desiderative -ṣiṣeṇayiṣati- View this entry on the original dictionary page scan.
abhisevanan. practising, cultivating View this entry on the original dictionary page scan.
abhiṣiṣeṇayiṣuSee abhi-ṣeṇ/a-. View this entry on the original dictionary page scan.
abhiṣiṣeṇayiṣumfn. (fr. Desiderative) desirous of marching against View this entry on the original dictionary page scan.
abhisneham. affection, desire View this entry on the original dictionary page scan.
abhīṣṭadevatāf. beloved goddess, favourite deity (invoked in the last prayer before death) View this entry on the original dictionary page scan.
abhisvareind. dative case "for calling into one's presence", just behind (with genitive case) View this entry on the original dictionary page scan.
abhitodevayajanamātradeśamfn. whose space on all sides suffices for a sacrificial ground View this entry on the original dictionary page scan.
abhivedhinSee abhi-vyadh-. View this entry on the original dictionary page scan.
abhivedhinmfn. (in geometry) cutting (as one line another) . View this entry on the original dictionary page scan.
abhivegam. tottering, vacillation View this entry on the original dictionary page scan.
abhivegaSee abhi-vij-. View this entry on the original dictionary page scan.
abhiveṣṭCaus. to cover with (instrumental case) View this entry on the original dictionary page scan.
abhivijñeyamfn. perceivable, visible, View this entry on the original dictionary page scan.
abhivikṣepam. flapping one's wings over commentator or commentary on View this entry on the original dictionary page scan.
abhivye(Imper. 2. sg. A1. -vyayasva-) to wrap one's self into (accusative) View this entry on the original dictionary page scan.
abhramujīviteśam.Name of Indras elephant View this entry on the original dictionary page scan.
abhreṣam. non-deviation, fitness, propriety View this entry on the original dictionary page scan.
ābhūṣeṇyamfn. to be obeyed or praised or honoured View this entry on the original dictionary page scan.
abhyācare locative case ind. See abhy-āgāre-. View this entry on the original dictionary page scan.
abhyācāreind. See abhy.āgāre-. View this entry on the original dictionary page scan.
abhyadhveind. locative case on the way View this entry on the original dictionary page scan.
abhyāgāreind. locative case in the house View this entry on the original dictionary page scan.
abhyāgāreind. varia lectio abhy-ācāre- ([ ]) and abhy-ācare- ([ ]),"in the reach or compass." View this entry on the original dictionary page scan.
abhyāhve -hv/ayate-, to address (with the āhāva-formula) ; (pr. p. -hvayat-) to shout at, challenge, attack View this entry on the original dictionary page scan.
abhyanujñeyamfn. to be admitted or assented to, View this entry on the original dictionary page scan.
abhyardheind. only locative case opposite to, in the face of (ablative) View this entry on the original dictionary page scan.
abhyāśeind. locative case near (with genitive case or ablative) etc. View this entry on the original dictionary page scan.
abhyave( i-), -avaiti- to go down, descend (into water, as in bathing) ; (future 3. plural -avaiṣyanti-) to condescend ; (imperfect tense 3. plural -av/āyan-) to perceive View this entry on the original dictionary page scan.
abhyavekṣ( īkṣ-), -avekṣate- to look at or upon View this entry on the original dictionary page scan.
abhyāyaṃsenyamfn. (said of the aśvin-s) one who allows himself to be drawn near (for accepting the sacrificial oblation) View this entry on the original dictionary page scan.
abhye( i-), -yati- ([ ]) or -/aiti- ([ ]), to go near, come to, approach View this entry on the original dictionary page scan.
abhyeṣaṇan. (only for the explan. of abhiṣṭi-) approaching (either in a friendly or hostile manner) on View this entry on the original dictionary page scan.
abhyeṣaṇan. desiring, wishing for on View this entry on the original dictionary page scan.
abhyeṣaṇaSee abhī-.
abhyeṣaṇīyamfn. (only for the explan. of abhiṣṭi-) to be desired on View this entry on the original dictionary page scan.
abhyetya ind.p. having approached, N. View this entry on the original dictionary page scan.
abhyudayeṣṭif. Name of an expiatory sacrifice (see abhyuditeṣṭi-.) View this entry on the original dictionary page scan.
abhyuddṛṣṭeṣṭif. Name of a ceremony (beginning only after the moon has become visible), View this entry on the original dictionary page scan.
abhyude( i-), (ind.p. -/etya-) to go out in order to meet any one (accusative) View this entry on the original dictionary page scan.
abhyudīriteind. locative case after it had been said by (instrumental case) View this entry on the original dictionary page scan.
abhyuditeṣṭif. equals abhyudayeṣṭi-, View this entry on the original dictionary page scan.
abhyupasev -sevate-, to observe religiously View this entry on the original dictionary page scan.
abhyupe( i-), -upaiti- (3. plural -/upayanti-) to go near, approach, arrive at, enter etc. ; (with apaḥ-) to bathe ; to approach (in copulation) ; to go to meet any one (accusative) ; to enter a state or condition, obtain, share (Ved. infinitive mood -upaitos-) etc. ; to admit as an argument or a position (perf. p. genitive case plural -upeyuṣām-) commentator or commentary on and on ; to select as (accusative) ; to agree with, approve of (See abhy-upeta-): Passive voice -upeyate- to be approved of, admitted View this entry on the original dictionary page scan.
abhyupe(-upā- i-), (Imper. 2. sg. -upaihi-) to approach (for refuge, śaraṇam-) View this entry on the original dictionary page scan.
abhyupekṣ( īkṣ-), (perf. p. -upekṣitavat-) to overlook, allow View this entry on the original dictionary page scan.
abhyupetamfn. approached, arrived at (accusative) View this entry on the original dictionary page scan.
abhyupetamfn. (with gṛham-) staying in a house View this entry on the original dictionary page scan.
abhyupetamfn. furnished with (in compound [ ]or instrumental case) View this entry on the original dictionary page scan.
abhyupetamfn. agreed upon, assented to View this entry on the original dictionary page scan.
abhyupetamfn. promised View this entry on the original dictionary page scan.
abhyupetavyamfn. to be admitted or assented to commentator or commentary on View this entry on the original dictionary page scan.
abhyupetya ind.p. having arrived at (accusative) View this entry on the original dictionary page scan.
abhyupetyahaving entered View this entry on the original dictionary page scan.
abhyupetyahaving assented or agreed to. View this entry on the original dictionary page scan.
abhyupetyāśuśrūṣāf. breach of a contracted service, a title of law treating of disputes between the master and a servant who has broken his agreement commentator or commentary on View this entry on the original dictionary page scan.
abhyupeyivasmf(yuṣī-)n. (perf. p.) having approached, arrived at (accusative) View this entry on the original dictionary page scan.
abhyupeyivasmf(yuṣī-)n. having admitted (See 1. abhy-upe-). View this entry on the original dictionary page scan.
abhyuttheyamfn. to be greeted reverentially (id est by rising from one's seat) commentator or commentary on View this entry on the original dictionary page scan.
abjanetramfn. equals -dṛś-. View this entry on the original dictionary page scan.
acalaśreṣṭham. chief of mountains. View this entry on the original dictionary page scan.
ācārabhedam. breaking the rules of traditional usage View this entry on the original dictionary page scan.
ācāravef. "altar of religious customs", Name of āryāvarta- View this entry on the original dictionary page scan.
ācāravyapetamfn. deviating from established custom View this entry on the original dictionary page scan.
ācāryadeśīyamfn. (see ) "somewhat inferior to an ācārya-"(a title applied by commentators to scholars or disputants whose statements contain only a part of the truth and are not entirely correct;the term is opposed to " ācārya-"and" siddhāntin-"), kaiyaṭa- and nāgojībhaṭṭa- on View this entry on the original dictionary page scan.
ācāryadevamfn. worshipping one's teacher like a deity View this entry on the original dictionary page scan.
ācchedam. cutting, cutting off, excision View this entry on the original dictionary page scan.
ācchedanan. id View this entry on the original dictionary page scan.
ācchedanan. exclusion View this entry on the original dictionary page scan.
ācchedanīf. Name of the passage in (, apām medhyam-,-10, śaradaḥ śatam-) in which the word ā-cchett/ṛ- occurs (by called chedanamantra-). View this entry on the original dictionary page scan.
acchedikamfn. not fit or needing to be cut View this entry on the original dictionary page scan.
acchedyamfn. improper or impossible to be cut, indivisible. View this entry on the original dictionary page scan.
acchera(or añś/era-), mfn. (said of the waters), View this entry on the original dictionary page scan.
acchetamfn. approached, attained View this entry on the original dictionary page scan.
ācchettṛm. one who cuts off View this entry on the original dictionary page scan.
ācchettṛetc. See ā-cchid-. View this entry on the original dictionary page scan.
acchetyamfn. to be approached View this entry on the original dictionary page scan.
acchidreṇaind. uninterruptedly, without break from first to last.
āceṣṭ -ceṣṭate-, to do, perform : Causal -ceṣṭayati- (varia lectio -veṣṭayati-) to cause to move, set in motion View this entry on the original dictionary page scan.
aceṣṭamfn. effortless, motionless. View this entry on the original dictionary page scan.
aceṣṭatāf. loss of motion from fainting etc. View this entry on the original dictionary page scan.
āceṣṭitamfn. undertaken, done View this entry on the original dictionary page scan.
āceśvaram. Name of a temple built by āca- View this entry on the original dictionary page scan.
āceśvaraSee āca-. View this entry on the original dictionary page scan.
acetanamfn. without consciousness, inanimate View this entry on the original dictionary page scan.
acetanamfn. unconscious, insensible, senseless, fainting, etc. View this entry on the original dictionary page scan.
acetānamfn. thoughtless, infatuated View this entry on the original dictionary page scan.
acetasmfn. imprudent View this entry on the original dictionary page scan.
acetasmfn. unconscious, insensible. View this entry on the original dictionary page scan.
acireṇaind. not long, not for long View this entry on the original dictionary page scan.
adaiteyam. "not a daiteya-", a god, View this entry on the original dictionary page scan.
addhābodheyam. plural adherents of a particular śākhā- or recension of the white yajur-veda-. View this entry on the original dictionary page scan.
adeham. "bodiless", the god of love, View this entry on the original dictionary page scan.
ādehadāhamind. from the cremation of the body, View this entry on the original dictionary page scan.
ādeśam. advice, instruction etc. View this entry on the original dictionary page scan.
ādeśam. account information, declaration View this entry on the original dictionary page scan.
ādeśam. foretelling, soothsaying, View this entry on the original dictionary page scan.
ādeśam. a precept View this entry on the original dictionary page scan.
ādeśam. rule, command, order etc. View this entry on the original dictionary page scan.
ādeśam. a substitute, substituted form or letter View this entry on the original dictionary page scan.
ādeśam. result or consequence of stellar conjunction View this entry on the original dictionary page scan.
ādeśaa guest (= prāghūrṇika-), View this entry on the original dictionary page scan.
adeśam. a wrong place, an improper place. View this entry on the original dictionary page scan.
adeśajamfn. produced in a wrong place. View this entry on the original dictionary page scan.
ādeśakam. one who commands, a guide View this entry on the original dictionary page scan.
adeśakālan. wrong place and time. View this entry on the original dictionary page scan.
ādeśakārinmfn. obeying orders. View this entry on the original dictionary page scan.
ādeśanan. the act of pointing out, commanding, instructing View this entry on the original dictionary page scan.
adeśasthamfn. out of place, in the wrong place View this entry on the original dictionary page scan.
adeśasthamfn. one absent from his country, an absentee. View this entry on the original dictionary page scan.
adeśikamfn. guideless, homeless, View this entry on the original dictionary page scan.
ādeśinmfn. in fine compositi or 'at the end of a compound' assigning View this entry on the original dictionary page scan.
ādeśinmfn. commanding, directing View this entry on the original dictionary page scan.
ādeśinmfn. that (form or letter) for which something is substituted (= sthānin- q.v) on View this entry on the original dictionary page scan.
ādeśinm. a fortune-teller View this entry on the original dictionary page scan.
ādeṣṭṛm. one who orders, a teacher View this entry on the original dictionary page scan.
ādeṣṭṛm. an employer of priests View this entry on the original dictionary page scan.
ādeśyamfn. to be said or ordered or commanded View this entry on the original dictionary page scan.
adeśyamfn. not on the spot, not present on the occasion referred to (varia lectio a-deśa-) View this entry on the original dictionary page scan.
adeśyamfn. not to be ordered or advised. View this entry on the original dictionary page scan.
ādevamf(ī-)n. varia lectio adeva- q.v View this entry on the original dictionary page scan.
ādevam. (scil jana-) "all creatures including the gods" ( on ) View this entry on the original dictionary page scan.
ādevamf(ī-)n. devoted to the gods ([ ]) View this entry on the original dictionary page scan.
adevamfn. not divine not of divine origin, not referring to any deity View this entry on the original dictionary page scan.
adevamfn. godless, impious View this entry on the original dictionary page scan.
adevam. one who is not a god View this entry on the original dictionary page scan.
ādevakamf(ī-)n. ( div-), one who sports or plays View this entry on the original dictionary page scan.
adevakamf(ā-)n. not referring to or intended for any deity View this entry on the original dictionary page scan.
adevamātrikamfn. "not having the gods or clouds as mothers, not suckled by any deity", not rained upon. View this entry on the original dictionary page scan.
ādevanan. a place for playing View this entry on the original dictionary page scan.
ādevanan. a means of playing View this entry on the original dictionary page scan.
ādevanan. gain in playing View this entry on the original dictionary page scan.
adevatāf. one who is not a deity View this entry on the original dictionary page scan.
adevatramfn. not devoted to the gods View this entry on the original dictionary page scan.
adevayat([ ]) mfn. indifferent to the gods, irreligious. View this entry on the original dictionary page scan.
adevayu([ ]) mfn. indifferent to the gods, irreligious. View this entry on the original dictionary page scan.
adevṛghnīf. not killing her brother-in-law View this entry on the original dictionary page scan.
ādeyamfn. to be appropriated View this entry on the original dictionary page scan.
ādeyamfn. to be received View this entry on the original dictionary page scan.
ādeyamfn. to be taken away View this entry on the original dictionary page scan.
ādeyaacceptable, agreeable, View this entry on the original dictionary page scan.
ādeyamfn. varia lectio for ā-dheya- q.v View this entry on the original dictionary page scan.
ādeyamfn. See under ā-- 1. - above. View this entry on the original dictionary page scan.
adeyamfn. improper or unfit to be given, (am-) an illegal gift. View this entry on the original dictionary page scan.
adeyadānan. an illegal gift. View this entry on the original dictionary page scan.
ādeyataratā(f.) View this entry on the original dictionary page scan.
adhaḥsaṃveśinmfn. idem or '(f.)', View this entry on the original dictionary page scan.
ādhārādheyabhāvam. the relation of the recipient and the thing to be received (as of a mirror and the object reflected) View this entry on the original dictionary page scan.
adharedyusind. the day before yesterday View this entry on the original dictionary page scan.
ādhenavan. (fr. a-dhenu-), want of cows commentator or commentary on View this entry on the original dictionary page scan.
adhenumfn. yielding no milk View this entry on the original dictionary page scan.
adhenumfn. not nourishing View this entry on the original dictionary page scan.
ādheyamf(ā-)n. to be kindled or placed (as a fire) commentator or commentary on View this entry on the original dictionary page scan.
ādheyamf(ā-)n. to be deposited or placed View this entry on the original dictionary page scan.
ādheyamf(ā-)n. to be pledged or mortgaged View this entry on the original dictionary page scan.
ādheyamf(ā-)n. to be assigned or attributed or given or conceded etc. View this entry on the original dictionary page scan.
ādheyamf(ā-)n. being contained, comprehended, included commentator or commentary on View this entry on the original dictionary page scan.
ādheyamf(ā-)n. being imputed View this entry on the original dictionary page scan.
ādheyan. putting on, placing (see agnyā-above) etc. View this entry on the original dictionary page scan.
ādheyan. an attribute, predicate etc. View this entry on the original dictionary page scan.
ādheyan. to be effected View this entry on the original dictionary page scan.
ādheyan. to be fixed View this entry on the original dictionary page scan.
adhidaṇḍanetṛm. "presiding over punishment", Name of yama- View this entry on the original dictionary page scan.
adhidevam. a presiding or tutelary deity. View this entry on the original dictionary page scan.
adhidevam ([ ]) ind. concerning the gods or the deity. View this entry on the original dictionary page scan.
adhidevanan. a table or board for gambling View this entry on the original dictionary page scan.
adhidevatāf. a presiding or tutelary deity. View this entry on the original dictionary page scan.
adhidevatam([ ]) ind. concerning the gods or the deity. View this entry on the original dictionary page scan.
adhikaraṇalekhakam. a clerk at a hall of justice, View this entry on the original dictionary page scan.
adhiketanamind. on a flag, View this entry on the original dictionary page scan.
adhikṣepam. abuse, contempt, dismissal. View this entry on the original dictionary page scan.
adhīkṣepam. = adhi-- kṣ-, hāla-, Scholiast or Commentator View this entry on the original dictionary page scan.
adhikṣipadabjanetramfn. having eyes which eclipse the lotus. View this entry on the original dictionary page scan.
adhipeṣaṇamfn. serving to pound or grind upon View this entry on the original dictionary page scan.
adhisenāpatif. the chief commander of an army, View this entry on the original dictionary page scan.
ādhistenam. the stealer of a deposit, . View this entry on the original dictionary page scan.
adhiṣṭhānadeha n. the intermediate body which serves to clothe and support the departed spirit during its several residences in the pitṛ-loka- or world of spirits (also called the preta-śarīra-). View this entry on the original dictionary page scan.
adhiṣṭheyamfn. to be superintended or governed. View this entry on the original dictionary page scan.
adhītavedam. one who has studied the veda-s or whose studies are finished View this entry on the original dictionary page scan.
adhivedamind. concerning the veda- View this entry on the original dictionary page scan.
adhivedanan. marrying an additional wife. View this entry on the original dictionary page scan.
ādhivedanikamfn. (fr. adhivedana-), belonging to a second marriage View this entry on the original dictionary page scan.
ādhivedanikan. (scilicet dānam-) property (gifts etc.) given to a first wife upon marrying a second
adhivedanīyā f. equals -vettavyā-. View this entry on the original dictionary page scan.
adhivedanīyāvedyāf. equals -vettavyā-. View this entry on the original dictionary page scan.
adhivelamind. on the shore
adhiveśmain the house, View this entry on the original dictionary page scan.
adhivettavyāf. a wife in addition to whom it is proper to marry another. View this entry on the original dictionary page scan.
adhivettṛm. a husband who marries an additional wife. View this entry on the original dictionary page scan.
adhivṛkṣasūryeind. when the sun is (still) shining on the tops of trees (rya--, in compound), View this entry on the original dictionary page scan.
adhivyeto envelop. View this entry on the original dictionary page scan.
adhodeśam. the lower or lowest part (especially of the body). View this entry on the original dictionary page scan.
adhokṣeṇa([ ]) ind. under the axle. View this entry on the original dictionary page scan.
adhovekṣinmfn. looking down. View this entry on the original dictionary page scan.
adhvareṣṭhā([ ]) mfn. standing at or engaged in an adhvara-. View this entry on the original dictionary page scan.
adhvaryuvedam. the yajur- veda-. View this entry on the original dictionary page scan.
adhveśam. an officer in charge of the public roads, police-officer View this entry on the original dictionary page scan.
adhyadhikṣepam. excessive censure View this entry on the original dictionary page scan.
adhyadhikṣepam. gross abuse. View this entry on the original dictionary page scan.
adhyantenaind. close to View this entry on the original dictionary page scan.
adhyātmacetasm. one who meditates on the Supreme Spirit. View this entry on the original dictionary page scan.
adhyavaseyamfn. only to be conceived in the mind, View this entry on the original dictionary page scan.
adhyedhto increase, prosper. View this entry on the original dictionary page scan.
adhyeṣaṇaf(ā-)n. solicitation, asking for instruction. View this entry on the original dictionary page scan.
adhyeṣaṇaSee adhīṣṭa-. View this entry on the original dictionary page scan.
adhyeṣyamāṇamf(ā-)n. (future p.) intending to study, about to read View this entry on the original dictionary page scan.
adhyetavya mfn. to be read. View this entry on the original dictionary page scan.
adhyetavyaetc. See adhi-. View this entry on the original dictionary page scan.
adhyetavyaeyamfn. to be read. View this entry on the original dictionary page scan.
adhyetṛm. a student, reader. View this entry on the original dictionary page scan.
adhyeya1 mfn. (it is) to be studied or learned (Name (also title or epithet) impersonal or used impersonally), View this entry on the original dictionary page scan.
adhyeya2 mfn. not to be thought of, View this entry on the original dictionary page scan.
adhyupekṣ(- upa-- īkṣ-; P. - upe- kṣati-), to disregard, View this entry on the original dictionary page scan.
adhyupekṣāf. disregard, neglect, indifference, View this entry on the original dictionary page scan.
adhyuṣiteind. locative case at daybreak View this entry on the original dictionary page scan.
ādidevam. "the first god" View this entry on the original dictionary page scan.
ādidevam. Name of brahman-, viṣṇu-, śiva-, gaṇeśa-, the sun. View this entry on the original dictionary page scan.
ādikeśavam. "the first long-haired one", Name of viṣṇu- View this entry on the original dictionary page scan.
ādikeśavāṣṭakan. Name (also title or epithet) of a stotra- View this entry on the original dictionary page scan.
āditeyam. "son of aditi-", the sun View this entry on the original dictionary page scan.
āditeyam. a god, deity View this entry on the original dictionary page scan.
ādityadevam. idem or 'm. Name of a man.' View this entry on the original dictionary page scan.
ādityadevata(ādity/a--) mfn. one whose (special) deity is the sun View this entry on the original dictionary page scan.
ādityakeśavam. Name of an image of viṣṇu-. View this entry on the original dictionary page scan.
ādityaketum. Name of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
ādityasenam. Name of a prince View this entry on the original dictionary page scan.
ādityatejasm. or f. Polanisia Icosandra View this entry on the original dictionary page scan.
adreśyamfn. invisible View this entry on the original dictionary page scan.
adribhedanan. the splitting of the soma- stone, View this entry on the original dictionary page scan.
aduḥkhasukhavedanāf. the nonperception of either pain or pleasure, . View this entry on the original dictionary page scan.
adūreind. (with ablative or genitive case) not far, near View this entry on the original dictionary page scan.
advaitenaind. solely. View this entry on the original dictionary page scan.
adveṣamfn. not malevolent (Nominal verb dual number f. /e-) View this entry on the original dictionary page scan.
adveṣarāginmfn. free from malevolence and passionate desire. View this entry on the original dictionary page scan.
adveṣasind. without malevolence View this entry on the original dictionary page scan.
adveṣinmfn. free from malevolence. View this entry on the original dictionary page scan.
adveṣṭṛm. not an enemy, a friend. View this entry on the original dictionary page scan.
adviṣeṇya(5) mfn. ( dviṣ-), not malevolent View this entry on the original dictionary page scan.
adyāgreṇaind. henceforth, View this entry on the original dictionary page scan.
agadavedam. medical science View this entry on the original dictionary page scan.
āgamanirapekṣamfn. independent of a written voucher or title. View this entry on the original dictionary page scan.
agandhasevinmfn. not addicted to perfumes, View this entry on the original dictionary page scan.
āgeyamfn. to be sung or intoned in a low voice View this entry on the original dictionary page scan.
aghadevam. Name of a man View this entry on the original dictionary page scan.
aghreyamfn. ( ghra-), improper to be smelled at View this entry on the original dictionary page scan.
āghreyamfn. to be smelled at View this entry on the original dictionary page scan.
āgnendramf(ī-)n. () idem or 'mfn. consecrated to agni- and indra- ' View this entry on the original dictionary page scan.
āgneyamf(ī-)n. ( commentator or commentary) belonging or relating or consecrated to fire or its deity agni- View this entry on the original dictionary page scan.
āgneyamf(ī-)n. [with kīṭa- m.an insect which flies into the fire (applied to a thief who breaks into a room and extinguishes the lamp) ] View this entry on the original dictionary page scan.
āgneyamf(ī-)n. belonging or consecrated to agnāyī- (wife of agni-) commentator or commentary View this entry on the original dictionary page scan.
āgneyamf(ī-)n. south-eastern View this entry on the original dictionary page scan.
āgneyam. Name of skanda- View this entry on the original dictionary page scan.
āgneyam. of agastya- (see āgnimārut/a-above) View this entry on the original dictionary page scan.
āgneyam. plural Name of a people (varia lectio āgreya-) View this entry on the original dictionary page scan.
āgneyam. (equals agnāyī-) the wife of agni- View this entry on the original dictionary page scan.
āgneyam. the south-east quarter (of which agni- is the regent) View this entry on the original dictionary page scan.
āgneyan. blood View this entry on the original dictionary page scan.
āgneyan. ghee, or clarified butter View this entry on the original dictionary page scan.
āgneyan. gold View this entry on the original dictionary page scan.
āgneyan. the nakṣatra- kṛttikā- View this entry on the original dictionary page scan.
āgneyan. Name of a sāman-. View this entry on the original dictionary page scan.
āgneyamfn. (also) inflammable, combustible, View this entry on the original dictionary page scan.
āgneyaindramfn. belonging to agni- and indra- View this entry on the original dictionary page scan.
āgneyaindrāf. āgneyy-aindrī- id est ṛc-, a verse addressed to agni- and indra- View this entry on the original dictionary page scan.
agneyānīf. a kind of brick, View this entry on the original dictionary page scan.
āgneyapāvamānīf. equals āgnipāvamānī- q.v View this entry on the original dictionary page scan.
āgneyapurāṇan. equals -agni-purāṇa- q.v View this entry on the original dictionary page scan.
āgneyāstran. "fiery weapon", Name of a Tantric formula. View this entry on the original dictionary page scan.
āgnef. Name of a daughter of agni- and wife of ūru- View this entry on the original dictionary page scan.
āgneyyaindrīf. See āgneyaīndra- above. View this entry on the original dictionary page scan.
āgnidatteyamfn. relating to agnidatta-, (gaRa sakhy-ādi- q.v;not in ) View this entry on the original dictionary page scan.
agnidevam. agni- View this entry on the original dictionary page scan.
agnidef. equals -nakṣatr/a-, q.v View this entry on the original dictionary page scan.
agnidevata(agn/i--) mfn. having agni- for deity View this entry on the original dictionary page scan.
agnihotradevatāf. the deity of the agnihotra- View this entry on the original dictionary page scan.
agnihotravef. the time of the agni-hotra-, View this entry on the original dictionary page scan.
agnihotreṣṭif. a libation or offering at the agnihotra- ([ see iṣṭi-]) View this entry on the original dictionary page scan.
agnihotroccheṣaṇan. the remains of the agnihotra- ([ ]) View this entry on the original dictionary page scan.
agnijvalitatejanamfn. having a point hardened in fire View this entry on the original dictionary page scan.
agnijyeṣṭha(n/i-- jy-), mfn. having agni- for a chief, View this entry on the original dictionary page scan.
agniketumfn. (agni--) having fire as an emblem or characteristic mark (uṣas-) View this entry on the original dictionary page scan.
agniketum. (us-) Name of a rakṣas- View this entry on the original dictionary page scan.
agnikṣetran. the place for the fire-altar, View this entry on the original dictionary page scan.
agninetra(agn/i--) mfn. having agni- for a guide View this entry on the original dictionary page scan.
agnipraveśam. entering the fire, self immolation of a widow on her husband's funeral pile. View this entry on the original dictionary page scan.
agnipraveśanan. entering the fire, self immolation of a widow on her husband's funeral pile. View this entry on the original dictionary page scan.
agniretasamfn. sprung from agni-'s seed View this entry on the original dictionary page scan.
agniśekharan. saffron View this entry on the original dictionary page scan.
agniśeṣam. appendix to the chapter on agni- in the taittirīya-saṃhitā-. View this entry on the original dictionary page scan.
agnitejasmfn. (agn/i--) having the energy of fire or of agni- View this entry on the original dictionary page scan.
agnitejasm. one of the seven ṛṣi-s of the eleventh manvantara- View this entry on the original dictionary page scan.
agnitre([ ]) f. the three sacred fires, called respectively gārhapatya-, āhavanīya-, and dakṣiṇa-. View this entry on the original dictionary page scan.
agnivef. the time at which the fire is kindled, afternoon View this entry on the original dictionary page scan.
agniveśam. Name of an ancient medical authority View this entry on the original dictionary page scan.
agniveśam. also of other persons. View this entry on the original dictionary page scan.
āgniveśim. a descendant of agniveśa- View this entry on the original dictionary page scan.
agniveśmanm. the fourteenth day of the karma-māsa- View this entry on the original dictionary page scan.
agniveśyam. Name of a teacher View this entry on the original dictionary page scan.
agniveśyam. Name of the 22nd muhūrta- View this entry on the original dictionary page scan.
āgniveśyamfn. (gaRa gargādi- q.v) belonging or referring to agniveśa- View this entry on the original dictionary page scan.
āgniveśyam. Name of a teacher (descendant of agniveśa-) () View this entry on the original dictionary page scan.
āgniveśyāyanamfn. descending from agniveśya- (as a family) View this entry on the original dictionary page scan.
āgniveśyāyanam. Name of a grammarian View this entry on the original dictionary page scan.
agnivetālam. Name of a vetāla- (connected with the story of king vikramāditya-). View this entry on the original dictionary page scan.
agnyādhānadevatāf. the deity of the agnyādheya- ceremony View this entry on the original dictionary page scan.
agnyādheyan. ([ etc.]) placing the fire on the sacrificial fire-place View this entry on the original dictionary page scan.
agnyādheyan. the ceremony of preparing the three sacred fires āhavanīya- etc. View this entry on the original dictionary page scan.
āgnyādheyikamf(ī-)n. belonging to the agnyādheya- (q.v) View this entry on the original dictionary page scan.
agnyedham. one who kindles the fire View this entry on the original dictionary page scan.
agocareṇaind. instrumental case out of the sight of any one (genitive case), behind one's back View this entry on the original dictionary page scan.
agradef. a chief queen, View this entry on the original dictionary page scan.
āgraheṇaind. instrumental case obstinately View this entry on the original dictionary page scan.
agrapeyan. precedence in drinking View this entry on the original dictionary page scan.
agrasenam. Name of janamejaya-'s son. View this entry on the original dictionary page scan.
āgrayaṇeṣṭif. oblation of the first-fruits (in harvest) View this entry on the original dictionary page scan.
agreind. in front, ahead of, in the beginning, first View this entry on the original dictionary page scan.
agreind. further on, subsequently, below (in a book) View this entry on the original dictionary page scan.
agreind. from - up to (ā-) , before (in time) ([ confer, compare Greek ]) . View this entry on the original dictionary page scan.
agreind. (locative case) See /agra-. View this entry on the original dictionary page scan.
agrebhrū( bhram-) m. wandering in front commentator or commentary View this entry on the original dictionary page scan.
agredadhiṣu([ ]) m. a man who at his first marriage takes a wife that was married before, (agre-didhiṣu-or -didhiṣu-) View this entry on the original dictionary page scan.
agredadhiṣuf. a married woman whose elder sister is still unmarried. View this entry on the original dictionary page scan.
agredadhus([ ]) m. a man who at his first marriage takes a wife that was married before, (agre-didhiṣu-or -didhiṣu-) View this entry on the original dictionary page scan.
agredadhusf. a married woman whose elder sister is still unmarried. View this entry on the original dictionary page scan.
agredidhiṣu([ ]) m. a man who at his first marriage takes a wife that was married before, (agre-didhiṣu-or -didhiṣu-) View this entry on the original dictionary page scan.
agredidhiṣuf. a married woman whose elder sister is still unmarried. View this entry on the original dictionary page scan.
agregaetc. See /agre- below. View this entry on the original dictionary page scan.
agrega([ ]) ([ etc.]) mfn. going in front or before. View this entry on the original dictionary page scan.
agre([ etc.]) mfn. going in front or before. View this entry on the original dictionary page scan.
agremfn. (said of the waters) moving forwards View this entry on the original dictionary page scan.
agreṇaind. in front, before (without or with accusative) View this entry on the original dictionary page scan.
agreṇīm. a leader View this entry on the original dictionary page scan.
agre([ iv, 34, 7 and 10]) ([ ]) mfn. having the precedence in drinking. View this entry on the original dictionary page scan.
agre([ ]) mfn. having the precedence in drinking. View this entry on the original dictionary page scan.
agresaramf(ī-)n. going in front, preceding, best View this entry on the original dictionary page scan.
agresarikam. a leader View this entry on the original dictionary page scan.
agretanamfn. occurring further on, subsequently (in a book). View this entry on the original dictionary page scan.
agretvanmf(arī-)n. going in front View this entry on the original dictionary page scan.
agrevadham. hitting or killing whatever is in front View this entry on the original dictionary page scan.
agrevaṇan. the border of a forest (gaRa rājadantādi- q.v) View this entry on the original dictionary page scan.
āgreya varia lectio for āgneya- (Name of a people) q.v View this entry on the original dictionary page scan.
ahahāreind. idem or 'ind. an interjection, as Ah! aha-! etc. (implying surprise, fatigue, pain, sorrow, pleasure, calling) ' View this entry on the original dictionary page scan.
ahaḥśeṣam. the remaining part of the day View this entry on the original dictionary page scan.
ahalyākāmadhenuf. Name (also title or epithet) of a modern law-book View this entry on the original dictionary page scan.
ahalyeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
ahaṃśreṣṭhikāf. idem or 'n. idem or 'n. claiming superiority for one's self ' () ' View this entry on the original dictionary page scan.
ahaṃśreyasn. claiming superiority for one's self View this entry on the original dictionary page scan.
ahaṃśreyasan. idem or 'n. claiming superiority for one's self ' () View this entry on the original dictionary page scan.
āharaceṭā gaRa mayūra-vyaṃsakādi- View this entry on the original dictionary page scan.
āharase gaRa mayūra-vyaṃsakādi- View this entry on the original dictionary page scan.
aheind. a particle (implying reproach, rejection, separation ) (only in a sacrificial formula beginning with /ahe daidhiṣavya-and reoccurring in several other texts) . View this entry on the original dictionary page scan.
aheḍamānamfn. not sporting or joking, being in earnest, View this entry on the original dictionary page scan.
ahedhmam. (with paiḍvasya-) Name (also title or epithet) of a sāman-, View this entry on the original dictionary page scan.
aheḷamānamfn. idem or 'mfn. not angry, not displeased, favourable ' View this entry on the original dictionary page scan.
aheḷatmfn. not angry, not displeased, favourable View this entry on the original dictionary page scan.
aheḷayatmfn. idem or 'mfn. idem or 'mfn. not angry, not displeased, favourable ' '
ahelinmfn. not dallying, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
aherum. the plant Asparagus Racemosus View this entry on the original dictionary page scan.
ahetum. absence of cause or reason View this entry on the original dictionary page scan.
ahetum. not a real or sound argument View this entry on the original dictionary page scan.
ahetum. (in rhetoric) a certain figure of speech. View this entry on the original dictionary page scan.
ahetukamf(ā- )n. groundless. View this entry on the original dictionary page scan.
ahetusamam. a particular sophism tending to prove an argument to be untenable View this entry on the original dictionary page scan.
ahetutvan. (in Buddhist terminology) absence of cause or necessity View this entry on the original dictionary page scan.
ahetuvādam. the doctrine of the cārvāka-s, View this entry on the original dictionary page scan.
ahetuvādinm. an adherent of it, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
āheyamfn. (fr. ahi- ), belonging to or coming from a snake View this entry on the original dictionary page scan.
ahideva n. "having serpents as deities", Name of the nakṣatra- aśleṣā- View this entry on the original dictionary page scan.
ahimeda m. idem or 'm. (equals asi-meda- q.v) the plant Vachellia Farnesiana ' View this entry on the original dictionary page scan.
ahimedakam. idem or ' m. idem or 'm. (equals asi-meda- q.v) the plant Vachellia Farnesiana ' ' View this entry on the original dictionary page scan.
ahiphenan. (equals a-phena- q.v) "the saliva or venom of a snake", opium View this entry on the original dictionary page scan.
ahirbudhnyadevatāf. plural "having ahirbudhnya- as deity", the nakṣatra- uttara-bhadrapadā- View this entry on the original dictionary page scan.
ahirbudhnyadevatyan. "having ahirbudhnya- as deity", the nakṣatra- uttara-bhadrapadā- View this entry on the original dictionary page scan.
ahitecchumfn. wishing evil, malevolent. View this entry on the original dictionary page scan.
āhneyam. (fr. ahni- f.), Name of śauca- View this entry on the original dictionary page scan.
āhrutabheṣajamf(ī-)n. curing anything wounded or hurt View this entry on the original dictionary page scan.
ahutābhyuditeind. when the sun has risen before the sacrifice, View this entry on the original dictionary page scan.
āhveP. -hvayati- (but also Potential 1. sg. ā-huvema- ) A1. -hvayate- (but also 1. sg. -huve- ; Aorist 3. plural hūṣata- ; infinitive mood -huv/adhyai- -hvayitav/ai- ) to call near, invoke invite, summon, cite etc. ; to provoke, challenge, emulate (in this sense only A1. ) etc. ; to call to (especially in rites said of the hotṛ-, who addresses the adhvaryu- by the ā-hāva- or ā-hvāna-;See below) and ; to proclaim : Causal -hvāyayati-, to cause to call near, send for ; to cause to summon or challenge or invite : Desiderative -juhūṣati-, to wish to call near, to be about to call near: Intensive -johavīti- , to call near zealously. View this entry on the original dictionary page scan.
aileyam. Name of the planet Mars View this entry on the original dictionary page scan.
aileyan. equals elavālu- q.v View this entry on the original dictionary page scan.
aindrasenim. a descendant of indra-sena View this entry on the original dictionary page scan.
aindriyedhīmfn. one whose mind is fixed upon sensual pleasure only View this entry on the original dictionary page scan.
aindumateyam. a descendant of indumatī-, Name of daśaratha- View this entry on the original dictionary page scan.
ainduśekharamfn. (fr. indu-śekhara-), belonging to or treating of the moon-crested one id est śiva- View this entry on the original dictionary page scan.
aiṇeyamfn. (fr. eṇī-), produced or coming from the female black antelope etc. View this entry on the original dictionary page scan.
aiṇeyamfn. (fr. aiṇeya-) belonging to anything which is produced from the female black antelope on View this entry on the original dictionary page scan.
aiṇeyam. the black antelope View this entry on the original dictionary page scan.
aiṇeyan. a kind of coitus. View this entry on the original dictionary page scan.
aiṇeyajaṅghatāf. having legs like those of a deer (one of the 32 signs of perfection), . View this entry on the original dictionary page scan.
aireyan. (fr. irā-), an intoxicating beverage View this entry on the original dictionary page scan.
aitareyam. a descendant of itara- or itarā-, Name of mahidāsa- (author of a brāhmaṇa- and āraṇyaka- called after him) View this entry on the original dictionary page scan.
aitareyamfn. composed by aitareya-. View this entry on the original dictionary page scan.
aitareyabrāhmaṇan. Name of the brāhmaṇa- composed by aitareya- (attached to the ṛg-- veda- and prescribing the duties of the hotṛ- priest;it is divided into forty adhyāya-s or eight pañcikā-s). View this entry on the original dictionary page scan.
aitareyakan. the aitareya-brāhmaṇa-. View this entry on the original dictionary page scan.
aitareyāraṇyakan. Name of the āraṇyaka- composed by aitareya- (consisting of five books or āraṇyaka-s, the second and third books of which form the upaniṣad-). View this entry on the original dictionary page scan.
aitareyinm. plural the school of aitareya- View this entry on the original dictionary page scan.
aitareyopaniṣadf. Name of either the second and third books of the aitareya-āraṇyaka- or of the four last sections of the second book only View this entry on the original dictionary page scan.
aitareyopaniṣadbhāṣyan. Name of a treatise and commentary on the last. View this entry on the original dictionary page scan.
ajadevatāf. plural the 25th lunar mansion. View this entry on the original dictionary page scan.
ājadhenavim. (fr. aja-dhenu-), a patronymic, (gaRa bāhv-ādi- q.v) View this entry on the original dictionary page scan.
ājakeśinm. plural Name (also title or epithet) of a family, View this entry on the original dictionary page scan.
ajameruName of a place, Ajmir (?). View this entry on the original dictionary page scan.
ājānadeva(āj/āna--) m. a god by birth (as opposed to karma-deva- q.v) () View this entry on the original dictionary page scan.
ājāneyamf(-)n. of noble origin, of good breed (as a horse) View this entry on the original dictionary page scan.
ājāneyamf(-)n. originating or descending from (in compound) View this entry on the original dictionary page scan.
ājāneyam. a well-bred horse View this entry on the original dictionary page scan.
ājāneyaand neyya- See ā-jan-. View this entry on the original dictionary page scan.
ājāneyyamfn. of noble birth, View this entry on the original dictionary page scan.
ajasreṇaind. perpetually, for ever, ever. [ ] View this entry on the original dictionary page scan.
ājavasteyam. a descendant of an aja-vasti- man or prince, (gaRa gṛṣṭy-ādi-and śubhrādi- q.v) View this entry on the original dictionary page scan.
ājavasteyaetc. See āja-. View this entry on the original dictionary page scan.
ajetavyamfn. invincible. View this entry on the original dictionary page scan.
ajeyamfn. invincible View this entry on the original dictionary page scan.
ajeyamfn. Name of a prince View this entry on the original dictionary page scan.
ajeyan. Name of a kind of antidote. View this entry on the original dictionary page scan.
ājijñāsenyāSee ā-jñā-. View this entry on the original dictionary page scan.
ājijñāsenyāf. plural (fr. Desiderative) scilicet ṛcas-,"liable to investigation", Name of some of the kuntāpa- hymns (of the ) View this entry on the original dictionary page scan.
ājireyam. a descendant of ajira-, (gaRa śubhrādi-, q.v) View this entry on the original dictionary page scan.
ajitakeśakambalam. Name of one of the six chief heretical teachers (mentioned in Buddhist texts as contemporaries of buddha-). View this entry on the original dictionary page scan.
ajitendriyamfn. having unsubdued passions. View this entry on the original dictionary page scan.
ajñātaketa(/ajñāta--) mfn. having unknown or secret designs View this entry on the original dictionary page scan.
ajñeyamfn. unknowable, unfit to be known. View this entry on the original dictionary page scan.
ājyalepam. an unguent made of clarified butter View this entry on the original dictionary page scan.
ajyeṣṭhamfn. not the oldest or best View this entry on the original dictionary page scan.
ajyeṣṭhamfn. Nominal verb plural of which none is the eldest (the marut-s) View this entry on the original dictionary page scan.
ajyeṣṭhamfn. see /a-kaniṣṭha-. View this entry on the original dictionary page scan.
ajyeṣṭhavṛttimfn. not behaving as the eldest brother ([ ]) , or (ajyeṣṭha-vṛtti-) behaving like one who has no elder brother. View this entry on the original dictionary page scan.
ajyeyatāf. state of anything which is not to be hurt or overpowered View this entry on the original dictionary page scan.
akālakṣepamind. without delay View this entry on the original dictionary page scan.
akālameghodayam. unseasonable rising of clouds or mist. View this entry on the original dictionary page scan.
akālavef. wrong or unseasonable time. View this entry on the original dictionary page scan.
akāleind. unseasonably. View this entry on the original dictionary page scan.
akāṇḍeind. causelessly, unexpectedly. View this entry on the original dictionary page scan.
akāraṇeind. causelessly. View this entry on the original dictionary page scan.
akāraṇenaind. causelessly. View this entry on the original dictionary page scan.
akārṇaveṣṭakikamf(ī-)n. not fit for ear-rings, not looking well with ear-rings See karṇa-veṣṭaka-. View this entry on the original dictionary page scan.
ākāśadeśam. an open place View this entry on the original dictionary page scan.
ākaśāpeyam. a descendant of akaśāpa-, (gaRa śubhrādi- q.v) View this entry on the original dictionary page scan.
ākāśeind. in the air (a stage direction implying something said by or to a person out of sight) View this entry on the original dictionary page scan.
ākāśeśamfn. "who has no other possession than the air", helpless (as a child, woman, pauper, or invalid) View this entry on the original dictionary page scan.
ākāśeśam. "lord of the sky", indra- View this entry on the original dictionary page scan.
ākeind. locative case (fr. 2. añc-with ā- see /apāka-,etc.)"hitherward" , near , () View this entry on the original dictionary page scan.
ākeind. far View this entry on the original dictionary page scan.
āke(according to to some,"visibly"[ confer, compare akṣi-, īkṣ-], View this entry on the original dictionary page scan.
ākekaramfn. squinting slightly View this entry on the original dictionary page scan.
ākenipamfn. (said of the horses of the aśvin-s) protecting in the vicinity View this entry on the original dictionary page scan.
ākenipamfn. (equals ā- kenip/āso-, ibidem or 'in the same place or book or text' as the preceding ) View this entry on the original dictionary page scan.
akeśamf(ā- ī- )n. hairless. View this entry on the original dictionary page scan.
aketanamfn. houseless. View this entry on the original dictionary page scan.
aketumfn. shapeless, unrecognisable View this entry on the original dictionary page scan.
aketumfn. ("unconscious") View this entry on the original dictionary page scan.
ākhareṣṭhamfn. abiding or dwelling in a hole (quoted in on ) . View this entry on the original dictionary page scan.
ākhedanan. drawlng to one's self, , Scholiast or Commentator View this entry on the original dictionary page scan.
akhedinmfn. not wearisome, unwearied. View this entry on the original dictionary page scan.
akheditvan. continuous flow (of speech), one of the vāg-guṇas- of mahāvīra- View this entry on the original dictionary page scan.
ākheṭam. ( khiṭ-?) chase, hunting View this entry on the original dictionary page scan.
ākheṭabhūmif. hunting-ground View this entry on the original dictionary page scan.
ākheṭakam. equals ā-kheṭa- View this entry on the original dictionary page scan.
ākheṭakam. a hunter View this entry on the original dictionary page scan.
ākheṭakāṭavīf. a hunting-forest View this entry on the original dictionary page scan.
ākheṭaśīrṣaka varia lectio for ākhoṭa-ś- q.v View this entry on the original dictionary page scan.
ākheṭikam. (also akh- q.v) a hound View this entry on the original dictionary page scan.
ākheṭikam. a hunter View this entry on the original dictionary page scan.
akheṭikaor ākheṭika- m. a dog trained to the chase. View this entry on the original dictionary page scan.
akhilenaind. completely. View this entry on the original dictionary page scan.
ākhyeyamfn. to be told or related, to be said or confessed View this entry on the original dictionary page scan.
ākīrṇeind. in a place filled or crowded with people,
akkādef. Name (also title or epithet) of a queen, View this entry on the original dictionary page scan.
ākledam. moistening View this entry on the original dictionary page scan.
akledyamfn. not to be wetted. View this entry on the original dictionary page scan.
akleśam. freedom from trouble View this entry on the original dictionary page scan.
ākokeram. = , the constellation Capricornus. View this entry on the original dictionary page scan.
akṣadevanan. gambling, dice-playing. View this entry on the original dictionary page scan.
akṣadevin m. a gambler, a dice-player. View this entry on the original dictionary page scan.
akṣaresthāmfn. consisting of syllables View this entry on the original dictionary page scan.
akṣaryaṃrevatn. Name of a sāman- View this entry on the original dictionary page scan.
ākṣepam. drawing together, convulsion, palpitation View this entry on the original dictionary page scan.
ākṣepam. applying, laying (as a colour) View this entry on the original dictionary page scan.
ākṣepam. throwing away, giving up, removing View this entry on the original dictionary page scan.
ākṣepam. "shaking about the hands"or"turning the hand"(in pronouncing the svarita-) View this entry on the original dictionary page scan.
ākṣepam. charming, transporting etc. View this entry on the original dictionary page scan.
ākṣepam. (in rhetoric) pointing to (in compound), hinting etc. View this entry on the original dictionary page scan.
ākṣepam. (See also ākṣepopamā-below) View this entry on the original dictionary page scan.
ākṣepam. reviling, abuse, harsh speech etc. (see kṣepam-) View this entry on the original dictionary page scan.
ākṣepam. objection (especially to rectify a statement of one's own) etc. View this entry on the original dictionary page scan.
ākṣepam. challenge View this entry on the original dictionary page scan.
ākṣepam. Name of a man View this entry on the original dictionary page scan.
ākṣepakamfn. pointing to, hinting at View this entry on the original dictionary page scan.
ākṣepakamfn. reviling View this entry on the original dictionary page scan.
ākṣepakam. convulsion, spasm View this entry on the original dictionary page scan.
ākṣepaṇamf(ī-)n. charming, transporting View this entry on the original dictionary page scan.
ākṣepaṇan. throwing, tossing View this entry on the original dictionary page scan.
ākṣepaṇan. reviling View this entry on the original dictionary page scan.
ākṣepaṇan. objecting View this entry on the original dictionary page scan.
ākṣeparūpakan. a simile, in which the object compared is only hinted at View this entry on the original dictionary page scan.
ākṣepasūtran. a string for filing pearls, (varia lectio) View this entry on the original dictionary page scan.
ākṣepavalanan. tossing about (the arms etc.), View this entry on the original dictionary page scan.
ākṣepinmfn. in fine compositi or 'at the end of a compound' applying to, concerning View this entry on the original dictionary page scan.
ākṣepinmfn. hinting at View this entry on the original dictionary page scan.
ākṣepiṇīf. (with siddhi-) the magical power of attraction, (= ākarṣiṇī- siddhiḥ-, Scholiast or Commentator). View this entry on the original dictionary page scan.
ākṣepopamāf. idem or 'f. (with siddhi-) the magical power of attraction, (= ākarṣiṇī- siddhiḥ-, Scholiast or Commentator).' View this entry on the original dictionary page scan.
ākṣeptṛmfn. one who refuses View this entry on the original dictionary page scan.
ākṣepyamfn. to be objected to View this entry on the original dictionary page scan.
ākṣepyamfn. to be challenged (at play etc.) View this entry on the original dictionary page scan.
akṣetramfn. destitute of fields, uncultivated View this entry on the original dictionary page scan.
akṣetran. a bad field View this entry on the original dictionary page scan.
akṣetran. a bad geometrical figure. View this entry on the original dictionary page scan.
akṣetrajñamfn. ([ ]) not finding out the way View this entry on the original dictionary page scan.
akṣetrajñamfn. destitute of spiritual knowledge. View this entry on the original dictionary page scan.
akṣetravidmfn. ([ /akṣ- ]), not finding out the way View this entry on the original dictionary page scan.
akṣetravidmfn. destitute of spiritual knowledge. View this entry on the original dictionary page scan.
akṣetrinmfn. having no fields View this entry on the original dictionary page scan.
akṣibheṣajan. medicament for the eyes, collyrium, etc. View this entry on the original dictionary page scan.
akṣibheṣajam. a tree, Red Lodh. View this entry on the original dictionary page scan.
akṣinimeṣam. twinkling of an eye, a moment View this entry on the original dictionary page scan.
akṣṇayādeśam. an intermediate region View this entry on the original dictionary page scan.
akṣṇayāpacchedanan. transverse division, View this entry on the original dictionary page scan.
akṣuṇṇavedhathe act of throwing a spear so as to touch the mark lightly, View this entry on the original dictionary page scan.
ākṣveḍitan. humming, buzzing, View this entry on the original dictionary page scan.
ākulendriyamfn. confused in mind View this entry on the original dictionary page scan.
alābukeśvaran. Name of a tīrtha- View this entry on the original dictionary page scan.
alakeśvaram. "lord of alakā-", a Name of kubera- View this entry on the original dictionary page scan.
ālālamehinmfn. discharging the above with the urine, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
alaleind. (see arare-), a word of no import occurring in the dialect or gibberish of the piśāca-s (a class of goblins introduced in plays, etc.) View this entry on the original dictionary page scan.
alasekṣaṇamf(ā-)n. having languishing or tired looks View this entry on the original dictionary page scan.
aleor alele- ind. (see are-and arere-), unmeaning words in the dialect of the demons or piśāca-s (introduced in plays etc.) View this entry on the original dictionary page scan.
ālekhanan. scratching, scraping View this entry on the original dictionary page scan.
ālekhanan. marking out by scratches View this entry on the original dictionary page scan.
ālekhanan. painting View this entry on the original dictionary page scan.
ālekhanam. Name of a teacher View this entry on the original dictionary page scan.
ālekhanaSee ā-likh-. View this entry on the original dictionary page scan.
ālekhanīf. a brush, pencil View this entry on the original dictionary page scan.
ālekhanim. Name of a teacher. View this entry on the original dictionary page scan.
ālekhyamfn. to be written or delineated or painted View this entry on the original dictionary page scan.
ālekhyan. writing, painting View this entry on the original dictionary page scan.
ālekhyan. a picture, portrait View this entry on the original dictionary page scan.
ālekhyadevatāf. a painted deity. View this entry on the original dictionary page scan.
ālekhyalekhāf. painting. View this entry on the original dictionary page scan.
ālekhyapuruṣam. an image or drawing of a man View this entry on the original dictionary page scan.
ālekhyasamarpitamfn. fixed on a picture, painted View this entry on the original dictionary page scan.
ālekhyaśeṣamfn. one of whom there is nothing left but a painting, deceased View this entry on the original dictionary page scan.
alepam. = preceding, View this entry on the original dictionary page scan.
alepamfn. unstained, clean, pure, View this entry on the original dictionary page scan.
ālepam. the act of smearing, plastering, anointing View this entry on the original dictionary page scan.
ālepam. liniment View this entry on the original dictionary page scan.
ālepam. ointment View this entry on the original dictionary page scan.
alepakamfn. stainless. View this entry on the original dictionary page scan.
ālepanan. smearing, plastering, anointing View this entry on the original dictionary page scan.
ālepanan. liniment View this entry on the original dictionary page scan.
ālepanan. ointment View this entry on the original dictionary page scan.
aleśamfn. not little, much, large View this entry on the original dictionary page scan.
āleśam. ( liś-= riś-), grazing View this entry on the original dictionary page scan.
aleśaijamfn. "not moving a bit", firm, steady View this entry on the original dictionary page scan.
aleśamind. "not a bit", not at all View this entry on the original dictionary page scan.
ālīḍheyam. () a descendant of ālīḍha-. View this entry on the original dictionary page scan.
alikalekhāf. an impression or mark upon the forehead View this entry on the original dictionary page scan.
āllakeyasee hṛtsv-- āśaya-. View this entry on the original dictionary page scan.
ālokasuvegadhvajam. Name (also title or epithet) of a serpent-demon, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
alpaceṣṭitamfn. "making little effort", inert. View this entry on the original dictionary page scan.
alpadeśavṛttitvasee vyā-- vṛtta-, parasmE-pada 1039 View this entry on the original dictionary page scan.
alpakeśīf. Name of a plant (or perhaps the root of sweet flag) View this entry on the original dictionary page scan.
alpamedhasmfn. () of little understanding, ignorant, silly View this entry on the original dictionary page scan.
alpaśeṣamfn. at which little is left, nearly finished View this entry on the original dictionary page scan.
alpāvaśeṣamfn. idem or '(n.)', View this entry on the original dictionary page scan.
alpecchamfn. having little or moderate wishes View this entry on the original dictionary page scan.
alpecchumfn. idem or 'mfn. having little or moderate wishes ' View this entry on the original dictionary page scan.
alpenaind. instrumental case (with a perf. Pass. p. ) "for little", cheap
alpeśākhyamfn. "named after an insignificant chief or master", of low origin View this entry on the original dictionary page scan.
alpetaramfn. "other than small", large View this entry on the original dictionary page scan.
alpetaratvan. largeness View this entry on the original dictionary page scan.
amanuṣyaniṣevitamfn. not inhabited by men. View this entry on the original dictionary page scan.
āmapeṣam. plural grains pounded in a raw (id est uncooked) condition View this entry on the original dictionary page scan.
amaradevam. a Name of amarasiṃha-. View this entry on the original dictionary page scan.
amaragaṇanālekhyan. the list (or number) of the gods, View this entry on the original dictionary page scan.
amarejyam. equals amara-guru- q.v View this entry on the original dictionary page scan.
amareśam. equals amara-pa- q.v View this entry on the original dictionary page scan.
amareśam. Name of śiva- or rudra- View this entry on the original dictionary page scan.
amareśvaram. equals amara-pa- q.v View this entry on the original dictionary page scan.
amareśvaram. Name of viṣṇu- View this entry on the original dictionary page scan.
amareśvaram. Name of a liṅga-. View this entry on the original dictionary page scan.
amareśvaratīrtham. Name of a tīrtha- View this entry on the original dictionary page scan.
amārgeṇaind. instrumental case in a dishonourable manner
amarmavedhitāf. the state of not inflicting severe injury on others, absence of acrimony (one of the thirty-five vāg-guṇa-s of a tīrthaṃkara-) View this entry on the original dictionary page scan.
ambaralekhinmfn. touching the sky, View this entry on the original dictionary page scan.
ambekam. Name (also title or epithet) of a Commentator, View this entry on the original dictionary page scan.
ambikeyam. (for āmbikeya- q.v) Name of dhṛtarāṣṭra- View this entry on the original dictionary page scan.
ambikeyam. of gaṇeśa- View this entry on the original dictionary page scan.
ambikeyam. of kārttikeya- View this entry on the original dictionary page scan.
āmbikeyam. (gaRa śubhrādi- ), a descendant of ambikā- View this entry on the original dictionary page scan.
āmbikeyam. Name of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
āmbikeyam. of kārttikeya- View this entry on the original dictionary page scan.
āmbikeyam. of a mountain View this entry on the original dictionary page scan.
ambudeva n. "having the waters as deity", Name of the astrological mansion pūrvāṣāḍhā- View this entry on the original dictionary page scan.
ambukeśaram. lemon tree View this entry on the original dictionary page scan.
ambulīlāgehan. a pleasure-house standing in water, View this entry on the original dictionary page scan.
ambusecanīf. (-vāhinī-) a wooden baling vessel View this entry on the original dictionary page scan.
ambuvegam. a current of water, View this entry on the original dictionary page scan.
ambuvetasam. a kind of cane or reed growing in water.
amedaskamfn. without fat, lean
amedhasmfn. unintelligent, foolish, an idiot View this entry on the original dictionary page scan.
amedhyamfn. not able or not allowed to sacrifice, not fit for sacrifice, impure, unholy, nefarious, foul etc. View this entry on the original dictionary page scan.
amedhyamfn. (am-) ,n. faeces, excrement View this entry on the original dictionary page scan.
amedhyāktamfn. soiled with ordure View this entry on the original dictionary page scan.
amedhyakuṇapāśinmfn. feeding on carrion. View this entry on the original dictionary page scan.
amedhyalepam. smearing with ordure. View this entry on the original dictionary page scan.
amedhyaliptamfn. smeared with ordure View this entry on the original dictionary page scan.
amedhyapratimantraṇan. conjuring of unlucky omens, View this entry on the original dictionary page scan.
amedhyatāf. impurity, foulness, filthiness. View this entry on the original dictionary page scan.
amedhyatvan. impurity, foulness, filthiness. View this entry on the original dictionary page scan.
amedhyayuktamfn. filthy, foul. View this entry on the original dictionary page scan.
ameghopaplavamfn. not covered with clouds, View this entry on the original dictionary page scan.
ameham. retention of urine View this entry on the original dictionary page scan.
āmekhalamind. to the edge (of a mountain) View this entry on the original dictionary page scan.
amekṣaṇamfn. having no mekṣaṇa-, or mixing instrument. View this entry on the original dictionary page scan.
amenam. having no wife, a widower View this entry on the original dictionary page scan.
amenamfn. not casting or throwing, not able to throw View this entry on the original dictionary page scan.
ameni according to to others,"inflicting no punishment". View this entry on the original dictionary page scan.
āmenyamfn. to be measured from all sides ([ ]) View this entry on the original dictionary page scan.
ameṣṭamfn. sacrificed at home View this entry on the original dictionary page scan.
ameṣṭaSee 1. am/ā-. View this entry on the original dictionary page scan.
āmeṣṭakamfn. made of raw bricks, . View this entry on the original dictionary page scan.
ameyamfn. immeasurable View this entry on the original dictionary page scan.
ameyātmanmfn. possessing immense powers of mind, magnanimous View this entry on the original dictionary page scan.
ameyātmanm. Name of viṣṇu- View this entry on the original dictionary page scan.
aṃhubhef. having a narrow slit (pudendum muliebre)
amitatejasmfn. of boundless glory View this entry on the original dictionary page scan.
amitrasef. hostile army (= ) View this entry on the original dictionary page scan.
amlabhedanam. sorrel
amlakeśaram. citron tree. View this entry on the original dictionary page scan.
amlameham. acid urine (a disease) View this entry on the original dictionary page scan.
amlavetasam. a kind of dock or sorrel, Rumex Vesicarius View this entry on the original dictionary page scan.
amlavetasan. vinegar (obtained from fruit) View this entry on the original dictionary page scan.
āmlavetasam. the plant Rumex Vesicarius (= amla-). View this entry on the original dictionary page scan.
amoghadevam. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
āmrapeśīf. a portion of dried mango fruit View this entry on the original dictionary page scan.
āmrātakeśvaran. Name of a liṅga-. View this entry on the original dictionary page scan.
āmre Causal P. -mreḍayati-, to repeat View this entry on the original dictionary page scan.
āmreḍam. repetition View this entry on the original dictionary page scan.
āmreḍanan. tautology, reiteration of words and sounds View this entry on the original dictionary page scan.
āmreḍitamfn. reiterated, repeated View this entry on the original dictionary page scan.
āmreḍitan. repetition of a sound or word View this entry on the original dictionary page scan.
āmreḍitan. (in grammar) reduplication, reiteration, the second word in a reiteration View this entry on the original dictionary page scan.
āmreḍitayamakan. a yamaka- (in which every pāda- ends with a word repeated twice). View this entry on the original dictionary page scan.
amṛtakeśavam. Name of a temple (built by amṛtaprabhā-) View this entry on the original dictionary page scan.
amṛtamegham. a cloud of nectar, View this entry on the original dictionary page scan.
amṛtatejasm. Name of a vidyādhara- prince View this entry on the original dictionary page scan.
amṛteśam. "lord of the immortals", Name of śiva- View this entry on the original dictionary page scan.
amṛteśayam. "lying on amṛta-", Name of viṣṇu- View this entry on the original dictionary page scan.
amṛteṣṭakāf. a burnt or baked (and therefore imperishable) brick (used for the sacrificial altar) View this entry on the original dictionary page scan.
amṛteśvaram. equals amṛtesa- q.v View this entry on the original dictionary page scan.
amṛteśvaram. Name of a medicament View this entry on the original dictionary page scan.
aṃsebhāram. a burden on the shoulder, (gaRa bhastrādi- q.v) View this entry on the original dictionary page scan.
aṃsebhārikamf(ī-)n. bearing a burden on the shoulder View this entry on the original dictionary page scan.
anabhipretan. an occurrence different from what was intended. View this entry on the original dictionary page scan.
anabhiṣecanīya(), mfn. not worthy of inauguration. View this entry on the original dictionary page scan.
anabhiṣekya(), mfn. not worthy of inauguration. View this entry on the original dictionary page scan.
anabhisnehamfn. without affection, cold, unimpassioned View this entry on the original dictionary page scan.
anādarākṣepam. (in rhetoric) objection to anything by feigned indifference, . View this entry on the original dictionary page scan.
anādeśakaramfn. doing what is not commanded or not allowed View this entry on the original dictionary page scan.
anādeyamfn. unfit or improper to be received, unacceptable, inadmissible. View this entry on the original dictionary page scan.
anāgatāvekṣaṇan. act of looking at that which is not yet come or the future. View this entry on the original dictionary page scan.
anākṣepamind. without reproaching (locative case), . View this entry on the original dictionary page scan.
ananaṅgamejayamfn. not leaving the body unshaken (?) see an-aṅgamejaya-. View this entry on the original dictionary page scan.
ānandabodhendram. Name of a scholiast. View this entry on the original dictionary page scan.
ānandadevam. Name of a poetry or poetic View this entry on the original dictionary page scan.
ānandavedam. Name of several men. View this entry on the original dictionary page scan.
ānandeśvaratīrthan. Name of a tīrtha-. View this entry on the original dictionary page scan.
anaṅgadef. Name of a queen of Kashmir. View this entry on the original dictionary page scan.
anaṅgalekhāf. a love letter View this entry on the original dictionary page scan.
anaṅgalekhāf. Name of a queen of Kashmir. View this entry on the original dictionary page scan.
anaṅgamejaya(an-aṅgam--) mfn. not shaking the body (?), (gaRa cārv-ādi- q.v) View this entry on the original dictionary page scan.
anaṅgaśekharam. Name of a metre (of four verses, each containing fifteen iambi). View this entry on the original dictionary page scan.
anaṅgasef. Name of a dramatic personage. View this entry on the original dictionary page scan.
anantadevam. Name of various persons, especially of a king of Kashmir. View this entry on the original dictionary page scan.
anantanemim. Name of a king of mālava-, a contemporary of śākyamuni-. View this entry on the original dictionary page scan.
ananteśvaraetc., names of persons unknown. View this entry on the original dictionary page scan.
ananyacetasmfn. giving one's undivided thought to (with locative case) View this entry on the original dictionary page scan.
ananyadevamfn. having no other god. View this entry on the original dictionary page scan.
anapadeśam. an invalid argument. View this entry on the original dictionary page scan.
anapakṣepyamfn. not to be rejected, View this entry on the original dictionary page scan.
anapekṣamfn. regardless, careless View this entry on the original dictionary page scan.
anapekṣamfn. indifferent View this entry on the original dictionary page scan.
anapekṣamfn. impartial View this entry on the original dictionary page scan.
anapekṣamfn. irrespective of View this entry on the original dictionary page scan.
anapekṣamfn. irrelevant View this entry on the original dictionary page scan.
anapekṣāf. disregard, carelessness View this entry on the original dictionary page scan.
anapekṣamind. irrespectively, carelessly View this entry on the original dictionary page scan.
anapekṣamāṇamfn. not looking about, View this entry on the original dictionary page scan.
anapekṣatvan. disregard View this entry on the original dictionary page scan.
anapekṣatvan. irrelevance View this entry on the original dictionary page scan.
anapekṣatvan. irrespectiveness View this entry on the original dictionary page scan.
anapekṣatvātind. from having no reference to, since (it) has no reference to. View this entry on the original dictionary page scan.
anapekṣinmfn. regardless of View this entry on the original dictionary page scan.
anapekṣinmfn. indifferent to. View this entry on the original dictionary page scan.
anapekṣitamfn. disregarded View this entry on the original dictionary page scan.
anapekṣitamfn. unheeded View this entry on the original dictionary page scan.
anapekṣitamfn. unexpected. View this entry on the original dictionary page scan.
anapekṣya ind.p. disregarding, irrespective of. View this entry on the original dictionary page scan.
anapetamfn. not gone off, not past View this entry on the original dictionary page scan.
anapetamfn. not separated, faithful to, possessed of. View this entry on the original dictionary page scan.
anārṣeyamfn. not connected with the ṛṣi-s View this entry on the original dictionary page scan.
anarthāvekṣamfn. regardless of (worldly) objects, View this entry on the original dictionary page scan.
anāśramevāsam. one who does not belong to the āśrama-s View this entry on the original dictionary page scan.
anāśramevāsam. non-residence in a religious retreat. View this entry on the original dictionary page scan.
anaṣṭavedas(/anaṣṭa--) mfn. having one's property unimpaired View this entry on the original dictionary page scan.
anatinedam. not foaming over View this entry on the original dictionary page scan.
anatirecan. not abundance View this entry on the original dictionary page scan.
anātmapratyavekṣāf. reflection that there is no spirit or self View this entry on the original dictionary page scan.
anavalepamfn. free from veneer, unvarnished, plain, unassuming. View this entry on the original dictionary page scan.
anāveditamfn. not notified, not made known. View this entry on the original dictionary page scan.
anavekṣamfn. regardless View this entry on the original dictionary page scan.
anavekṣamfn. without regard to View this entry on the original dictionary page scan.
anavekṣāf. or View this entry on the original dictionary page scan.
anavekṣamind. irrespectively View this entry on the original dictionary page scan.
anavekṣaṇan. regardlessness. View this entry on the original dictionary page scan.
anavekṣitamind. without looking at, View this entry on the original dictionary page scan.
anaveṣṭamfn. not averted by sacrifice, View this entry on the original dictionary page scan.
anavetamfn. not gone away or run off, View this entry on the original dictionary page scan.
anāyāsenaind. easily. View this entry on the original dictionary page scan.
aṇḍajeśvaram. "king of birds", garuḍa-. View this entry on the original dictionary page scan.
andhamehalan. the smell of being stained by urine, View this entry on the original dictionary page scan.
andhamehalamfn. having the above smell, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
aneḍam. (an-being an expletive or denoting comparison) , stupid, foolish View this entry on the original dictionary page scan.
aneḍamūkamfn. deaf and dumb View this entry on the original dictionary page scan.
aneḍamūkamfn. blind View this entry on the original dictionary page scan.
aneḍamūkamfn. wicked, fraudulent View this entry on the original dictionary page scan.
anedhasm. fire, View this entry on the original dictionary page scan.
anedhasthe wind, View this entry on the original dictionary page scan.
anedya(4) mfn. ( nid-), not to be blamed View this entry on the original dictionary page scan.
anehasmfn. ( īh-), without a rival, incomparable, unattainable View this entry on the original dictionary page scan.
anehasmfn. unmenaced, unobstructed View this entry on the original dictionary page scan.
anehasm. time View this entry on the original dictionary page scan.
anejatmfn. ( ej-), not moving, immovable. View this entry on the original dictionary page scan.
anekamfn. not one, many, much View this entry on the original dictionary page scan.
anekamfn. separated. View this entry on the original dictionary page scan.
anekabhāryamfn. having more wives than one. View this entry on the original dictionary page scan.
anekācmfn. having more than one vowel or syllable (ac-in grammar being the technical term for vowel) . View this entry on the original dictionary page scan.
anekacaramfn. gregarious. View this entry on the original dictionary page scan.
anekacittamantram. one whose counsels are many-minded. View this entry on the original dictionary page scan.
anekadhāind. in various ways, often. View this entry on the original dictionary page scan.
anekadhāprayogam. using repeatedly. View this entry on the original dictionary page scan.
anekadharmakathāf. different exposition of the law. View this entry on the original dictionary page scan.
anekadhṛtm. Name (also title or epithet) of rudra-śiva-, View this entry on the original dictionary page scan.
anekagotram. having more families than one id est two, belonging to two families (or to one as an adopted son). View this entry on the original dictionary page scan.
anekāgramfn. engaged in various pursuits. View this entry on the original dictionary page scan.
anekajamfn. born more than once View this entry on the original dictionary page scan.
anekajam. a bird View this entry on the original dictionary page scan.
anekakālamind. a long time, for a long time. View this entry on the original dictionary page scan.
anekakālāvadhiind. long since. View this entry on the original dictionary page scan.
anekakāma(/aneka--) mfn. having many wishes View this entry on the original dictionary page scan.
anekākāramfn. multiform. View this entry on the original dictionary page scan.
anekākinmfn. not alone, accompanied by View this entry on the original dictionary page scan.
anekakṛtm. "doing much", Name of śiva-. View this entry on the original dictionary page scan.
anekākṣaramfn. polysyllabic, having more than one syllable. View this entry on the original dictionary page scan.
anekālmfn. consisting of more than one letter (al-being the technical term for letter) . View this entry on the original dictionary page scan.
anekalocanam. "having several (three) eyes", Name of śiva-. View this entry on the original dictionary page scan.
anekamukhamfn. having several faces, having different ways. View this entry on the original dictionary page scan.
anekāntamfn. not alone and excluding every other, uncertain. View this entry on the original dictionary page scan.
anekāntatvan. uncertainty. View this entry on the original dictionary page scan.
anekāntavādam. scepticism. View this entry on the original dictionary page scan.
anekāntavādinm. a sceptic View this entry on the original dictionary page scan.
anekāntavādinm. a jaina-, an arhat- of the jaina-s. View this entry on the original dictionary page scan.
anekapamfn. "drinking oftener than once", an elephant (because he drinks with his trunk and with his mouth) View this entry on the original dictionary page scan.
anekarandhramfn. having many holes or weaknesses or troubles. View this entry on the original dictionary page scan.
anekārthamfn. having more than one meaning (as a word). View this entry on the original dictionary page scan.
anekārthadhvanimañjarīf. Name of two works on words. View this entry on the original dictionary page scan.
anekārthasaṃgraham. Name of two works on words. View this entry on the original dictionary page scan.
anekarūpamf(ā-)n. multiform View this entry on the original dictionary page scan.
anekarūpamf(ā-)n. of various kinds or sorts View this entry on the original dictionary page scan.
anekarūpamf(ā-)n. fickle, of variable mind. View this entry on the original dictionary page scan.
anekaśabdamfn. expressed by several words, synonymous. View this entry on the original dictionary page scan.
anekasaṃkhyamfn. very numerous, View this entry on the original dictionary page scan.
anekasaṃsthānamfn. wearing various disguises (as spies), View this entry on the original dictionary page scan.
anekaśaphamfn. cloven-hoofed commentator or commentary View this entry on the original dictionary page scan.
anekaśasind. in great numbers, several times, repeatedly. View this entry on the original dictionary page scan.
anekāśraya mfn. (in vaiśeṣika- philosophy) dwelling or abiding in more than one. View this entry on the original dictionary page scan.
anekāśritamfn. (in vaiśeṣika- philosophy) dwelling or abiding in more than one. View this entry on the original dictionary page scan.
anekatāf. muchness, manifold condition. View this entry on the original dictionary page scan.
anekātmavādinmfn. asserting a plurality of souls, Sa1m2khyas., Scholiast or Commentator View this entry on the original dictionary page scan.
anekatraind. in many places. View this entry on the original dictionary page scan.
anekatvan. muchness, manifold condition. View this entry on the original dictionary page scan.
anekavacanan. the plural number. View this entry on the original dictionary page scan.
anekavāramind. many times, repeatedly. View this entry on the original dictionary page scan.
anekavarṇa(in algebra compounded with various words to denote) many unknown quantities (colours representingx,y,z,etc. exempli gratia, 'for example' aneka-varṇa-guṇana-,multiplication of many unknown quantities) . View this entry on the original dictionary page scan.
anekavarṇamfn. many-coloured, View this entry on the original dictionary page scan.
anekavārṣikamfn. many years old, View this entry on the original dictionary page scan.
anekavidhamfn. of many kinds, in different ways, various. View this entry on the original dictionary page scan.
anekayuddhavijayinm. victorious in many battles. View this entry on the original dictionary page scan.
anekībhavatmfn. being manifold id est divided in two. View this entry on the original dictionary page scan.
anekīkaraṇan. making manifold. View this entry on the original dictionary page scan.
anekīyamfn. having several, (gaRa utkarādi- q.v) View this entry on the original dictionary page scan.
anelamūka(probably) = an-- eḍa-- m-, View this entry on the original dictionary page scan.
anemanmfn. equals praśasya- (to be praised) View this entry on the original dictionary page scan.
ānemimagnamfn. sunk up to the rim or felloe (as a wheel). View this entry on the original dictionary page scan.
anenamfn. without stags (see en/ī-) View this entry on the original dictionary page scan.
anenasmfn. blameless, sinless, not liable to error View this entry on the original dictionary page scan.
anenasmfn. Name of various personages.
anenasyan. freedom from fault, sin View this entry on the original dictionary page scan.
ānetavaiSee under ā--. View this entry on the original dictionary page scan.
ānetavyamfn. = ā-nāyya-1 q.v View this entry on the original dictionary page scan.
ānetṛmfn. one who leads or brings near, a bringer, bringing View this entry on the original dictionary page scan.
anevaind. otherwise View this entry on the original dictionary page scan.
anevamind. not so, View this entry on the original dictionary page scan.
anevaṃvidmfn. not having such knowledge, View this entry on the original dictionary page scan.
anevaṃvidvas mfn. not having such knowledge, View this entry on the original dictionary page scan.
āneyamfn. to be brought, View this entry on the original dictionary page scan.
aṅgabhedamfn. causing rheumatism View this entry on the original dictionary page scan.
aṅgabhedam. self-betrayal, View this entry on the original dictionary page scan.
aṅgamejayatva(aṅgam-ej-) n. the trembling of the body View this entry on the original dictionary page scan.
aṅgānulepanan. anointing the body. View this entry on the original dictionary page scan.
aṅgārasetum. Name of a prince, father of gāndhāra-. View this entry on the original dictionary page scan.
aṅgārāvakṣepaṇan. an instrument for putting on coals, tongs, View this entry on the original dictionary page scan.
aṅgarejamfn. English, View this entry on the original dictionary page scan.
aṅgavikṣepam. gesticulation View this entry on the original dictionary page scan.
aṅgavikṣepam. movement of the limbs and arms a kind of dance. View this entry on the original dictionary page scan.
aṅgeṣṭhāmfn. situated in a member or in the body View this entry on the original dictionary page scan.
aṅgeśvaram. the king of aṅga-. View this entry on the original dictionary page scan.
āṅgeyam. (equals āṅga-,m.) a prince of aṅga- View this entry on the original dictionary page scan.
āṅgeya āṅgya- See āṅga-. View this entry on the original dictionary page scan.
āṅgef. a princess of aṅga- View this entry on the original dictionary page scan.
aṅghryavanejanamf(ī-)n. washing the feet View this entry on the original dictionary page scan.
aṅghryavanejanafit for washing the feet, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
aṅghryavanejanatva(n.) View this entry on the original dictionary page scan.
āṅgiraseśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
aṅgulipraṇejanan. water for washing the fingers, View this entry on the original dictionary page scan.
aṅgulisaṃdeṃsam. snapping or cracking the fingers as a sign. View this entry on the original dictionary page scan.
aṅgulīveṣṭam. (probably) a glove, View this entry on the original dictionary page scan.
aṅguliveṣṭakam. a glove (?). View this entry on the original dictionary page scan.
aṅguliveṣṭanan. a glove (?). View this entry on the original dictionary page scan.
aṅguṣṭhavibhedakam. "thumb-separator", a mitten, View this entry on the original dictionary page scan.
āniceyamf(ī-[ ])n. (according to [fr. ā-ni-ci-],to be gathered from every side;more probably) a descendant of aniceya- ([ ]) View this entry on the original dictionary page scan.
ānidheyamf(ī-[ ]) n. a descendant of a-nidheya- ([ ]) View this entry on the original dictionary page scan.
anighāteṣum. "having arrows that strike no one"Name of a man. View this entry on the original dictionary page scan.
aniketaor a-niketana- mfn. houseless. View this entry on the original dictionary page scan.
animeṣamfn. equals animiṣ/a- View this entry on the original dictionary page scan.
animeṣamind. vigilantly View this entry on the original dictionary page scan.
anirbhedam. not blurting out, not revealing. View this entry on the original dictionary page scan.
anirdeśam. absence of rule or direction. View this entry on the original dictionary page scan.
anirdeśyamfn. undefinable, inexplicable, incomparable. View this entry on the original dictionary page scan.
anirṇeyamfn. not to be decided. View this entry on the original dictionary page scan.
anirvedam. non-depression, self-reliance. View this entry on the original dictionary page scan.
anirveditamfn. not depressed, self-reliant, bold, View this entry on the original dictionary page scan.
anirveśa(equals akṛta-nirveśa-) mfn. not having expiated one's sins View this entry on the original dictionary page scan.
aniśceyamfn. not to be decided or ascertained, View this entry on the original dictionary page scan.
aniṣeddhramf(-)n. unimpeded View this entry on the original dictionary page scan.
aniṣṭahetum. an evil omen.
aniṣṭotprekṣaṇan. expectation of evil. View this entry on the original dictionary page scan.
anityapratyavekṣāf. consciousness that all is passing away View this entry on the original dictionary page scan.
aniveditamfn. untold, unmentioned. View this entry on the original dictionary page scan.
aniveditavijñātamfn. known without being told. View this entry on the original dictionary page scan.
anivedya ind.p. not having announced. View this entry on the original dictionary page scan.
aniveśanamf(-)n. affording no place of rest View this entry on the original dictionary page scan.
aniveṣṭyamānamfn. not being fettered or hindered, View this entry on the original dictionary page scan.
āṇīveyam. a descendant of aṇīva-, (gaRa śubhrādi-, q.v) View this entry on the original dictionary page scan.
añjanakeśamf(ī-)n. whose hair (or mane) is as black as pigment View this entry on the original dictionary page scan.
añjanakeśīf. Name of a vegetable perfume. View this entry on the original dictionary page scan.
āñjaneyam. "son of añjanā-", Name of the monkey hanumat- View this entry on the original dictionary page scan.
āñjaneya Name (also title or epithet) of an author View this entry on the original dictionary page scan.
āñjaneyapurāṇan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
āñjaneyastavam. Name (also title or epithet) of work View this entry on the original dictionary page scan.
āñjaneyastotran. Name (also title or epithet) of work View this entry on the original dictionary page scan.
āñjineyam. a kind of lizard (see añjanikā-.) View this entry on the original dictionary page scan.
añjyetamfn. black and white coloured View this entry on the original dictionary page scan.
aṅkacchedam. (in dramatic language) interruption (of the action) by the close of an Act, View this entry on the original dictionary page scan.
annadevatāf. the divinity supposed to preside over articles of food. View this entry on the original dictionary page scan.
annadveṣam. want of appetite, dislike of food. View this entry on the original dictionary page scan.
annapeyan. explains the word vāja-p/eya- q.v View this entry on the original dictionary page scan.
annasaṃdeha(ann/a--), m. cementing of food, View this entry on the original dictionary page scan.
annaśeṣam. leavings, offal. View this entry on the original dictionary page scan.
annatejas(/anna--) mfn. having the vigour of food View this entry on the original dictionary page scan.
annavidveṣam. "disgust of food", want of appetite, View this entry on the original dictionary page scan.
anṛgvedavinītamfn. not versed in the ṛg-veda-, View this entry on the original dictionary page scan.
anṛtadeva(/anṛta--) m. one whose gods are not true View this entry on the original dictionary page scan.
antaḥpadeind. in the middle of an inflected word View this entry on the original dictionary page scan.
antaḥpeyan. supping up, drinking View this entry on the original dictionary page scan.
antaḥpraveśam. entering within, View this entry on the original dictionary page scan.
antaḥpurevāsamfn. living in the women's apartments, View this entry on the original dictionary page scan.
antaḥsenamind. into the midst of the armies. View this entry on the original dictionary page scan.
antaḥśleṣa([ ]) m. internal support. View this entry on the original dictionary page scan.
antaḥśleṣaṇa([ ]) n. internal support. View this entry on the original dictionary page scan.
antaḥsmeramfn. smiling inwardly, View this entry on the original dictionary page scan.
antaḥsvedam. "sweating internally", an elephant View this entry on the original dictionary page scan.
antanetran. the hem of a garment, View this entry on the original dictionary page scan.
antarābhavadeham. the soul in its middle existence between death and regeneration. View this entry on the original dictionary page scan.
antarālakeind. locative case in the midst, in midway (āla-is probably for ālaya-). View this entry on the original dictionary page scan.
antarāleind. locative case in the midst, in midway (āla-is probably for ālaya-). View this entry on the original dictionary page scan.
antarānveṣinmfn. waiting for an opportunity, View this entry on the original dictionary page scan.
antaraprekṣinmfn. perceiving a weak point, View this entry on the original dictionary page scan.
antarātmeṣṭakamind. in the space between one's self and the (sacrificial) bricks View this entry on the original dictionary page scan.
antarāvef. a veranda resting on columns View this entry on the original dictionary page scan.
antarbhedam. inner division, View this entry on the original dictionary page scan.
antardeśam. an intermediate region of the compass View this entry on the original dictionary page scan.
antareind. amidst, among, between View this entry on the original dictionary page scan.
antareind. with regard to, for the sake of, on account of. View this entry on the original dictionary page scan.
antareṇaind. amidst, between View this entry on the original dictionary page scan.
antareṇaind. (with accusative) within, between, amidst, during View this entry on the original dictionary page scan.
antareṇaind. except, without, with regard to, with reference to, on account of. View this entry on the original dictionary page scan.
antareṣam. the space between the two shafts of a carriage, View this entry on the original dictionary page scan.
antargehan. interior of the house, inner apartment View this entry on the original dictionary page scan.
antargehamind. in the interior of a house. View this entry on the original dictionary page scan.
āntargehikamf(ī-)n. (fr. antargeha-), being inside a house
antarniveśanan. an inner apartment, View this entry on the original dictionary page scan.
antarvediind. within the sacrificial ground etc. View this entry on the original dictionary page scan.
antarvef. the Doab or district between the gaṅgā- and yamunā- rivers View this entry on the original dictionary page scan.
antarvedim. plural (ayas-) Name of the people living there View this entry on the original dictionary page scan.
āntarvedikamfn. (fr. antarvedika-), being within the place of sacrifice commentator or commentary on View this entry on the original dictionary page scan.
antarvegam. internal uneasiness or anxiety View this entry on the original dictionary page scan.
antarvegam. inward fever. View this entry on the original dictionary page scan.
antarveśmann. the inner apartments, the interior of a building. View this entry on the original dictionary page scan.
āntarveśmikamf(ī-)n. (fr. antar-veśma-), produced or occurring within a house View this entry on the original dictionary page scan.
antarveśmikam. superintendent of the women's apartments. View this entry on the original dictionary page scan.
antavef. hour of death View this entry on the original dictionary page scan.
antevāsam. a neighbour, companion View this entry on the original dictionary page scan.
antevasāyinm. a man living at the end of a town or village, a man belonging to the lowest caste View this entry on the original dictionary page scan.
antevāsiind. in statu pupillari, (gaRa dvidaṇḍy-ādi- q.v) View this entry on the original dictionary page scan.
antevāsinSee . View this entry on the original dictionary page scan.
antevāsinmfn. dwelling near the boundaries, dwelling close by View this entry on the original dictionary page scan.
antevāsinm. a pupil who dwells near or in the house of his teacher etc. View this entry on the original dictionary page scan.
antevāsinm. equals ante-'vasāyin- q.v View this entry on the original dictionary page scan.
antideva(/anti--) mfn. being in the presence of the gods, near the gods View this entry on the original dictionary page scan.
antidevam. Name (also title or epithet) of an ancient king and sage, ibidem or 'in the same place or book or text' as the preceding ; View this entry on the original dictionary page scan.
antikeind. (with genitive case or in fine compositi or 'at the end of a compound') near, close by, in the proximity or presence of View this entry on the original dictionary page scan.
antikenaind. (with genitive case) near. View this entry on the original dictionary page scan.
antyeṣṭif. funeral sacrifice. View this entry on the original dictionary page scan.
antyeṣṭikriyāf. funeral ceremonies. View this entry on the original dictionary page scan.
anucchedam. equals an-uc-chitti-. View this entry on the original dictionary page scan.
anucchedyamfn. indestructible, not severable. View this entry on the original dictionary page scan.
anūcyate Passive voice of anu-vac- q.v , . View this entry on the original dictionary page scan.
anudāttetm. a verbal root having for its anubandha- the anudātta- accent to indicate that it takes the ātmane-pada- terminations only View this entry on the original dictionary page scan.
anudāttetm. also anudāttopadeśa-. View this entry on the original dictionary page scan.
anūddeśam. ( diś-), describing, mentioning according to or conformably with View this entry on the original dictionary page scan.
anūddeśasubsequent indication, View this entry on the original dictionary page scan.
anūde( -ā-i-) cl.2 P. anūd-aiti-, to rise or come up after View this entry on the original dictionary page scan.
anudehamind. behind the body View this entry on the original dictionary page scan.
anudeśam. a rule or injunction pointing back to a previous rule View this entry on the original dictionary page scan.
anudeśam. reference to something prior. View this entry on the original dictionary page scan.
ānudeśikamfn. belonging to an anu-- deśa- (q.v) rule View this entry on the original dictionary page scan.
anudeśinmfn. pointing back, referring back View this entry on the original dictionary page scan.
anudeśinmfn. being the object of an anudeśa- View this entry on the original dictionary page scan.
anudeśinmfn. residing at the same place View this entry on the original dictionary page scan.
anudeyan. a present View this entry on the original dictionary page scan.
anudef. a bride's maid ( and ) View this entry on the original dictionary page scan.
anudef. (["gift" ]) View this entry on the original dictionary page scan.
anudheCaus. -dhāpayati-, to cause to suck, to put to the breast View this entry on the original dictionary page scan.
ānudṛṣṭeyamfn. idem or 'mf. a descendant of anu-dṛṣṭi-, q.v ' View this entry on the original dictionary page scan.
ānudṛṣṭineyamf. a descendant of anu-dṛṣṭi-, q.v View this entry on the original dictionary page scan.
anudvegamfn. free from anxiety View this entry on the original dictionary page scan.
anudvegam. freedom from uneasiness. View this entry on the original dictionary page scan.
anudvegakaramfn. not causing apprehension, not overawing. View this entry on the original dictionary page scan.
anudvejayatmfn. not stimulating, View this entry on the original dictionary page scan.
anugeyamfn. to be sung after, View this entry on the original dictionary page scan.
anuhveto call again, call after, call back : Intensive -johavīti-, to call repeatedly View this entry on the original dictionary page scan.
anujñākṣepam. (in rhetoric) an objection expressed by a feigned consent, . View this entry on the original dictionary page scan.
anujyeṣṭhamfn. next eldest View this entry on the original dictionary page scan.
anujyeṣṭhamind. after the eldest, according to seniority View this entry on the original dictionary page scan.
anukrośākṣepam. (in rhetoric) an objection based on compassion or sympathy, . View this entry on the original dictionary page scan.
anukṣetran. stipend given to temple-servants in Orissa (in commutation probably of the proceeds of an endowment). View this entry on the original dictionary page scan.
anulepam. unction, anointing, bedaubing. View this entry on the original dictionary page scan.
anulepakamfn. anointing the body with unguents View this entry on the original dictionary page scan.
anulepanan. anointing the body View this entry on the original dictionary page scan.
anulepanan. unguent so used View this entry on the original dictionary page scan.
anulepanan. oily or emollient application. View this entry on the original dictionary page scan.
anulepikāf. (gaRa mahiṣy-ādi- q.v) View this entry on the original dictionary page scan.
anulepinmfn. (in fine compositi or 'at the end of a compound') smeared or anointed with, View this entry on the original dictionary page scan.
anumateind. with consent of. View this entry on the original dictionary page scan.
anumeyamfn. to be measured View this entry on the original dictionary page scan.
anumeyamfn. inferable, to be inferred, proved or conjectured. View this entry on the original dictionary page scan.
anuneyamfn. to be conciliated View this entry on the original dictionary page scan.
anunirdeśam. description or relation following a previous model. View this entry on the original dictionary page scan.
anupādeind. behind (a person's feet), View this entry on the original dictionary page scan.
anūpadeśam. a marshy country. View this entry on the original dictionary page scan.
anupadeṣṭavyamfn. not to be commended, View this entry on the original dictionary page scan.
anupadeṣṭṛm. one who does not teach. View this entry on the original dictionary page scan.
anupadhiśeṣamfn. in whom there is no longer a condition of individuality View this entry on the original dictionary page scan.
anupahatakarṇendriyatāf. having the organ of hearing uninjured (one of the 80 minor marks 0f a buddha-), . View this entry on the original dictionary page scan.
anupameyamfn. incomparable. View this entry on the original dictionary page scan.
anupare( -parā-i-), (Imper. 2. sg. -p/arehi-; imperfect tense -p/araīt-) to follow in walking off View this entry on the original dictionary page scan.
anuparye( -ā-i-), -pary-aiti-, to make the whole round of View this entry on the original dictionary page scan.
anupasecanamfn. having nothing that moistens (exempli gratia, 'for example' no sauce) View this entry on the original dictionary page scan.
anupeta([ ]) or anupeta-pūrva- ([ ]), mfn. not yet entered at a teacher's (for instruction). View this entry on the original dictionary page scan.
anupetanot affected by, devoid of (compound), View this entry on the original dictionary page scan.
anupeyamfn. not to be married, View this entry on the original dictionary page scan.
anupeyamānamfn. not being approached (sexually), View this entry on the original dictionary page scan.
anupraveśam. entrance into View this entry on the original dictionary page scan.
anupraveśam. imitation View this entry on the original dictionary page scan.
anupraveśanan. ([ gaṇa- anupravacanādi- q.v ]) entrance into View this entry on the original dictionary page scan.
anupraveśanan. imitation View this entry on the original dictionary page scan.
anupraveśanīyamfn. connected with entering, (gaRa anupravacanādi- q.v) View this entry on the original dictionary page scan.
anupre( i-) cl.2 P. -praiti-, to follow etc. ; to follow in death ; to seek after View this entry on the original dictionary page scan.
anuprekṣ( īkṣ-) to follow with the eyes. View this entry on the original dictionary page scan.
anupre( iṣ-), Causal P. -preṣayati- to send forth after. View this entry on the original dictionary page scan.
anupreṣaṇan. sending after, , Scholiast or Commentator View this entry on the original dictionary page scan.
anupūrvakeśamfn. having regular hair, regularly shaped limbs, regular teeth, a regularly shaped navel, regular lines in the hands (all these are epithets given to buddha-, some of them also to mahāvīra-) and View this entry on the original dictionary page scan.
anupūrvapāṇilekhamfn. having regular hair, regularly shaped limbs, regular teeth, a regularly shaped navel, regular lines in the hands (all these are epithets given to buddha-, some of them also to mahāvīra-) and View this entry on the original dictionary page scan.
anupūrveṇaind. in regular order or succession, from the first, from the beginning, from above downwards. View this entry on the original dictionary page scan.
anupūrveṇagradually, by degrees, View this entry on the original dictionary page scan.
anurāgeṅgitan. gesture expressive of passion. View this entry on the original dictionary page scan.
aṇureṇumf. atomic dust (as seen in sun-beams). View this entry on the original dictionary page scan.
aṇureṇujālan. an aggregate of such atomic dust. View this entry on the original dictionary page scan.
aṇurevatīf. the plant Croton Polyandrum. View this entry on the original dictionary page scan.
anurevatīf. Name of a plant. View this entry on the original dictionary page scan.
anurūpaceṣṭamfn. endeavouring to act becomingly. View this entry on the original dictionary page scan.
anurūpeṇaind. in fine compositi or 'at the end of a compound' conformably, according. View this entry on the original dictionary page scan.
anusaṃdheyamfn. to be investigated, worthy of inquiry or scrutiny, etc. View this entry on the original dictionary page scan.
anuśayākṣepam. (in rhetoric) objection expressing (or resulting from) repenting, . View this entry on the original dictionary page scan.
anuṣekam. rewatering or sprinkling over again View this entry on the original dictionary page scan.
anuṣekaṣecanan. rewatering or sprinkling over again View this entry on the original dictionary page scan.
anusevto practise, observe. View this entry on the original dictionary page scan.
anusevinmfn. practising, observing, habitually addicted to. View this entry on the original dictionary page scan.
anusnehamind. after (adding) oil View this entry on the original dictionary page scan.
ānusṛṣṭineyamf. a descendant of anu-sṛṣṭi- View this entry on the original dictionary page scan.
ānusṛtineyamf. a descendant of anu-sṛti- View this entry on the original dictionary page scan.
anuṣṭheyamfn. to be effected, done or accomplished
anuṣṭheyamfn. to be observed View this entry on the original dictionary page scan.
anuṣṭheyamfn. to be proved or established. View this entry on the original dictionary page scan.
anutsekam. absence of arrogance or highmindedness. View this entry on the original dictionary page scan.
anutsekinmfn. not arrogant or puffed up View this entry on the original dictionary page scan.
anuvaineyaName of a country. View this entry on the original dictionary page scan.
anuvāteind. with the wind blowing in the same direction, to windward View this entry on the original dictionary page scan.
aṇuvedāntam. title of a book. View this entry on the original dictionary page scan.
anuvedha m. piercing View this entry on the original dictionary page scan.
anuvedham. obstructing View this entry on the original dictionary page scan.
anuvedham. blending, intermixture. View this entry on the original dictionary page scan.
anuvediind. along the ground prepared for sacrifice View this entry on the original dictionary page scan.
anuvedyantamind. along the edge of the sacrificial ground View this entry on the original dictionary page scan.
anuvelamind. now and then. View this entry on the original dictionary page scan.
anuvellitan. ( vell-), bandaging, securing with bandages (in surgery) View this entry on the original dictionary page scan.
anuvellitan. a kind of bandage applied to the extremities View this entry on the original dictionary page scan.
anuvellitamfn. bent in conformity with, bent under. View this entry on the original dictionary page scan.
anuvento allure, entice View this entry on the original dictionary page scan.
anuveśam. entering after, following. View this entry on the original dictionary page scan.
anuveśaveśanan. entering after, following. View this entry on the original dictionary page scan.
anuveṣṭto be fixed to, cling to : Causal P. -veṣṭayati-, to wind round, cover. View this entry on the original dictionary page scan.
ānuveśyamfn. (fr. anu-veśa- ), a neighbour living on the same side View this entry on the original dictionary page scan.
anuvidheyamfn. to be followed, View this entry on the original dictionary page scan.
anuvidheyato be prescribed according to (instrumental case), View this entry on the original dictionary page scan.
anuvyave( i-) cl.2 P. -avaiti-, to follow in intervening or coming between View this entry on the original dictionary page scan.
anvādeśam. mentioning after, a repeated mention, referring to what has been stated previously, re-employment of the same word in a subsequent part of a sentence, the employment again of the same thing to perform a subsequent operation. View this entry on the original dictionary page scan.
anvādeśakamfn. referring to a previous statement View this entry on the original dictionary page scan.
anvādheya n. property presented after marriage to the wife by her husband's family View this entry on the original dictionary page scan.
anvādheyaādheyakan. property presented after marriage to the wife by her husband's family View this entry on the original dictionary page scan.
anvagjyeṣṭhamfn. the next eldest, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
anvāhveto call to one's side in order or after another View this entry on the original dictionary page scan.
anvāje( aj-?), only used in connection with 1. kṛ- exempli gratia, 'for example' anvāje kṛ- to support, aid, assist View this entry on the original dictionary page scan.
anvāsecanan. sprinkling, View this entry on the original dictionary page scan.
anvave( i-) cl.2 P. -avaiti-, to follow, walk up to or get into. View this entry on the original dictionary page scan.
anvavekṣ( īkṣ-) to look at, inspect. View this entry on the original dictionary page scan.
anvavekṣāf. regard, consideration. View this entry on the original dictionary page scan.
anvavekṣaṇan. looking after, inspection, View this entry on the original dictionary page scan.
anvavekṣinmfn. circumspect, considerate, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
anvayavyatirekan. agreement and contrariety View this entry on the original dictionary page scan.
anvayavyatirekan. a positive and negative proposition View this entry on the original dictionary page scan.
anvayavyatirekan. species and difference View this entry on the original dictionary page scan.
anvayavyatirekan. rule and exception View this entry on the original dictionary page scan.
anvayavyatirekan. logical connection and disconnection. View this entry on the original dictionary page scan.
anvayavyatirekinmfn. (in philosophy) affirmative and negative. View this entry on the original dictionary page scan.
anve( ā-i-) cl.2 P. -aiti-, to come after, to follow as an adherent or attendant View this entry on the original dictionary page scan.
anveṣam. ([ ]) seeking for, searching, investigating. View this entry on the original dictionary page scan.
anveṣakamf(ikā-)n. searching, inquiring. View this entry on the original dictionary page scan.
anveṣaṇaf(ā-)n. seeking for, searching, investigating. View this entry on the original dictionary page scan.
anveṣin ([ ]) mfn. searching, inquiring. View this entry on the original dictionary page scan.
anveṣṭavya mfn. to be searched, to be investigated. View this entry on the original dictionary page scan.
anveṣṭṛ([ ]) mfn. searching, inquiring. View this entry on the original dictionary page scan.
anveṣṭṛmfn. searching, pursuing, View this entry on the original dictionary page scan.
anveṣyamfn. to be searched, to be investigated. View this entry on the original dictionary page scan.
anvetaveetc. See anv-i-. View this entry on the original dictionary page scan.
anyadevata mfn. having another divinity id est addressed to another divinity. View this entry on the original dictionary page scan.
anyadevatya([ ]) mfn. having another divinity id est addressed to another divinity. View this entry on the original dictionary page scan.
anyakṣetran. another territory or sphere View this entry on the original dictionary page scan.
anyaṅgaśvetamfn. white and without spot (as a sacrificial animal) View this entry on the original dictionary page scan.
anyāpadeśam. (= anyo- kti-), View this entry on the original dictionary page scan.
anyataetamf(-enī-)n. variegated on one side View this entry on the original dictionary page scan.
anyataredyusind. on either of two days View this entry on the original dictionary page scan.
ānyatareyam. (fr. anya-tara- gaRa śubhrādi- ), Name of a grammarian ([ ]), (perhaps rather) belonging to the school [and family] of another [teacher] ?. View this entry on the original dictionary page scan.
anyedyukamfn. ([ ]) occurring on another day View this entry on the original dictionary page scan.
anyedyukam. a chronic fever. View this entry on the original dictionary page scan.
anyedyusind. on the other day, on the following day etc.
anyedyusind. the other day, once
anyedyuṣkamfn. ([ ]) occurring on another day View this entry on the original dictionary page scan.
anyedyuṣkam. a chronic fever. View this entry on the original dictionary page scan.
anyedyuṣka(), mfn. relating or belonging to the other day. View this entry on the original dictionary page scan.
anyedyuska (), mfn. relating or belonging to the other day. View this entry on the original dictionary page scan.
anyoktiparicchedam. plural Name (also title or epithet) of work View this entry on the original dictionary page scan.
anyonyabhedam. mutual division or enmity. View this entry on the original dictionary page scan.
anyonyasāpekṣamfn. mutually relating. View this entry on the original dictionary page scan.
apacchedamn. cutting off or away View this entry on the original dictionary page scan.
apacchedamn. separation. View this entry on the original dictionary page scan.
apacchedanan. idem or 'mn. separation.' View this entry on the original dictionary page scan.
apacetasmfn. not favourable to (with ablative) View this entry on the original dictionary page scan.
apacetasmfn. averse from (ablative), View this entry on the original dictionary page scan.
apacetṛm. a spendthrift View this entry on the original dictionary page scan.
apadeśam. assigning, pointing out View this entry on the original dictionary page scan.
apadeśam. pretence, feint, pretext, disguise, contrivance View this entry on the original dictionary page scan.
apadeśam. the second step in a syllogism (id est statement of the reason) View this entry on the original dictionary page scan.
apadeśam. a butt or mark View this entry on the original dictionary page scan.
apadeśam. place, quarter View this entry on the original dictionary page scan.
apadeśinmfn. assuming the appearance or semblance of View this entry on the original dictionary page scan.
apadeśinmfn. pretending, feigning View this entry on the original dictionary page scan.
apadeśyamfn. to be indicated, to be stated View this entry on the original dictionary page scan.
āpadevam. (fr. 2. ap-), Name of the god of water (varuṇa-) View this entry on the original dictionary page scan.
āpadevam. Name of an author View this entry on the original dictionary page scan.
apadevatāf. an evil demon. View this entry on the original dictionary page scan.
āpadef. Name of a book written by the above (the mīmāṃsānyāya-prakāśa-). View this entry on the original dictionary page scan.
āpageyam. "a descendant of the river āpagā-", Name of bhīṣma-
apahef. contempt View this entry on the original dictionary page scan.
apahelanan. = ava-- h-, View this entry on the original dictionary page scan.
apahrepaṇan. putting to shame, View this entry on the original dictionary page scan.
āpākesthamfn. standing in an oven View this entry on the original dictionary page scan.
apakrāntamedha(/ap--), mfn. sapless, pithless, View this entry on the original dictionary page scan.
apakṛṣṭacetanamfn. mentally debased. View this entry on the original dictionary page scan.
apakṣepaṇan. throwing down, etc. View this entry on the original dictionary page scan.
apamakṣetraSee krānti-kṣetra-. View this entry on the original dictionary page scan.
apamecl.1 A1. -mayate- (ind.p. -mitya-,or -māya-) to be in debt to, owe View this entry on the original dictionary page scan.
āpaṇadevatāf. image of a deity placed in the market View this entry on the original dictionary page scan.
āpaṇavedikāf. a shop-counter View this entry on the original dictionary page scan.
apanetṛm. a remover, taking away. View this entry on the original dictionary page scan.
apaneyamfn. to be taken back, View this entry on the original dictionary page scan.
āpaneyamfn. to be reached or obtained View this entry on the original dictionary page scan.
apāṅgadeśam. the place round the outer corner of the eye. View this entry on the original dictionary page scan.
apāṅganetramf(ā-)n. casting side glances View this entry on the original dictionary page scan.
apāṅgaviśālanetramfn. casting side glances with wideopened eyes, View this entry on the original dictionary page scan.
apāṅkteyamfn. "not in a line or row", not in the same class, inadmissible into society, ejected from caste View this entry on the original dictionary page scan.
apapare( i-), (perf. 1. sg. /apa p/areto asmi-; /apa asmi-may also be taken by itself as fr. 1. apās-) to go off View this entry on the original dictionary page scan.
apapre( i-), (3. pl. -pra-y/anti-,or -pr/a-yanti-;Opt. -pr/eyāt-) to go away, withdraw View this entry on the original dictionary page scan.
aparāddheṣum. an archer whose arrows miss the mark View this entry on the original dictionary page scan.
aparahemantam. n. the latter part of winter. View this entry on the original dictionary page scan.
aparāhṇetana([ ]) mfn. belonging to or produced at the close of the day. View this entry on the original dictionary page scan.
aparapraṇeyamfn. easily led by others, tractable. View this entry on the original dictionary page scan.
aparavedanīyan. (Karman) manifesting itself at a subsequent period, View this entry on the original dictionary page scan.
aparāvṛttabhāgadheyamfn. one to whom fortune does not return, miserable, View this entry on the original dictionary page scan.
aparedyusind. on the following day View this entry on the original dictionary page scan.
aparedyusSee 2. /apara-. View this entry on the original dictionary page scan.
apareṇaind. (with accusative) behind, west, to the west of ([ confer, compare Gothic and Old German afar,and the modern German aber,in such words asAber-mal,Aber-witz]). View this entry on the original dictionary page scan.
aparetarāf. opposite to or other than the west, the east View this entry on the original dictionary page scan.
aparicchedam. want of distinction or division View this entry on the original dictionary page scan.
aparicchedam. want of discrimination , want of judgement, continuance.
apariceyamfn. unsociable. View this entry on the original dictionary page scan.
aparimeyamfn. immeasurable, illimitable. View this entry on the original dictionary page scan.
aparisaṃkhyeyamfn. innumerable, infinitely different, ibidem or 'in the same place or book or text' as the preceding, Scholiast or Commentator View this entry on the original dictionary page scan.
apariśeṣamfn. not leaving a remainder, all-surrounding, all-enclosing, View this entry on the original dictionary page scan.
aparuṣakeśatāf. having soft hair (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
aparyeṣitamfn. unsought, View this entry on the original dictionary page scan.
aparyeṣṭa mfn. unsought, View this entry on the original dictionary page scan.
apasavyenaind. to the left, from the right to the left View this entry on the original dictionary page scan.
apaṭīkṣepam. "tossing aside the curtain" View this entry on the original dictionary page scan.
apaṭīkṣepeṇaind. with a toss of the curtain, precipitate entrance on the stage (indicating hurry and agitation) (see paṭīkṣepa-.) View this entry on the original dictionary page scan.
apatyasneham. love for one's own children, View this entry on the original dictionary page scan.
apauruṣeyamfn. not coming from men View this entry on the original dictionary page scan.
apavāritakenaind. equals apa-vāritam-. View this entry on the original dictionary page scan.
apave(Imper. 2. sg. -vaya-) to unweave what has been woven View this entry on the original dictionary page scan.
apavedham. piercing anything in the wrong direction or manner (spoiling a jewel by so piercing it) View this entry on the original dictionary page scan.
apaven(subjunctive 2 sg. -venas-) to turn away from, be unfavourable to View this entry on the original dictionary page scan.
apaveṣṭCaus. -veṣṭayati-, to strip off
apavyeP. A1. -vyayati- (1. sg. -vyaye-) to uncover : A1. (pr. p. -vyayamāna-) to extricate one's self, deny View this entry on the original dictionary page scan.
ape( i-) P. A1. apaiti-, /apāyati- (imperfect tense A1. /apāyata- ) to go away, withdraw, retire, run away, escape ; to vanish, disappear. View this entry on the original dictionary page scan.
apehi(Imper. 2. sg. in compound) means"excluding, expelling." View this entry on the original dictionary page scan.
apehipraghasā(scilicet kriyā-) f. a ceremony from which gluttons are excluded, (gaRa mayūravyaṃsakādi-.) View this entry on the original dictionary page scan.
apehipraghasāetc. See ape-. View this entry on the original dictionary page scan.
apehivāṇijā(scilicet kriyā-) f. a ceremony from which merchants are excluded View this entry on the original dictionary page scan.
apehivātā(scilicet latā-) f. "useful in expelling wind", the plant Poederia Foetida View this entry on the original dictionary page scan.
apej( īj-), /apejate- to drive away View this entry on the original dictionary page scan.
apekṣ( īkṣ-) to look away, to look round ; to have some design ; to have regard to, to respect ; to look for, wait for ; to expect, hope ; to require, have an eye to ; with na-, not to like View this entry on the original dictionary page scan.
apekṣāf. looking round or about, consideration of, reference, regard to (in compound;rarely locative case) View this entry on the original dictionary page scan.
apekṣāf. dependence on, connection of cause with effect or of individual with species View this entry on the original dictionary page scan.
apekṣāf. looking for, expectation, hope, need, requirement View this entry on the original dictionary page scan.
apekṣābuddhif. (in vaiśeṣika- philosophy) a mental process, the faculty of arranging and methodizing, clearness of understanding. View this entry on the original dictionary page scan.
apekṣaṇan. equals apekṣā- View this entry on the original dictionary page scan.
apekṣaṇamfn. not looking at (compound), (conjectural). View this entry on the original dictionary page scan.
apekṣaṇīyamfn. to be considered or regarded View this entry on the original dictionary page scan.
apekṣaṇīyamfn. to be looked for or expected
apekṣaṇīyamfn. to be wished or required View this entry on the original dictionary page scan.
apekṣaṇīyamfn. desirable. View this entry on the original dictionary page scan.
apekṣayāind. with regard to (in compound) View this entry on the original dictionary page scan.
āpekṣikamfn. (fr. apekṣā-), relative, having relation or reference to View this entry on the original dictionary page scan.
āpekṣikatvan. the state of being relative View this entry on the original dictionary page scan.
apekṣinmfn. considering, respecting, regardful of, looking to (in compound;rarely genitive case) View this entry on the original dictionary page scan.
apekṣinmfn. looking for, expecting, requiring View this entry on the original dictionary page scan.
apekṣinmfn. depending on. View this entry on the original dictionary page scan.
apekṣitamfn. considered View this entry on the original dictionary page scan.
apekṣitamfn. referred to View this entry on the original dictionary page scan.
apekṣitamfn. looked for, expected View this entry on the original dictionary page scan.
apekṣitamfn. wished, required. View this entry on the original dictionary page scan.
apekṣitāf. expectation View this entry on the original dictionary page scan.
apekṣitavya equals apekṣaṇīya- q.v View this entry on the original dictionary page scan.
apekṣya equals apekṣaṇīya-. 2. View this entry on the original dictionary page scan.
apekṣya ind.p. with regard or reference to. View this entry on the original dictionary page scan.
apendramfn. without indra- View this entry on the original dictionary page scan.
ape( īṣ-), (Aorist 3. sg. /apa /aiyeḥ-) to withdraw from (ablative) View this entry on the original dictionary page scan.
apeśalamfn. unclever. View this entry on the original dictionary page scan.
āpeṣam ind.p. having pressed or rubbed against, touching View this entry on the original dictionary page scan.
āpeṣamSee under ā-piṣ-. View this entry on the original dictionary page scan.
apeśasmfn. shapeless View this entry on the original dictionary page scan.
apetamfn. escaped, departed, gone, having retired from, free from (ablative or in compound) View this entry on the original dictionary page scan.
apetabhimfn. one whose fear is gone View this entry on the original dictionary page scan.
apetaprajananamfn. one who has lost his generative energy, View this entry on the original dictionary page scan.
apetaprāṇamfn. lifeless, View this entry on the original dictionary page scan.
apetarākṣasīf. the plant Ocimum Sanctum (also apreta-r-). View this entry on the original dictionary page scan.
apeyamf(ā-)n. unfit for drinking, not to be drunk View this entry on the original dictionary page scan.
āpeyam. plural (fr. 1. ap-?) , a particular class of gods. View this entry on the original dictionary page scan.
āpeyaand View this entry on the original dictionary page scan.
āpeyatvan. the being of this class (see āpyeya-.) View this entry on the original dictionary page scan.
aphalaprepsumfn. one who desires no recompense View this entry on the original dictionary page scan.
aphenamf(ā-)n. frothless View this entry on the original dictionary page scan.
aphenan. opium View this entry on the original dictionary page scan.
aphenilamfn. frothless, View this entry on the original dictionary page scan.
apihve(1. sg. A1. -huve-) to call addition to (or besides) View this entry on the original dictionary page scan.
apinetṛm. one who leads towards (genitive case) View this entry on the original dictionary page scan.
apitṛdevatya(/a-pitṛ--) mfn. not having the Manes as deities View this entry on the original dictionary page scan.
apivye(1. plural P. -vyayūmasi-) to cover View this entry on the original dictionary page scan.
aplaveśamfn. unable to swim. View this entry on the original dictionary page scan.
āpodevatamfn. having the water as deity View this entry on the original dictionary page scan.
āpodevata āpo-maya-, etc. See . View this entry on the original dictionary page scan.
āpodevatyamfn. idem or 'mfn. having the water as deity ' View this entry on the original dictionary page scan.
apracchedyamfn. inscrutable View this entry on the original dictionary page scan.
apracetasmfn. deficient in understanding, foolish View this entry on the original dictionary page scan.
apracetitamfn. not having been perceived View this entry on the original dictionary page scan.
aprādeśikamfn. not pointing to or suggestive of (the etymol. of a word) View this entry on the original dictionary page scan.
apraketamfn. indiscriminate, unrecognizable View this entry on the original dictionary page scan.
aprameyamfn. immeasurable, unlimited, unfathomable View this entry on the original dictionary page scan.
aprameyamfn. not to be proved. View this entry on the original dictionary page scan.
aprameyānubhāvamfn. of unlimited might. View this entry on the original dictionary page scan.
aprameyātmanm. "of inscrutable spirit", Name of śiva-. View this entry on the original dictionary page scan.
apratihatanetram. "whose eyes are unimpeded", Name of a deity View this entry on the original dictionary page scan.
apratikareṇaind. without recompense (see a-prat/ā-.) View this entry on the original dictionary page scan.
apratimeyamfn. idem or 'mfn. incomparable ' View this entry on the original dictionary page scan.
apratiṣedham. "non-prohibition", non-negation, an invalid objection View this entry on the original dictionary page scan.
apratiṣekyamfn. (a ceremony) at which there is no pouring upon View this entry on the original dictionary page scan.
aprattadevatamfn. not yet offered to a deity, View this entry on the original dictionary page scan.
apratyākhyeyamfn. not to be contradicted, undeniable. View this entry on the original dictionary page scan.
apravedamf(ā-)n. (said of heaven and earth, together with /a-trasnu-), not insidious View this entry on the original dictionary page scan.
aprayāsenaind. easily View this entry on the original dictionary page scan.
apremann. dislike, aversion View this entry on the original dictionary page scan.
apremanmfn. unfriendly View this entry on the original dictionary page scan.
apretamfn. not gone away View this entry on the original dictionary page scan.
apretarākṣasīf. a plant (also called preta-rākṣasī-,or apeta-rākṣasī- q.v) View this entry on the original dictionary page scan.
apṛthagvivekyamfn. not to be distinguished, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
āptopadeśam. a credible or trusty instruction View this entry on the original dictionary page scan.
apūrveṇaind. never before View this entry on the original dictionary page scan.
apuvāyate see apvā- (parasmE-pada 59, column 3). View this entry on the original dictionary page scan.
āpyeyam. plural (fr. 1. ap-?) , Name of a class of deities (equals āpeya-) View this entry on the original dictionary page scan.
āpyeyatvan. equals āpeya-tva- View this entry on the original dictionary page scan.
arāgadveṣa(in compound) View this entry on the original dictionary page scan.
arāgadveṣatasind. not from psssion or anger, View this entry on the original dictionary page scan.
arāgadveṣinmfn. neither loving nor hating, View this entry on the original dictionary page scan.
arālakeśīf. a woman with curled hair, View this entry on the original dictionary page scan.
ārambaṇacchedanam. a particular samādhi-, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
aranemim. Name of brahmadatta- (king of kośala-) View this entry on the original dictionary page scan.
āraṇeyamfn. (fr. araṇi- q.v), made of or relating to the araṇi-s or two pieces of wood by the attrition of which sacred fire is kindled View this entry on the original dictionary page scan.
āraṇeyam. Name of śuka- (as born from araṇī-) View this entry on the original dictionary page scan.
āraṇeyan. a box for araṇi-s View this entry on the original dictionary page scan.
āraṇeyaparvann. Name of the last section (adhyāya-s 311-314) of the third book of the mahā-bhārata-. View this entry on the original dictionary page scan.
araṇīketum. the plant Premna Spinosa View this entry on the original dictionary page scan.
araṇyaketum. Name of a plant (see araṇī-ketu-.) View this entry on the original dictionary page scan.
araṇye(in compound for /araṇyn-chiefly used for figurative expressions or as names ) . View this entry on the original dictionary page scan.
araṇyegeyaetc. See sub voce, i.e. the word in the Sanskrit order araṇye-. View this entry on the original dictionary page scan.
araṇyegeyamfn. to be sung in the forest View this entry on the original dictionary page scan.
araṇyenūcyam. "to be recited in a forest", Name of an oblation (so called because of its being offered with a verse which is to be recited in a forest) View this entry on the original dictionary page scan.
araṇyenuvākyamfn. to be recited in the forest View this entry on the original dictionary page scan.
araṇyetilakam. plural "wild, sesamum growing in a forest and containing no oil", anything which disappoints expectation View this entry on the original dictionary page scan.
arareind. a vocative particle (expressing haste) View this entry on the original dictionary page scan.
arcinetrādhipatim. Name of a yakṣa- View this entry on the original dictionary page scan.
ardhabhedam. hemiplegia (see ardita- n.) , (see ava-bhedaka-.) View this entry on the original dictionary page scan.
ardhadevam. demi-god View this entry on the original dictionary page scan.
ardhadevatāf. a half-deity, demigod, View this entry on the original dictionary page scan.
ardhādhve locative case ind. equals ardha-mārge- above View this entry on the original dictionary page scan.
ardhaketum. Name of a rudra- View this entry on the original dictionary page scan.
ardhakṣetran. plural Name of particular lunar mansions View this entry on the original dictionary page scan.
ardhamārge locative case ind. half-way, mid-way View this entry on the original dictionary page scan.
ardhanārīnāṭeśvaram. śiva-., View this entry on the original dictionary page scan.
ardhapatheind. locative case midway View this entry on the original dictionary page scan.
ardhaśeṣamfn. half left (see ardhāvaśeṣa-below) . View this entry on the original dictionary page scan.
ardhāvabheda m. equals ardhabheda- above View this entry on the original dictionary page scan.
ardhāvabhedamfn. dividing into halves. View this entry on the original dictionary page scan.
ardhāvabhedakam. equals ardhabheda- above View this entry on the original dictionary page scan.
ardhāvabhedakamfn. dividing into halves. View this entry on the original dictionary page scan.
ardhāvaśeṣamfn. equals ardha-śeṣa- above View this entry on the original dictionary page scan.
ardheind. in the middle, (ardha-in compound with a substantive means"the half part of anything"[ see ],with an adjective (cf. mfn.) or past Passive voice p.[ see ]"half";also with an adjective (cf. mfn.) indicating measure[ see ];a peculiar kind of compound is formed with ordinals[ see commentator or commentary ] exempli gratia, 'for example' ardha-tṛtīya-,containing a half for its third, id est two and a half; ardha-caturtha-,having a half for its fourth, three and a half.) View this entry on the original dictionary page scan.
ardheḍāf. "half the iḍā- ", the syllable up- inserted in some sāman- verses View this entry on the original dictionary page scan.
ardhendramfn. that of which a half belongs to indra- View this entry on the original dictionary page scan.
ardhendum. (-ardha-candra-above) a half moon or crescent View this entry on the original dictionary page scan.
ardhendum. the semicircular impression of a finger nail View this entry on the original dictionary page scan.
ardhendum. an arrow with a crescent-shaped head View this entry on the original dictionary page scan.
ardhendum. the hand expanded in a semicircular from like a claw View this entry on the original dictionary page scan.
ardhendum. the constellation also called ardhacandra- (q.v) View this entry on the original dictionary page scan.
ardhendumaulim. "whose diadem is a half-moon", śiva- View this entry on the original dictionary page scan.
ardheṣṭakāf. half a brick, View this entry on the original dictionary page scan.
ārdrānulepanamfn. wet with unguents, View this entry on the original dictionary page scan.
areind. interjection of calling (see arare-, arere-,and re-). View this entry on the original dictionary page scan.
āreSee ss.vv. View this entry on the original dictionary page scan.
āreind. (locative case;See ār/āt-) far, far from, outside, without View this entry on the original dictionary page scan.
āreind. near View this entry on the original dictionary page scan.
āreaghamfn. having evil far removed View this entry on the original dictionary page scan.
āreavadyamfn. one from whom blame or insult is far removed View this entry on the original dictionary page scan.
ārecinmfn. emptying. View this entry on the original dictionary page scan.
ārecitamfn. emptied View this entry on the original dictionary page scan.
ārecitamfn. contracted, mixed. View this entry on the original dictionary page scan.
ārecitabhrūmfn. having contracted eye-brows View this entry on the original dictionary page scan.
ārehaṇan. licking, kissing View this entry on the original dictionary page scan.
ārehaṇaSee ā-rih-. View this entry on the original dictionary page scan.
ārekam. emptying View this entry on the original dictionary page scan.
ārekam. doubt
areṇumfn. not dusty (said of the gods and their cars and roads) View this entry on the original dictionary page scan.
areṇumfn. not earthly, celestial View this entry on the original dictionary page scan.
areṇum. plural (/avas-) the gods View this entry on the original dictionary page scan.
arepamfn. = a-- repas-, View this entry on the original dictionary page scan.
arepasmfn. spotless View this entry on the original dictionary page scan.
arephamfn. without the letter r. View this entry on the original dictionary page scan.
arephaSee a-riphita-. View this entry on the original dictionary page scan.
arephajātamfn. idem or 'mfn. without the letter r.' View this entry on the original dictionary page scan.
arephavatmfn. idem or 'mfn. idem or 'mfn. without the letter r.' ' View this entry on the original dictionary page scan.
arephinmfn. equals a-riphita- View this entry on the original dictionary page scan.
arereind. (probably are 're-,repetition of are-, q.v), interjection of calling to inferiors or of calling angrily View this entry on the original dictionary page scan.
āreśatrumfn. one whose enemies are driven far away View this entry on the original dictionary page scan.
aretasmfn. not receiving seed View this entry on the original dictionary page scan.
aretaskamfn. seedless View this entry on the original dictionary page scan.
arghāpacayenaind. instrumental case cheaper View this entry on the original dictionary page scan.
argheśvaram. Name of śiva-, (see arghīśa-) View this entry on the original dictionary page scan.
arimedam. a fetid Mimosa, Vachellia Farnesiana View this entry on the original dictionary page scan.
arimedam. plural Name of a people, View this entry on the original dictionary page scan.
arimedakam. Name of an insect View this entry on the original dictionary page scan.
arimejayam. "shaking enemies", Name of a Naga priest View this entry on the original dictionary page scan.
arimejayam. of a son of śvaphalka- View this entry on the original dictionary page scan.
arimejayam. of kuru- View this entry on the original dictionary page scan.
ariṣṭanemimfn. the felly of whose wheel is unhurt (Name of tārkṣya-) View this entry on the original dictionary page scan.
ariṣṭanemi(is-) m. Name of a man (named together with tārkṣya-) , (said to be the author of the hymn ) View this entry on the original dictionary page scan.
ariṣṭanemim. Name of various princes View this entry on the original dictionary page scan.
ariṣṭanemim. of a gandharva- View this entry on the original dictionary page scan.
ariṣṭanemim. of the twenty-second of the twenty four jaina- tīrthaṃkara-s of the present avasarpiṇī-. View this entry on the original dictionary page scan.
ariṣṭanemi Name (also title or epithet) of viṣṇu-, View this entry on the original dictionary page scan.
ariṣṭaneminm. Name of a brother of gauḍa- (= aruṇa- commentator or commentary) View this entry on the original dictionary page scan.
ariṣṭaneminm. of a muni- View this entry on the original dictionary page scan.
ariṣṭaneminm. of the twenty-second tīrthaṃkara- (See nemi-) View this entry on the original dictionary page scan.
arjuneśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
ārjuneyam. (fr. ārjuni-), Name of kutsa- View this entry on the original dictionary page scan.
arkakṣetran. "the field of the sun", Name of a sacred place in Orissa. View this entry on the original dictionary page scan.
arkanetramfn. twelve-eyed, View this entry on the original dictionary page scan.
arkaretojam. "son of sūrya-", revanta- View this entry on the original dictionary page scan.
arkāśvamedham. dual number ([ ]) or dh/au- ([ ]), the arka- ceremony and the aśvamedha- sacrifice View this entry on the original dictionary page scan.
arkāśvamedhavatmfn. containing the two View this entry on the original dictionary page scan.
arkāśvamedhinmfn. performing the two View this entry on the original dictionary page scan.
arkavedham. Name of a plant View this entry on the original dictionary page scan.
arkendusaṃgamam. the instant of conjunction of the sun and moon. View this entry on the original dictionary page scan.
arkeṣṭan. yellow sandal-wood, . View this entry on the original dictionary page scan.
arṇavanemif. "having the sea as a felly round itself", the earth, View this entry on the original dictionary page scan.
ārṣeyamf(ī-)n. relating or belonging to or derived from a ṛṣi-, of sacred descent
ārṣeyamf(ī-)n. venerable, respectable etc. View this entry on the original dictionary page scan.
ārṣeyam. Name of agni- View this entry on the original dictionary page scan.
ārṣeyan. sacred descent View this entry on the original dictionary page scan.
ārṣeyan. Name of several sāman-s. View this entry on the original dictionary page scan.
ārṣeyabrāhmaṇan. Name (also title or epithet) of a brāhmaṇa- (belouging to the sāmaveda- and originally a mere list of names of sāman-s) View this entry on the original dictionary page scan.
ārṣeyarāmāyaṇa n. Name (also title or epithet) of the yoga-vāsiṣṭha- View this entry on the original dictionary page scan.
ārṣeyavatmfn. connected with sacred descent View this entry on the original dictionary page scan.
ārṣiṇeśvam. Name of a king View this entry on the original dictionary page scan.
ārṣṭiṣeṇam. (fr. ṛṣṭi-ṣeṇa- ), a descendant of ṛṣṭi-ṣeṇa-, Name of devāpi- View this entry on the original dictionary page scan.
ārṣṭiṣeṇam. Name of a man commentator or commentary on View this entry on the original dictionary page scan.
arthabhedam. distinction or difference of meaning. View this entry on the original dictionary page scan.
arthaleśam. a little wealth. View this entry on the original dictionary page scan.
arthāntarākṣepam. "throwing in another fact" id est establishing any disagreement with a statement by introducing a similar case (showing the impossibility of that statement), View this entry on the original dictionary page scan.
arthāpekṣamfn. pursuing (worldly) objects, View this entry on the original dictionary page scan.
arthasaṃdeham. a dubious or critical matter, (varia lectio) View this entry on the original dictionary page scan.
arthaśleṣam. a pun or quibble based upon the sense (not upon the form of words, as opp. to śabda-- śl-), Sch. View this entry on the original dictionary page scan.
arthaviśeṣaṇan. (probably) specification of any matter, View this entry on the original dictionary page scan.
arthe locative case ind. with 1. kṛ- (gaRa sakṣād-ādi- q.v) View this entry on the original dictionary page scan.
arthegamfn. following one's business or vocation, View this entry on the original dictionary page scan.
arthef. idem or 'f. desire of wealth ' View this entry on the original dictionary page scan.
arthepsutāf. desire of wealth View this entry on the original dictionary page scan.
arthetmfn. ( i-), active, hasty (said of running waters) View this entry on the original dictionary page scan.
arthopakṣepakamfn. "indicating or suggesting a matter (so as to facilitate the understanding of the plot)", a N. applied to the parts of a drama called viṣkambha-, cūlikā-, aṅkāsya-, aṅkāvatāra-, and praveśaka-, qq.vv. View this entry on the original dictionary page scan.
arthopakṣepaṇan. suggesting or indicating a matter View this entry on the original dictionary page scan.
ārtvef. a woman during her courses View this entry on the original dictionary page scan.
aruṇaketubrāhmaṇan. the brāhmaṇa- of the aruṇāḥ- ketavaḥ- (See aruṇās-above) , View this entry on the original dictionary page scan.
āruṇaketukamfn. belonging to the aruṇāḥ- ketavaḥ- (See under aruṇa-) View this entry on the original dictionary page scan.
aruṇanetram. "red-eyed", a pigeon View this entry on the original dictionary page scan.
āruṇeyamfn. idem or 'mfn. belonging to āruṇi-.' View this entry on the original dictionary page scan.
āruṇeyam. Name of śvetaketu- as āruṇi-'s son View this entry on the original dictionary page scan.
āruṇeyapadan. Name of an āraṇyaka-. View this entry on the original dictionary page scan.
arvāke locative case ind. (opposed to parāk/e- q.v) in the proximity, near View this entry on the original dictionary page scan.
āryacetasmfn. noble-minded View this entry on the original dictionary page scan.
āryadeśam. a region inhabited by Aryans or followers of the Aryan laws View this entry on the original dictionary page scan.
āryadeśyamfn. belonging to or originated from such a region View this entry on the original dictionary page scan.
āryadevam. Name of a pupil of nāgārjuna-. View this entry on the original dictionary page scan.
aryamadef. "having aryaman- for its deity", Name of the mansion uttaraphalgunī- View this entry on the original dictionary page scan.
aryaśvetam. (varia lectio ārya-sv-), Name of a man, (gaRa śivādi- q.v) View this entry on the original dictionary page scan.
āryaveśamfn. dressed like an Aryan or honest person. View this entry on the original dictionary page scan.
asadadhyetṛm. a Brahman who reads heterodox works
āsaktacetas mfn. having the mind deeply engaged in or fixed upon (any object), intent on, devoted to, absorbed in. View this entry on the original dictionary page scan.
asamavetamfn. idem or 'mfn. not inherent, not inseparably connected with, accidental ' View this entry on the original dictionary page scan.
asamavetamfn. (plural) not all assembled View this entry on the original dictionary page scan.
asaṃbhedam. non-contact, the being separate View this entry on the original dictionary page scan.
asaṃbhedyamfn. not to be brought into contact View this entry on the original dictionary page scan.
asaṃdheyamfn. not to be made peace with View this entry on the original dictionary page scan.
asaṃdheyamfn. for which no amends can be made, not to be redressed View this entry on the original dictionary page scan.
asaṃdheyatāf. the state of one with whom no peace is to be made, View this entry on the original dictionary page scan.
asameṣum. idem or 'm. idem or 'm. equals -bāṇa- q.v ' ' View this entry on the original dictionary page scan.
asametamfn. "not arrived, absent", missing View this entry on the original dictionary page scan.
asaṃketitamfn. one with whom nothing has been concerted View this entry on the original dictionary page scan.
asaṃketitatvan. the not being settled by agreement View this entry on the original dictionary page scan.
asaṃkhyeyamfn. innumerable etc. View this entry on the original dictionary page scan.
asaṃkhyeyam. a Name of śiva- View this entry on the original dictionary page scan.
asaṃkhyeyan. an innumerable multitude View this entry on the original dictionary page scan.
asaṃkhyeyam. an exceedingly large number View this entry on the original dictionary page scan.
asaṃkhyeyaguṇamfn. innumerably multiplied, unnumbered. View this entry on the original dictionary page scan.
asaṃkhyeyatāf. innumerableness View this entry on the original dictionary page scan.
asaṃlulitakeśatāf. having the hair not tangled (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
asaṃrodhenaind. instrumental case without injury to (with genitive case) View this entry on the original dictionary page scan.
asaṃśleṣam. non-contact commentator or commentary on View this entry on the original dictionary page scan.
asaṃśravaṇeind. equals a-saṃśrave- View this entry on the original dictionary page scan.
asaṃvṛttavidheya(in rhetoric) the insertion into a compound of a word which ought to be independent, View this entry on the original dictionary page scan.
aśanāyāpipāse(aśanāy/ā--) f. Nominal verb dual number hunger and thirst View this entry on the original dictionary page scan.
asaṅgenaind. instrumental case "non-impediment", generally without obstacle View this entry on the original dictionary page scan.
asavyeind. on the right (see apa-savya-.) View this entry on the original dictionary page scan.
asecanamfn. (also ā-sec- q.v) charming, lovely View this entry on the original dictionary page scan.
āsecanan. pouring into, wetting, sprinkling View this entry on the original dictionary page scan.
āsecanan. a reservoir or vessel for fluids View this entry on the original dictionary page scan.
āsecanamfn. equals a-secana- qq.v. View this entry on the original dictionary page scan.
āsecanamfn. (for 1. ā-secana-See ā-sic-.) View this entry on the original dictionary page scan.
asecanaka([ ]) ([ ]) mfn. idem or 'mfn. (also ā-sec- q.v) charming, lovely ' View this entry on the original dictionary page scan.
āsecanakamfn. equals a-secanaka- qq.v. View this entry on the original dictionary page scan.
asecanakadarśanamfn. lovely to see, View this entry on the original dictionary page scan.
āsecanavatmfn. serving for sprinkling View this entry on the original dictionary page scan.
āsecanīf. a small vessel View this entry on the original dictionary page scan.
asecanīya([ ]) mfn. idem or 'mfn. lovely to see, ' View this entry on the original dictionary page scan.
āseddhṛm. one who confines, imprisons View this entry on the original dictionary page scan.
āseddhṛetc. See ā-sidh-. View this entry on the original dictionary page scan.
āsedham. arrest, custody, legal restraint of four kinds, (kālāsedha-,limitation of time; sthānāsedha-,confinement to a place; pravāsāsedha-,prohibition against removal or departure; karmāsedha-,restriction from employment) View this entry on the original dictionary page scan.
āsekam. wetting, sprinkling, watering View this entry on the original dictionary page scan.
āśekuṭinm. Name of a mountain View this entry on the original dictionary page scan.
āsekyaSee sub voce, i.e. the word in the Sanskrit order 1.
āsekyam. (fr. a-seka-), impotent, a man of slight generative power View this entry on the original dictionary page scan.
asenya(4) mfn. not striking or wounding, not hurting (as words) View this entry on the original dictionary page scan.
eṣamf(ā-)n. without remainder, entire, perfect, all View this entry on the original dictionary page scan.
eṣam. non-remainder View this entry on the original dictionary page scan.
eṣamind. entirely, wholly View this entry on the original dictionary page scan.
eṣasmfn. without descendants View this entry on the original dictionary page scan.
eṣasāmrājyam. "possessed of complete sovereignty", Name of śiva- View this entry on the original dictionary page scan.
eṣatāf. totality View this entry on the original dictionary page scan.
eṣatasind. id. View this entry on the original dictionary page scan.
eṣatvan. idem or 'f. totality ' View this entry on the original dictionary page scan.
eṣayaNom. P. (ind.p. ṣayitvā-) to finish entirely View this entry on the original dictionary page scan.
eeṇaind. idem or 'ind. entirely, wholly ' View this entry on the original dictionary page scan.
eṣitamfn. completely annihilated, View this entry on the original dictionary page scan.
āsev(rarely P.) A1. -sevati-, -te-, to frequent ; to abide in, inhabit, dwell on ; to attend to, serve ; to honour ; to take the part of, side with etc. ; to enjoy (sexual intercourse) ; to indulge in, like ; to perform assiduously, practise View this entry on the original dictionary page scan.
evamf(ā-)n. not causing pleasure, pernicious View this entry on the original dictionary page scan.
asef. not following or practising View this entry on the original dictionary page scan.
asef. disregard, inattention. View this entry on the original dictionary page scan.
āsef. idem or 'n. assiduous practice or performance of anything ' View this entry on the original dictionary page scan.
āsevanan. abiding in View this entry on the original dictionary page scan.
āsevanan. assiduous practice or performance of anything View this entry on the original dictionary page scan.
āsevinmfn. frequenting, inhabiting View this entry on the original dictionary page scan.
āsevinmfn. zealously cultivating or performing anything View this entry on the original dictionary page scan.
asevitamfn. neglected, unattended to View this entry on the original dictionary page scan.
asevitamfn. abstained from. View this entry on the original dictionary page scan.
āsevitamfn. frequented View this entry on the original dictionary page scan.
āsevitamfn. practised assiduously. View this entry on the original dictionary page scan.
aseviteśvaradvāramfn. not waiting at the doors of the great View this entry on the original dictionary page scan.
asevyamfn. not to be served or attended to
asevyamfn. not to be visited by (genitive case) View this entry on the original dictionary page scan.
asevyamfn. not to be used or practised, not to be eaten, drunk, etc. View this entry on the original dictionary page scan.
āsevyamfn. to be frequented or visited, View this entry on the original dictionary page scan.
asidhenuf. a (small) knife View this entry on the original dictionary page scan.
asidhenukāf. idem or 'f. a (small) knife '
asihetim. a swordsman or soldier armed with a sword View this entry on the original dictionary page scan.
asimedam. the fetid Mimosa (Vachellia Farnesiana) (see ahi-māra-,etc.) View this entry on the original dictionary page scan.
āśīrgeyan. song together with benediction View this entry on the original dictionary page scan.
āśīrvacanākṣepam. a deprecatory benediction ([ exempli gratia, 'for example' if a wife wishes "a happy journey"to her departing husband though deprecating his departure]) View this entry on the original dictionary page scan.
asitābhraśekharam. Name of a buddha- View this entry on the original dictionary page scan.
asitakeśāntamfn. having black locks View this entry on the original dictionary page scan.
asitekṣaṇamfn. blackeyed, View this entry on the original dictionary page scan.
aśleṣāf. sg. plural (equals aśleṣ/ā- q.v) Name of the seventh (in later times the ninth) lunar mansion (containing five stars) View this entry on the original dictionary page scan.
āśleṣam. intimate connection, contact View this entry on the original dictionary page scan.
āśleṣam. slight contact View this entry on the original dictionary page scan.
āśleṣam. embracing, embrace View this entry on the original dictionary page scan.
āśleṣam. intwining etc. View this entry on the original dictionary page scan.
āśleṣam. adherence, clinging to View this entry on the original dictionary page scan.
āśleṣāf. and (/ās-) f. plural Name of the seventh nakṣatra- View this entry on the original dictionary page scan.
aśleṣābhava m. the ketu- (or descending node) View this entry on the original dictionary page scan.
aśleṣābhūm. the ketu- (or descending node) View this entry on the original dictionary page scan.
āśleṣaṇan. adherence, hanging on View this entry on the original dictionary page scan.
aśleṣāvidhim. Name (also title or epithet) of a Paris3. of View this entry on the original dictionary page scan.
āśleṣitamfn. embraced View this entry on the original dictionary page scan.
aśmabheda([ ]) ([ ]) m. idem or 'm. the plant Coleus Scutellarioides (supposed to dissolve stone in the bladder) ' View this entry on the original dictionary page scan.
aśmabhedaka([ ]) m. idem or '([ ]) ([ ]) m. idem or 'm. the plant Coleus Scutellarioides (supposed to dissolve stone in the bladder) ' ' View this entry on the original dictionary page scan.
asmaddevatyamfn. having us as deities View this entry on the original dictionary page scan.
aśmaketum. Name of a plant View this entry on the original dictionary page scan.
aśmarībhedanaa lithontriptic View this entry on the original dictionary page scan.
asmatpreṣita(asm/at--) mfn. sent or driven towards us View this entry on the original dictionary page scan.
asmehitif. errand or message for us View this entry on the original dictionary page scan.
asmehitiSee asma-. View this entry on the original dictionary page scan.
asmeramf(ā-)n. not bashful or confused, confiding
asmeramf(ā-)n. not smiling, not merry View this entry on the original dictionary page scan.
āśmeyam. a descendant of aśman- View this entry on the original dictionary page scan.
asnehamfn. without unctuousness View this entry on the original dictionary page scan.
asnehamfn. without affection, unkind View this entry on the original dictionary page scan.
asneham. want of affection View this entry on the original dictionary page scan.
asnehanam. "without affection", a Name of śiva- View this entry on the original dictionary page scan.
asnehavatmfn. without affection (varia lectio) View this entry on the original dictionary page scan.
asnehyamfn. not to be made unctuous View this entry on the original dictionary page scan.
āsneyamf(ī-)n. (fr. asan-), bloody, being in blood View this entry on the original dictionary page scan.
aśokavegam. equals -datta- q.v View this entry on the original dictionary page scan.
aśokeśvaram. Name (also title or epithet) of two temples built by aśoka-, View this entry on the original dictionary page scan.
aśokeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
āśokeyamf(ī-), a descendant of āśokā- View this entry on the original dictionary page scan.
āśokeyamfn. (fr. a-śoka- gaRa sakhy-ādi- ), belonging to or coming from the aśoka- tree. View this entry on the original dictionary page scan.
aśraddheyamfn. incredible View this entry on the original dictionary page scan.
aśrāddheyamfn. not fit for funeral rites View this entry on the original dictionary page scan.
aśrameṇaind. instrumental case without fatigue View this entry on the original dictionary page scan.
āsrāvabheṣajan. a medicament, medicine View this entry on the original dictionary page scan.
asredhatmfn. (pr. p. P.) idem or 'mfn. (Aorist parasmE-pada A1.) idem or 'mfn. not failing, not erring ' ' View this entry on the original dictionary page scan.
asremanmfn. (said of agni-) faultless, perfect View this entry on the original dictionary page scan.
āśreṣam. ( śriṣ-= śliṣ-See below) , one who embraces View this entry on the original dictionary page scan.
āśreṣam. Name of an evil spirit or goblin View this entry on the original dictionary page scan.
āśreṣāf. equals āśleṣ/ā- q.v View this entry on the original dictionary page scan.
aśreṣmanmfn. (2. śriṣ-), without bands View this entry on the original dictionary page scan.
aśreṣṭhamfn. not the best, inferior View this entry on the original dictionary page scan.
āśretṛmfn. leaning on, resorting to (genitive case), View this entry on the original dictionary page scan.
aśreyasmfn. (Comparative degree) not the better, inferior View this entry on the original dictionary page scan.
aśreyasn. (as-) mischief. View this entry on the original dictionary page scan.
aśreyaskamfn. fatal, noxious View this entry on the original dictionary page scan.
aśruleśam. a tear-drop, View this entry on the original dictionary page scan.
aśrunetramfn. with tears in the eyes, View this entry on the original dictionary page scan.
aṣṭamadeśam. intermediate region (= antarā-- diś-), View this entry on the original dictionary page scan.
astameṣyatSee /astam- before sub voce, i.e. the word in the Sanskrit order /asta-. View this entry on the original dictionary page scan.
astamīke locative case ind. (fr. 2. añc- see samīk/a-,etc.) at home View this entry on the original dictionary page scan.
astamiteind. locative case after sunset View this entry on the original dictionary page scan.
aṣṭāṅgamārgadeśikam. "guide of the eightfold path", Name (also title or epithet) of a buddha-, View this entry on the original dictionary page scan.
aṣṭāṅgopetamfn. (said of excellent water), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
astenam. not a thief View this entry on the original dictionary page scan.
astenamāninmfn. not believing one's self to be a thief. View this entry on the original dictionary page scan.
asteyan. not stealing View this entry on the original dictionary page scan.
āsteyamfn. () belonging to something existent. View this entry on the original dictionary page scan.
asthāneind. ([ etc.]) or in compound asthāna-- ([ ]), in a wrong place View this entry on the original dictionary page scan.
āstheyamfn. to be approached View this entry on the original dictionary page scan.
āstheyamfn. to be seized View this entry on the original dictionary page scan.
āstheyamfn. to be applied or practised View this entry on the original dictionary page scan.
āstheyamfn. to be regarded as View this entry on the original dictionary page scan.
āstheyamfn. to be acknowledged or adopted (as an opinion) View this entry on the original dictionary page scan.
astheyasmfn. (Comparative degree) not firmer View this entry on the original dictionary page scan.
astheyasmfn. not firm View this entry on the original dictionary page scan.
asthibhedam. fracturing or wounding a bone View this entry on the original dictionary page scan.
asthibhedam. a sort of bone. View this entry on the original dictionary page scan.
asthiketum. Name of a ketu- View this entry on the original dictionary page scan.
asthiśeṣamfn. having only bones left, View this entry on the original dictionary page scan.
asthiśeṣatā(f.) View this entry on the original dictionary page scan.
asthisneha m. marrow View this entry on the original dictionary page scan.
asthisnehakam. marrow View this entry on the original dictionary page scan.
asthitejasn. marrow View this entry on the original dictionary page scan.
astrakṣepakamfn. shooting arrows View this entry on the original dictionary page scan.
astravedam. the science of archery, View this entry on the original dictionary page scan.
āśuhemanm. urged to fast course, running on quickly View this entry on the original dictionary page scan.
āśuhemanm. inciting his horses (Name of agni-, especially when regarded as apāṃ-napāt-) View this entry on the original dictionary page scan.
āśuheṣasmfn. having neighing horses View this entry on the original dictionary page scan.
āśuheṣasmfn. having quick horses or quickly praised ([ ]) View this entry on the original dictionary page scan.
āśuheṣasmfn. Name of the aśvin-s View this entry on the original dictionary page scan.
asūreind. locative case in the night View this entry on the original dictionary page scan.
asurejyam. equals asura-guru- q.v View this entry on the original dictionary page scan.
asurendram. lord of the asura-s View this entry on the original dictionary page scan.
āśusaṃdheyamfn. easy to be joined together or reconciled View this entry on the original dictionary page scan.
āśuṣeṇamfn. having swift arrows View this entry on the original dictionary page scan.
aśvadevam. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
aśvājāneyam. a h belonging to a cakra-vartin-, View this entry on the original dictionary page scan.
aśvakeśam. plural Name of a people View this entry on the original dictionary page scan.
aśvamedham. the horse-sacrifice (a celebrated ceremony, the antiquity of which reaches back to the Vedic period; the hymns [= ], referring to it, are however of comparatively late origin; in later times its efficacy was so exaggerated, that a hundred such sacrifices entitled the sacrificer to displace indra- from the dominion of svarga-; kings who engaged in it spent enormous sums in gifts to the Brahmans; it is said that the horse was sometimes not immolated, but kept bound during the ceremony) etc., (see arkāśvamedh/a-) View this entry on the original dictionary page scan.
aśvamedha(/aśva--) m. Name of a descendant of bharata- View this entry on the original dictionary page scan.
āśvamedham. a descendant of aśva-medha- View this entry on the original dictionary page scan.
aśvamedhadattam. Name of a king View this entry on the original dictionary page scan.
aśvamedhajam. Name of a king View this entry on the original dictionary page scan.
aśvamedhakam. (equals aśvamedha-ja-above) Name of a king View this entry on the original dictionary page scan.
aśvamedhakāṇḍan. (aśvamedha-) Name of (treating of the aśvamedha-) View this entry on the original dictionary page scan.
aśvamedhatvan. the state of an aśva-medha- View this entry on the original dictionary page scan.
aśvamedhavatmfn. receiving an aśva-medha- View this entry on the original dictionary page scan.
aśvamedhavatind. as with the aśva-medha- View this entry on the original dictionary page scan.
aśvamedhayājinm. engaged in an aśva-medha- View this entry on the original dictionary page scan.
aśvamedheśvaram. Name of a king View this entry on the original dictionary page scan.
aśvamedhikamfn. relating to the aśvamedha- (see /āśvamedhika-) View this entry on the original dictionary page scan.
aśvamedhikam. a horse fit for the aśva-medha- View this entry on the original dictionary page scan.
āśvamedhikamfn. (fr. idem or 'm. a descendant of aśva-medha- '), belonging to a horse-sacrifice View this entry on the original dictionary page scan.
āśvamedhikamfn. (āśva-medhi-kaṃ parva-is the Name of the fourteenth book of the mahā-bhārata-.) View this entry on the original dictionary page scan.
āśvamedhika View this entry on the original dictionary page scan.
āśvamedhikī feminine, View this entry on the original dictionary page scan.
aśvamedhinmfn. engaged in an aśva-medha- View this entry on the original dictionary page scan.
aśvamedhīyam. equals -medhika- (q.v) m. View this entry on the original dictionary page scan.
aśvapeja m. Name of a man View this entry on the original dictionary page scan.
āśvapejinm. followers or pupils of āśva-pejin- View this entry on the original dictionary page scan.
aśvapeśas(/āśva-.) mfn. decorated with horses View this entry on the original dictionary page scan.
aśvapeyam. Name of a man View this entry on the original dictionary page scan.
āśvapeyin m. followers or pupils of āśva-peyin- View this entry on the original dictionary page scan.
aśvasenam. Name of a nāga- View this entry on the original dictionary page scan.
aśvasenam. of a son of kṛṣṇa- View this entry on the original dictionary page scan.
aśvasenam. of the father of the twenty-third arhat- of the present avasarpiṇī- View this entry on the original dictionary page scan.
aśvatthabhedam. the tree Ficus Benjamina. View this entry on the original dictionary page scan.
asvaveśa(/a-sva--) mfn. having no home of one's own View this entry on the original dictionary page scan.
aśvāyurvedam. veterinary science. View this entry on the original dictionary page scan.
asvedamfn. not perspiring View this entry on the original dictionary page scan.
asvedam. suppressed perspiration View this entry on the original dictionary page scan.
asvedanamfn. not perspiring (as feet) View this entry on the original dictionary page scan.
asvedyamfn. where the application of sudorifics is prohibited View this entry on the original dictionary page scan.
aśveṣitamfn. driven by horses View this entry on the original dictionary page scan.
āśveyam. (gaRa śubhrādi- ), a descendant of aśva-. View this entry on the original dictionary page scan.
aśvidevatākamfn. whose divinities are the aśvin-s View this entry on the original dictionary page scan.
āśvineyam. (fr. aśvin-), Name of nakula- View this entry on the original dictionary page scan.
āśvineyam. of saha-deva- View this entry on the original dictionary page scan.
āśvineyam. (fr. aśvinī-), Name of either of the two aśvin-s View this entry on the original dictionary page scan.
asyaheti View this entry on the original dictionary page scan.
asyaheti(See /asyahaitika-.) View this entry on the original dictionary page scan.
āsyopalepam. obstruction of the mouth by phlegm View this entry on the original dictionary page scan.
ataevaind. for this very reason View this entry on the original dictionary page scan.
ataevaind. therefore. View this entry on the original dictionary page scan.
atamerumfn. not languid View this entry on the original dictionary page scan.
atarapaṇyenaind. without paying toll, View this entry on the original dictionary page scan.
atejasn. absence of brightness or vigour View this entry on the original dictionary page scan.
atejasn. dimness, shade, shadow View this entry on the original dictionary page scan.
atejasn. feebleness, dulness, insignificance View this entry on the original dictionary page scan.
atejasmfn. ([ ])not bright, dim, not vigorous. View this entry on the original dictionary page scan.
atejaskamfn. ([ ]) not bright, dim, not vigorous. View this entry on the original dictionary page scan.
atejasvinmfn. not bright, dim, not vigorous. View this entry on the original dictionary page scan.
atejomayamfn. not consisting of light or brightness View this entry on the original dictionary page scan.
atharvavedam. Name of the fourth veda- (See above) . View this entry on the original dictionary page scan.
aticeṣṭto make extraordinary or excessive efforts. View this entry on the original dictionary page scan.
atideśam. transfer, extended application, inference, analogy, overruling influence, assimilation View this entry on the original dictionary page scan.
atideśam. a rule providing for more than the usual rule View this entry on the original dictionary page scan.
atideśam. putting one thing instead of another, substitution View this entry on the original dictionary page scan.
atideśam. rūpātideśa-, such a rule as affecting the form of a word View this entry on the original dictionary page scan.
atideśamfn. overruling, previously stated. View this entry on the original dictionary page scan.
ātideśikamfn. resulting from an atideśa-, or substitution commentator or commentary View this entry on the original dictionary page scan.
atidevam. a superior god View this entry on the original dictionary page scan.
atidevam. surpassing the gods. View this entry on the original dictionary page scan.
atidhenumfn. distinguished for his cows , View this entry on the original dictionary page scan.
atihve(1. sg. A1. -hvaye-), to call over to one's side View this entry on the original dictionary page scan.
atikeśaram. the plant Trapa Bispinosa. View this entry on the original dictionary page scan.
atikrāntaniṣedhamfn. one who has neglected a prohibition. View this entry on the original dictionary page scan.
āṭīmedam. Name of a bird View this entry on the original dictionary page scan.
atimemiṣa(/ati--) mfn. (1. miṣ-), opening the eyes too much, staring View this entry on the original dictionary page scan.
atinedto stream or flow over, foam over View this entry on the original dictionary page scan.
atipaṭīkṣepa varia lectio for a-paṭīkṣepa- m. omitting to remove or non-removal of the theatrical curtain. View this entry on the original dictionary page scan.
atipeśalamfn. very dexterous. View this entry on the original dictionary page scan.
atiprageind. very early View this entry on the original dictionary page scan.
atipraveto add in weaving, weave on an additional piece View this entry on the original dictionary page scan.
atipreṣitan. the time following the praiṣa- ceremony View this entry on the original dictionary page scan.
atirekam. surplus, excess View this entry on the original dictionary page scan.
atirekam. redundancy View this entry on the original dictionary page scan.
atirekam. difference. View this entry on the original dictionary page scan.
atīrekam. ([only once ]) surplus, excess View this entry on the original dictionary page scan.
atīrekam. redundancy View this entry on the original dictionary page scan.
atīrekam. difference. View this entry on the original dictionary page scan.
atīrekaSee ati-ric-. View this entry on the original dictionary page scan.
atirekinmfn. surpassing. View this entry on the original dictionary page scan.
atisaṃdheyamfn. easy to be settled or conciliated. View this entry on the original dictionary page scan.
atisaṃdheyamfn. easy to be conciliated, easy to be settled. View this entry on the original dictionary page scan.
atiśayenaind. eminently, very. View this entry on the original dictionary page scan.
atisenam. Name of a prince. View this entry on the original dictionary page scan.
atiśeṣam. remainder, remnant (especially of time) View this entry on the original dictionary page scan.
atisevto use or enjoy immoderately, to practise excessively ; see ati-sevā- sub voce, i.e. the word in the Sanskrit order ati-. View this entry on the original dictionary page scan.
atisef. excessive addiction (to a habit). View this entry on the original dictionary page scan.
atiśreṣṭhamfn. superior to the best, best of all. View this entry on the original dictionary page scan.
atiśreṣṭhatvan. pre-eminence. View this entry on the original dictionary page scan.
atiśreyasim. a man superior to the most excellent woman. View this entry on the original dictionary page scan.
ātitheyamf(ī- )n. (fr. atithi-), proper for or attentive to a guest, hospitable etc. View this entry on the original dictionary page scan.
ātitheyam. a descendant of atithi-, (gaRa śubhrādi- q.v) View this entry on the original dictionary page scan.
ātitheyan. idem or 'f. hospitality ' View this entry on the original dictionary page scan.
ātithef. hospitality View this entry on the original dictionary page scan.
atithidevamfn. one to whom a guest is as a divinity View this entry on the original dictionary page scan.
atithidveṣam. hatred of guests, inhospitality. View this entry on the original dictionary page scan.
atithisef. attention to a guest. View this entry on the original dictionary page scan.
ātithyeṣṭif. equals ātithyā- before commentator or commentary on View this entry on the original dictionary page scan.
ativelamfn. passing the proper boundary, excessive View this entry on the original dictionary page scan.
ativelamind. excessively. View this entry on the original dictionary page scan.
ativepathum. excessive tremor View this entry on the original dictionary page scan.
ativepathumfn. trembling excessively. View this entry on the original dictionary page scan.
ativepathumatmfn. trembling excessively. View this entry on the original dictionary page scan.
ātmadevatāf. a tutelary deity View this entry on the original dictionary page scan.
ātmakāmeyam. plural Name of a people, (gaRa rājanyādi- q.v) View this entry on the original dictionary page scan.
ātmakāmeyakamfn. inhabited by the ātmakāmeya-s View this entry on the original dictionary page scan.
ātmānapekṣamfn. not regarding one's self, not selfish View this entry on the original dictionary page scan.
ātmane dative case in compound for ātman- View this entry on the original dictionary page scan.
ātmanebhāṣamfn. idem or 'mfn. taking the terminations of the middle voice commentator or commentary ' View this entry on the original dictionary page scan.
ātmanebhāṣāf. equals -pada- q.v View this entry on the original dictionary page scan.
ātmanepadan. "word to one's self", form for one's self id est that form of the verb which implies an action belonging or reverting to self, the terminations of the middle voice View this entry on the original dictionary page scan.
ātmanepadinmfn. taking the terminations of the middle voice commentator or commentary View this entry on the original dictionary page scan.
ātmanivedanan. offering one's self to a deity View this entry on the original dictionary page scan.
ātmārtheind. idem or 'ind. for the sake of one's self ' View this entry on the original dictionary page scan.
ātmasaṃdeham. personal risk View this entry on the original dictionary page scan.
ātmatattvavivekam. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ātmecchāf. desire of (union with) the Universal soul, View this entry on the original dictionary page scan.
ātmeśvaram. master of one's self View this entry on the original dictionary page scan.
ātmeyam. plural a class of divinities also called ātmy/a- (and named together with the āpya-) View this entry on the original dictionary page scan.
ātreyam. ( commentator or commentary) a descendant of atri- View this entry on the original dictionary page scan.
ātreyam. Name of a physician View this entry on the original dictionary page scan.
ātreyam. a priest who is closely related to the sadasya- (perhaps because this office was generally held by a descendant of atri-) View this entry on the original dictionary page scan.
ātreyam. Name of śiva- View this entry on the original dictionary page scan.
ātreyam. chyle View this entry on the original dictionary page scan.
ātref. (with śākhā-) the śākhā- of the ātreya-s View this entry on the original dictionary page scan.
ātref. a woman who has bathed after her courses View this entry on the original dictionary page scan.
ātref. Name of a river in the north of Bengal (otherwise called Tista) View this entry on the original dictionary page scan.
ātreyan. Name of two sāman-s etc. View this entry on the original dictionary page scan.
ātreyam. plural Name of a tribe View this entry on the original dictionary page scan.
ātreyam. (for atrayas- m. plural of atri- q.v) the descendants of atri- View this entry on the original dictionary page scan.
ātreyāyaṇam. a descendant of an ātreya-, (gaRa aśvādi- q.v) View this entry on the original dictionary page scan.
ātref. a female descendant of atri- View this entry on the original dictionary page scan.
ātreyikāf. a woman in her courses View this entry on the original dictionary page scan.
ātreyīputram. Name of a teacher View this entry on the original dictionary page scan.
ātreyīyamfn. fr. ātreya- View this entry on the original dictionary page scan.
atrinetrabhūm. "produced by atri-'s look", the moon, (in arithmetic) the number one. View this entry on the original dictionary page scan.
atrinetraja m. "produced by atri-'s look", the moon, (in arithmetic) the number one. View this entry on the original dictionary page scan.
atrinetraprabhava m. "produced by atri-'s look", the moon, (in arithmetic) the number one. View this entry on the original dictionary page scan.
atrinetraprasūta m. "produced by atri-'s look", the moon, (in arithmetic) the number one. View this entry on the original dictionary page scan.
atrinetrasūta m. "produced by atri-'s look", the moon, (in arithmetic) the number one. View this entry on the original dictionary page scan.
ātuje Vedic or Veda infinitive mood to bring near View this entry on the original dictionary page scan.
atye(subjunctive 2. sg. -eṣas-) to glide over View this entry on the original dictionary page scan.
atyetavaisee ati- (parasmE-pada 16). View this entry on the original dictionary page scan.
audamegham. plural the school of audameghyā- View this entry on the original dictionary page scan.
audameghim. a descendant of uda-megha- View this entry on the original dictionary page scan.
audameghīyamfn. belonging to audameghi- ([ varia lectio audameyi- ]) gaRa raivatakādi- View this entry on the original dictionary page scan.
audameghyāf. of audameghi- above View this entry on the original dictionary page scan.
audareiṣamfn. directed to agni-, View this entry on the original dictionary page scan.
audbhettran. (fr. ud-bhettṛ-) idem or 'n. forcing one's way to an aim, success, victory ' View this entry on the original dictionary page scan.
audbhettriyan. idem or 'n. (fr. ud-bhettṛ-) idem or 'n. forcing one's way to an aim, success, victory ' ' View this entry on the original dictionary page scan.
auddeśikamfn. (fr. ud-deśa-), pointing out, indicative of, showing, enumerating View this entry on the original dictionary page scan.
auddeśikamfn. prepared for the sake of (mendicants;said of alms) View this entry on the original dictionary page scan.
audheyam. plural Name of a family View this entry on the original dictionary page scan.
audheyam. of a school (belonging to the White yajur-veda-), View this entry on the original dictionary page scan.
audvepamfn. (fr. ud-vepa- gaRa saṃkalādi- ), resulting from tremor or trembling (?). View this entry on the original dictionary page scan.
augrasenim. a descendant of ugra-sena- View this entry on the original dictionary page scan.
augrasenyam. idem or 'm. a descendant of ugra-sena- ' on vArttika 7 on View this entry on the original dictionary page scan.
augreyam. a descendant of ugra- gaRa śubhrādi- View this entry on the original dictionary page scan.
aukheyam. plural idem or 'm. plural the descendants or pupils of ukha-.' View this entry on the original dictionary page scan.
aukhyeyakamfn. equals ukhyā-jāta- gaRa kattry-ādi- View this entry on the original dictionary page scan.
aumbheyakamfn. (fr. umbhi- gaRa kattry-ādi- ), relating to one who fills up ( ?) View this entry on the original dictionary page scan.
aunnetran. the office of the un-netṛ- priest gaRa udgātr-ādi- View this entry on the original dictionary page scan.
aupadeśikamf(ī-)n. living by teaching gaRa vetanādi- ) View this entry on the original dictionary page scan.
aupadeśikamf(ī-)n. depending on or resulting from a special rule commentator or commentary on and View this entry on the original dictionary page scan.
aupadeśikamf(ī-)n. (in grammar) denoting or relating to an originally enunciated grammatical form (See upadeśa-) View this entry on the original dictionary page scan.
aupadeśikatvan. the state of resulting from a special rule commentator or commentary on View this entry on the original dictionary page scan.
aupadhenavam. a descendant of upadhenu-, Name of a physician View this entry on the original dictionary page scan.
aupadheyamfn. serving for the upadhi- (a particular part of the wheel of a carriage) View this entry on the original dictionary page scan.
aupadheyan. the part of a wheel called upadhi- on View this entry on the original dictionary page scan.
aupaśleṣikamfn. (fr. upaśleṣa-), connected by close contact View this entry on the original dictionary page scan.
aupaveśim. a descendant of upa-veśa-, Name of aruṇa- View this entry on the original dictionary page scan.
aupaveṣikamfn. (fr. upa-veṣa- gaRa vetanādi- ), living by entertainment (?). View this entry on the original dictionary page scan.
aupendramfn. relating to viṣṇu-, View this entry on the original dictionary page scan.
aupoditeyam. a descendant of aupoditī- View this entry on the original dictionary page scan.
aurdhvadehamfn. (fr. ūrdhva-deha-), relating or referring to the state after death, relating to future life View this entry on the original dictionary page scan.
aurdhvadehikamfn. idem or 'mfn. (fr. ūrdhva-deha-), relating or referring to the state after death, relating to future life ' View this entry on the original dictionary page scan.
aurdhvadehikamfn. relating to a deceased person, performed in honour of the dead, funereal, funeral View this entry on the original dictionary page scan.
aurdhvadehikan. the obsequies of a deceased person, any funeral ceremony View this entry on the original dictionary page scan.
aurdhvadehikan. whatever is offered or performed on a person's decease (as burning of the body, offering cakes, distributing alms etc.) View this entry on the original dictionary page scan.
aurdhvadehikakalpavallif. Name of work View this entry on the original dictionary page scan.
aurdhvadehikanirṇayam. Name of work View this entry on the original dictionary page scan.
aurdhvadehikapaddhatif. Name of work View this entry on the original dictionary page scan.
aurdhvadehikaprayogam. Name of work View this entry on the original dictionary page scan.
aurmileyam. a descendant of urmilā- View this entry on the original dictionary page scan.
aurvaśeyam. a descendant of urvaśī- View this entry on the original dictionary page scan.
aurvaśeyam. Name of agastya- View this entry on the original dictionary page scan.
auṣadhapeṣakam. one who grinds or pounds medicaments View this entry on the original dictionary page scan.
autathyeśvaran. Name of a liṅga-. View this entry on the original dictionary page scan.
autkṣepamf(ī-). a descendant of ut-kṣepa- gaRa śivādi- View this entry on the original dictionary page scan.
autkṣepamf(ī-). ( reads ut-kṣipā-.) View this entry on the original dictionary page scan.
auttameyam. a descendant of auttami-
auttaravedikamfn. (fr. uttara-vedi-), relating to or performed on the northern altar View this entry on the original dictionary page scan.
auttareyam. a descendant of uttarā- View this entry on the original dictionary page scan.
auvef. idem or 'f. varia lectio for ovīlī- q.v ' View this entry on the original dictionary page scan.
auveṇakan. a kind of song (gītaka-) View this entry on the original dictionary page scan.
avabhedakamfn. "piercing (the head)", aching (as hemiplegia) (see ardha-bheda-.) View this entry on the original dictionary page scan.
avabhedinmfn. splitting, dividing View this entry on the original dictionary page scan.
avabhṛtheṣṭif. a supplementary sacrifice to atone for defects in a principal and preceding one View this entry on the original dictionary page scan.
avacchedam. anything cut off (as from clothes) View this entry on the original dictionary page scan.
avacchedam. part, portion (as of a recitation) View this entry on the original dictionary page scan.
avacchedam. separation, discrimination View this entry on the original dictionary page scan.
avacchedam. (in logic) distinction, particularising, determining View this entry on the original dictionary page scan.
avacchedam. a predicate (the property of a thing by which it is distinguished from everything else). View this entry on the original dictionary page scan.
avacchedakamfn. distinguishing, particularising, determining View this entry on the original dictionary page scan.
avacchedakam. "that which distinguishes", a predicate, characteristic, property View this entry on the original dictionary page scan.
avacchedanan. cutting off View this entry on the original dictionary page scan.
avacchedanan. dividing View this entry on the original dictionary page scan.
avacchedanan. discriminating, distinguishing View this entry on the original dictionary page scan.
avacchedāvacchedam. removing distinctions, generalising View this entry on the original dictionary page scan.
avacchedyamfn. to be separated. View this entry on the original dictionary page scan.
avācyadeśam. "unmentionable region", the vulva commentator or commentary on View this entry on the original dictionary page scan.
avadāheṣṭan. idem or 'm. "burning down", the root of the fragrant grass Andropogon Muricatus ' View this entry on the original dictionary page scan.
avadeyamfn. to be divided commentator or commentary on View this entry on the original dictionary page scan.
avadhesind. ablative until, up to, as far as, as long as (genitive case [ ],or in compound) View this entry on the original dictionary page scan.
avadheyan. equals -dhātavya- q.v View this entry on the original dictionary page scan.
avadhūtaveṣamfn. "wearing unclean clothes"or"wearing the clothes of one who is rejected", or"having discarded clothes" View this entry on the original dictionary page scan.
avadhyeyamfn. to be disregarded View this entry on the original dictionary page scan.
avaghreyamfn. to be smelt at View this entry on the original dictionary page scan.
avahelaf(ā-)n. ( hel-for hed-), disrespect View this entry on the original dictionary page scan.
avahelanan. disrespect View this entry on the original dictionary page scan.
avahelayāind. instrumental case without any trouble, quite easily (see vahelam-.) View this entry on the original dictionary page scan.
avahelitamfn. disrespected View this entry on the original dictionary page scan.
avahelitan. disrespect View this entry on the original dictionary page scan.
avahveA1. (1. sg. -hvaye-) to call down from View this entry on the original dictionary page scan.
avajñeyamfn. to be contemned, disesteemed etc. View this entry on the original dictionary page scan.
avakāśeind. (probably) about dawn, View this entry on the original dictionary page scan.
avakāśenaind. avakāśa
avakeśamfn. having the hair hanging down View this entry on the original dictionary page scan.
avakeśinmfn. "having its filaments (keśa-= kesara- q.v) turned downwards (so that they remain uncopulated)", unfruitful, barren (as a plant) View this entry on the original dictionary page scan.
avakeśinm. a barren tree, View this entry on the original dictionary page scan.
avakledam. trickling, descent of moisture View this entry on the original dictionary page scan.
avakledam. fetid discharge View this entry on the original dictionary page scan.
avakledakledanan. trickling, descent of moisture View this entry on the original dictionary page scan.
avakledakledanan. fetid discharge View this entry on the original dictionary page scan.
avakṣepam. blaming, reviling, scolding commentator or commentary View this entry on the original dictionary page scan.
avakṣepaṇan. throwing down, overcoming View this entry on the original dictionary page scan.
avakṣepaṇan. reviling, blame, despising View this entry on the original dictionary page scan.
avakṣepaṇīf. bridle View this entry on the original dictionary page scan.
avaleham. licking, lapping View this entry on the original dictionary page scan.
avaleham. an extract, electuary View this entry on the original dictionary page scan.
avalehaetc. See ava-lih-. View this entry on the original dictionary page scan.
avalehakamfn. licking View this entry on the original dictionary page scan.
avalehanan. licking View this entry on the original dictionary page scan.
avalehanan. equals -lehikā- View this entry on the original dictionary page scan.
avalehikāf. (equals -leha-before) an extract, electuary View this entry on the original dictionary page scan.
avalehinmfn. lickerish, fond of dainties, ([ ;"sṛkkiṇī lelīhāna- id est sadā kruddha-"commentator or commentary ]) View this entry on the original dictionary page scan.
avalekham. anything scraped off View this entry on the original dictionary page scan.
avalekhāf. drawing painting View this entry on the original dictionary page scan.
avalekhaetc. See ava-likk-. View this entry on the original dictionary page scan.
avalekhanan. brushing, combing View this entry on the original dictionary page scan.
avalekhanīf. brush, comb View this entry on the original dictionary page scan.
avalepam. glutinousness (as of the mouth)
avalepam. ointment View this entry on the original dictionary page scan.
avalepam. ornament View this entry on the original dictionary page scan.
avalepam. pride, haughtiness (see an-- negative) View this entry on the original dictionary page scan.
avalepaetc. See ava-lip-. View this entry on the original dictionary page scan.
avalepanan. ointment View this entry on the original dictionary page scan.
avalepanan. proud behaviour View this entry on the original dictionary page scan.
avalokeṣuind. before the (looks or) eyes of(genitive case) View this entry on the original dictionary page scan.
avalokiteśvaram. Name of a bodhi-sattva-, worshipped by the northern Buddhists. View this entry on the original dictionary page scan.
avamehanan. urining upon View this entry on the original dictionary page scan.
avamehanīyamfn. to be urined upon, (an-- negative) View this entry on the original dictionary page scan.
avanegaSee prātar-avaneg/a-. View this entry on the original dictionary page scan.
avanegyamfn. serving for washing View this entry on the original dictionary page scan.
avanejaSee pādāvan-. View this entry on the original dictionary page scan.
avanejanamf(ī-)n. washing, serving for washing (the feet) View this entry on the original dictionary page scan.
avanejanan. ablution (of hands [SBr.] or feet[ ]) View this entry on the original dictionary page scan.
avanejanan. water for washing (hands[ ] or feet see pādāvan-). View this entry on the original dictionary page scan.
avanejyaSee pādāvan-. View this entry on the original dictionary page scan.
avanektṛSee pādāvan-. View this entry on the original dictionary page scan.
avaneyamfn. to be led away View this entry on the original dictionary page scan.
āvaneyam. (fr. avani-),"son of the earth", Name of the planet Mars. View this entry on the original dictionary page scan.
avāntarabhedam. subdivision View this entry on the original dictionary page scan.
avāntaradeśam. a place situated in an intermediate region View this entry on the original dictionary page scan.
avāntareḍāf. an iḍā- subdivided into five parts View this entry on the original dictionary page scan.
avantīḍeśam. the region of avanti-. View this entry on the original dictionary page scan.
avantidevam. (equals -varman- q.v) Name of a king View this entry on the original dictionary page scan.
avantisenam. Name of a man View this entry on the original dictionary page scan.
avareṇaind. instrumental case below (with accusative) View this entry on the original dictionary page scan.
avarṣatarkyeind. when no rain is to be expected, when the sky is clear, View this entry on the original dictionary page scan.
avaruddhadehamfn. having the person imprisoned, incarcerated View this entry on the original dictionary page scan.
avasādanāvineyamfn. to be taught by discouragement, View this entry on the original dictionary page scan.
avasarakāle ([ ]) locative case ind. on a favourable opportunity. View this entry on the original dictionary page scan.
avasaravelāyām([ ]) locative case ind. on a favourable opportunity. View this entry on the original dictionary page scan.
avasareind. at the right moment View this entry on the original dictionary page scan.
avasecanan. sprinkling, View this entry on the original dictionary page scan.
avasecanan. water used for irrigating (trees) View this entry on the original dictionary page scan.
avasecanan. bathing View this entry on the original dictionary page scan.
avasecanan. bleeding View this entry on the original dictionary page scan.
avasecitamfn. equals -srkta- View this entry on the original dictionary page scan.
avaśedriyacittamfn. whose mind and senses are not held in subjection View this entry on the original dictionary page scan.
avasekam. sprinkling, irrigating (as the ground) View this entry on the original dictionary page scan.
avasekam. syringing, administering a clyster , bleeding (with leeches) View this entry on the original dictionary page scan.
avasekimam. a kind of cake (pulse ground and fried with oil or butter) View this entry on the original dictionary page scan.
avaśeṣan. leavings, remainder View this entry on the original dictionary page scan.
avaśeṣan. often in fine compositi or 'at the end of a compound' exempli gratia, 'for example' ardhāv-, kathāv-, pitāv- q.v View this entry on the original dictionary page scan.
avaśeṣaetc. See ava-śiṣ-. View this entry on the original dictionary page scan.
avaśeṣamind. in fine compositi or 'at the end of a compound' so as to leave as a remnant (see nir-av-.) View this entry on the original dictionary page scan.
avaśeṣatāf. the being left as a remainder View this entry on the original dictionary page scan.
avaśeṣitamfn. left as a remnant, remaining (see kathā-mātrāv-and nāmamātrāv-.) View this entry on the original dictionary page scan.
avaśeṣyamfn. to be left or kept remaining. View this entry on the original dictionary page scan.
avaseyamfn. to be ascertained, be understood, be made out, be learnt, from commentator or commentary etc. View this entry on the original dictionary page scan.
avaseyamfn. "to be brought to a close", be destroyed View this entry on the original dictionary page scan.
avaśyendriyamfn. one who does not control his senses, View this entry on the original dictionary page scan.
avataptenakulasthitan. an ichneumon's standing on hot ground (metaphorically said of a person's inconstancy) View this entry on the original dictionary page scan.
avatāraprekṣinmfn. watching opportunities, espying faults, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
avavye(p. -vy/ayat-) to pull off (as clothes) View this entry on the original dictionary page scan.
avayātaheḷas(/avayāta--.) mfn. whose anger is appeased View this entry on the original dictionary page scan.
ave( i-), -eti- (imperfect tense -ayat-; Potential 1. sg. iyām-; pr. p. f. avā-yati- ) to go down, go down to (accusative), go to ; (Imper. 3. plural A1. āyantām-) to rush down (see āvai-) ; (Imper. /avaitu-) to go away ; to look upon, consider ; to perceive, conceive, understand, learn, know etc. ; (with infinitive mood) : Intensive (plural -īmahe-) to beg pardon for, conciliate View this entry on the original dictionary page scan.
āveP. -vayati-, to weave on to ; to interweave, string ; to sew loosely View this entry on the original dictionary page scan.
āve( ā-ava-i-) P. (3. plural va-yanti- ) to rush down upon (accusative) View this entry on the original dictionary page scan.
avedam. plural not the veda-s View this entry on the original dictionary page scan.
āvedakamfn. in fine compositi or 'at the end of a compound' making known, reporting, announcing View this entry on the original dictionary page scan.
āvedakam. an appellant, a suitor View this entry on the original dictionary page scan.
āvedakam. one who makes known, an informer. View this entry on the original dictionary page scan.
āvedakaetc. See ā-- 1. vid-. View this entry on the original dictionary page scan.
avedanan. not knowing View this entry on the original dictionary page scan.
avedanamfn. painless View this entry on the original dictionary page scan.
āvedanan. announcing, informing View this entry on the original dictionary page scan.
āvedanan. stating a complaint View this entry on the original dictionary page scan.
āvedanan. addressing or apprising respectfully. View this entry on the original dictionary page scan.
āvedanīyamfn. to be declared or reported or announced View this entry on the original dictionary page scan.
avedavidmfn. not knowing the veda-s View this entry on the original dictionary page scan.
avedavidvasm(dative case -viduṣe-)fn. idem or 'mfn. not knowing the veda-s ' View this entry on the original dictionary page scan.
avedavihitamfn. not prescribed in the veda-s View this entry on the original dictionary page scan.
avedayānamfn. (pr. p. A1.) not knowing, not ascertaining View this entry on the original dictionary page scan.
āvedhaetc. See ā-vyadh-. View this entry on the original dictionary page scan.
āvedham. swinging, shaking View this entry on the original dictionary page scan.
avedhyamfn. un-pierceable, not to be pierced View this entry on the original dictionary page scan.
āvedhyamfn. to be pierced or pinned on View this entry on the original dictionary page scan.
āvedhyamfn. to be put on. View this entry on the original dictionary page scan.
avedif. ignorance View this entry on the original dictionary page scan.
avedimfn. without a vedi- or sacrificial altar View this entry on the original dictionary page scan.
avedinmfn. having no knowledge View this entry on the original dictionary page scan.
āvedinmfn. in fine compositi or 'at the end of a compound' announcing, declaring. View this entry on the original dictionary page scan.
āveditamfn. made known, communicated, represented commentator or commentary on View this entry on the original dictionary page scan.
avedoktamfn. idem or 'mfn. not prescribed in the veda-s ' View this entry on the original dictionary page scan.
avedyamfn. not to be known, unascertainable View this entry on the original dictionary page scan.
avedyāf. (in sāṃkhya- philosophy) non-admission of the ahaṃkāra-. View this entry on the original dictionary page scan.
avedyamf(ā-)n. (3. vid-), not to be married View this entry on the original dictionary page scan.
avedyam. a calf. View this entry on the original dictionary page scan.
āvedyamfn. equals ā-vedanīya- above. View this entry on the original dictionary page scan.
āvedya ind.p. having made known etc. View this entry on the original dictionary page scan.
āvedyamānamfn. being made known, being stated or represented. View this entry on the original dictionary page scan.
āvegam. ( vij-), hurry or haste produced by excitement
āvegam. flurry, agitation etc. View this entry on the original dictionary page scan.
āvef. Name of the plant Argyreia Speciosa View this entry on the original dictionary page scan.
avekṣ( īkṣ-), avekṣate- to look towards, look at, behold etc. ; (1. sg. /ikṣe-) to perceive, observe, experience etc.: A1. (rarely P. exempli gratia, 'for example' 2. sg. av/ekṣasi- ) to have in view, have regard to, take into consideration etc.: Causal avekṣayati-, to cause to look at View this entry on the original dictionary page scan.
avekṣāf. observation, care, attention to (locative case) View this entry on the original dictionary page scan.
avekṣaṇan. looking towards or at View this entry on the original dictionary page scan.
avekṣaṇan. (said of planets) the being in sight View this entry on the original dictionary page scan.
avekṣaṇan. the act of considering, attention, observation View this entry on the original dictionary page scan.
avekṣaṇīyamfn. to be respected View this entry on the original dictionary page scan.
avekṣatāf. foresight, View this entry on the original dictionary page scan.
avekṣinmfn. looking towards or at View this entry on the original dictionary page scan.
avekṣinmfn. attentive to (accusative) View this entry on the original dictionary page scan.
avekṣitavyamfn. to be observed attentively View this entry on the original dictionary page scan.
avekṣyamfn. to be attended to View this entry on the original dictionary page scan.
avelam. (?) , denial or concealment of knowledge View this entry on the original dictionary page scan.
avef. wrong time View this entry on the original dictionary page scan.
avef. chewed betel View this entry on the original dictionary page scan.
avelamind. untimely View this entry on the original dictionary page scan.
avenatmfn. not having any wish or desire View this entry on the original dictionary page scan.
aveṇimfn. having no braid of hair View this entry on the original dictionary page scan.
aveṇimfn. not commingled (as the waters of rivers) View this entry on the original dictionary page scan.
aveṇimfn. single, being by itself. (see aveṇika-.) View this entry on the original dictionary page scan.
āveṇikamf(ī-)n. (fr. a-veṇi-), not connected with anything else, independent View this entry on the original dictionary page scan.
avenv( inv-), (Imper. 2. dual number -invatam-) to send down (as rain) View this entry on the original dictionary page scan.
āveśam. joining one's self View this entry on the original dictionary page scan.
āveśam. entering, entrance, taking possession of etc. View this entry on the original dictionary page scan.
āveśam. absorption of the faculties in one wish or idea, intentness, devotedness to an object View this entry on the original dictionary page scan.
āveśam. demoniacal frenzy, possession, anger, wrath View this entry on the original dictionary page scan.
āveśam. pride, arrogance View this entry on the original dictionary page scan.
āveśam. indistinctness of idea, apoplectic or epileptic giddiness View this entry on the original dictionary page scan.
āveśaetc. See ā-viś-. View this entry on the original dictionary page scan.
āveśanan. entering, entrance View this entry on the original dictionary page scan.
āveśanan. possession by devils etc. View this entry on the original dictionary page scan.
āveśanan. passion, anger, fury View this entry on the original dictionary page scan.
āveśanan. a house in which work is carried on, a workshop, manufactory, etc. View this entry on the original dictionary page scan.
āveśanan. the disk of the sun or moon View this entry on the original dictionary page scan.
āveśanan. (for ā-veṣaṇa-.) View this entry on the original dictionary page scan.
aveśasadṛśamfn. not like prostitution, View this entry on the original dictionary page scan.
āveśikamfn. own, peculiar View this entry on the original dictionary page scan.
āveśikamfn. inherent View this entry on the original dictionary page scan.
āveśikam. a guest, a visitor View this entry on the original dictionary page scan.
āveśikan. entering into View this entry on the original dictionary page scan.
āveśikan. hospitable reception, hospitality View this entry on the original dictionary page scan.
āveṣṭA1. -veṣṭate-, to spread over : Causal -veṣṭayati-, to envelop, cover ; to keep together ; to close (the hand) : Passive voice -veṣṭyate-, to be twisted (as a rope) View this entry on the original dictionary page scan.
āveṣṭam. surrounding, covering with (clothes) View this entry on the original dictionary page scan.
āveṣṭam. to strangle, throttle View this entry on the original dictionary page scan.
āveṣṭakam. a snare commentator or commentary on View this entry on the original dictionary page scan.
āveṣṭakam. a wall, fence View this entry on the original dictionary page scan.
āveṣṭakam. an enclosure View this entry on the original dictionary page scan.
āveṣṭanan. wrapping round View this entry on the original dictionary page scan.
āveṣṭanan. binding, tying View this entry on the original dictionary page scan.
āveṣṭanan. a wrapper, bandage, envelope, enclosure View this entry on the original dictionary page scan.
aveṣṭif. ( yaj-), appeasing or expiation by sacrifices View this entry on the original dictionary page scan.
āveṣṭitamfn. surrounded, enveloped, etc. View this entry on the original dictionary page scan.
āveṣṭya ind.p. having surrounded etc. View this entry on the original dictionary page scan.
avetamfn. elapsed, passed, (/an-- negative) View this entry on the original dictionary page scan.
avetamfn. one who has gained, obtained (with accusative), -. View this entry on the original dictionary page scan.
avibhāgenaind. instrumental case without distinction, in the same way View this entry on the original dictionary page scan.
avicalendriyamfn. whose senses do not waver, id est are under control View this entry on the original dictionary page scan.
avicchedam. uninterruptedness, continuity etc. View this entry on the original dictionary page scan.
avicchedātind. ablative ([ ]) , uninterruptedly. View this entry on the original dictionary page scan.
avicchedenaind. instrumental case ([Comm. on ]) or in compound aviccheda-- ([ ]) , uninterruptedly. View this entry on the original dictionary page scan.
avicetanamfn. unintelligible View this entry on the original dictionary page scan.
avicetasmfn. unwise View this entry on the original dictionary page scan.
avidite locative case ind. ([ ]) without the knowledge of (genitive case) View this entry on the original dictionary page scan.
avidūreind. not far off (with ablative), near View this entry on the original dictionary page scan.
avidveṣam. non-enmity View this entry on the original dictionary page scan.
āvidvevidānaattaining, View this entry on the original dictionary page scan.
avidviṣe Vedic or Veda infinitive mood for preventing enmity View this entry on the original dictionary page scan.
avighnenaind. instrumental case without obstacle View this entry on the original dictionary page scan.
aviheṭhitamfn. unhurt, undamaged, View this entry on the original dictionary page scan.
āviḥsūryeind. when the sun shines, View this entry on the original dictionary page scan.
avijñeyamfn. undistinguishable undiscernible View this entry on the original dictionary page scan.
avikreyamfn. not to be sold, unsaleable (edition Bomb.) View this entry on the original dictionary page scan.
avilambenaind. idem or 'ind. without delay (varia lectio lambitam-)' View this entry on the original dictionary page scan.
avimukteśam. a particular from of śiva- View this entry on the original dictionary page scan.
avimukteśamahātmyan. Name of work
avimukteśvaram. equals avimukteśa- View this entry on the original dictionary page scan.
avimukteśvaraliṅgan. Name of a liṅga- View this entry on the original dictionary page scan.
avirecanan. anything which constipates or stops the passage of the food. View this entry on the original dictionary page scan.
avirecaniyamfn. not to be purged, View this entry on the original dictionary page scan.
avirecyamfn. idem or 'mfn. not to be purged, ' View this entry on the original dictionary page scan.
aviśeṣam. non-distinction, non-difference, uniformity View this entry on the original dictionary page scan.
aviśeṣamfn.without difference, uniform etc. View this entry on the original dictionary page scan.
aviśeṣan. plural (in sāṃkhya- philosophy) Name of the (five) elementary substances (see tan-mātra-) View this entry on the original dictionary page scan.
aviśeṣam. not differently, equally commentator or commentary on View this entry on the original dictionary page scan.
aviśeṣajñatāf. want of discrimination or judgement View this entry on the original dictionary page scan.
aviśeṣasamam. a kind of sophism View this entry on the original dictionary page scan.
aviśeṣātind. or in compound aviśṣa-- ([ exempli gratia, 'for example' aviśeṣa-śruteṣ-, aviseṣopadeśāt- ]) without a special distinction or difference View this entry on the original dictionary page scan.
aviśeṣatasind. without difference View this entry on the original dictionary page scan.
aviśeṣavatmfn. not making a difference between (locative case) View this entry on the original dictionary page scan.
aviśeeṇaind. without a special distinction or difference commentator or commentary on = View this entry on the original dictionary page scan.
avitathehitamfn. whose wishes are not frustrated View this entry on the original dictionary page scan.
avitathenaind. idem or 'ind. not falsely, according to truth ' , (ājñam-) avitathāṃ- 1. kṛ-, or avitathī- 1. kṛ-,"to make true or effective", fulfil (an order) View this entry on the original dictionary page scan.
avitave Vedic or Veda infinitive mood av- q.v View this entry on the original dictionary page scan.
avivecakamfn. undiscriminating, View this entry on the original dictionary page scan.
avivecamind. so as not to part or separate View this entry on the original dictionary page scan.
avivecamind. (a-vivekam-in the same sense) View this entry on the original dictionary page scan.
avivecanāf. want of judgement View this entry on the original dictionary page scan.
avivekam. absence of judgement or discrimination View this entry on the original dictionary page scan.
avivekam. non-separation, non-distinction View this entry on the original dictionary page scan.
avivekamind. See a-vivecam-. View this entry on the original dictionary page scan.
avivekatāwant of judgement, inconsiderateness View this entry on the original dictionary page scan.
avivekinmfn. not separated, undistinguished, uniform, etc. View this entry on the original dictionary page scan.
avivekinmfn. undiscriminating, ignorant commentator or commentary on etc. View this entry on the original dictionary page scan.
avivekinmfn. (said of a country) destitute of men that can discriminate View this entry on the original dictionary page scan.
avivenamind. favourably View this entry on the original dictionary page scan.
avivenatmfn. not disaffected, favourable View this entry on the original dictionary page scan.
avodevaSee 2. av/as-. View this entry on the original dictionary page scan.
avyabhicāreṇaind. with absolute necessity kāśi-. and Scholiast or Commentator View this entry on the original dictionary page scan.
avyākhyeyamfn. inexplicable, unintelligible View this entry on the original dictionary page scan.
avyākhyeyamfn. inexpressible View this entry on the original dictionary page scan.
avyākṣepam. the not being confused or unsteady-minded, resolution View this entry on the original dictionary page scan.
avyālaceṣṭitamfn. not acting like a snake, not decritful, View this entry on the original dictionary page scan.
avyapadeśam. no designation or pointing to View this entry on the original dictionary page scan.
avyapadeśarūpinmfn. whose shape admits of no name or appellation View this entry on the original dictionary page scan.
avyapadeśyamfn. not to be defined View this entry on the original dictionary page scan.
avyapetamfn. not separated, contiguous View this entry on the original dictionary page scan.
avyatirekam. non-exclusion, non-exception View this entry on the original dictionary page scan.
avyatirekamfn., (equals avyabhicārin-) unerring View this entry on the original dictionary page scan.
avyatirekinmfn. unerring. View this entry on the original dictionary page scan.
avyavacchedam. uninterruptedness View this entry on the original dictionary page scan.
avyavetamfn. not separated by (instrumental case), View this entry on the original dictionary page scan.
avyavetaseparated by a-, View this entry on the original dictionary page scan.
āvyeP. (Potential 1. sg. -vyayeyam- ; Aorist 2. plural -/avyata- ) A1. (Aorist 3. sg. -avyata- ) to cover or hide one's self ; to take refuge. View this entry on the original dictionary page scan.
avyeṣyatmfn. ( i- fut.p.) not disappearing View this entry on the original dictionary page scan.
avyucchettṛm. one who does not injure (with genitive case) View this entry on the original dictionary page scan.
avyuptakeśamfn. having unshorn hair, View this entry on the original dictionary page scan.
ayase Vedic or Veda infinitive mood fr. i- q.v View this entry on the original dictionary page scan.
āyatapāṇilekhatāf. having long lines on the hand (one of the 80 minor marks of a buddha-), View this entry on the original dictionary page scan.
āyatekṣaṇamfn. long-eyed, having long or large eyes. View this entry on the original dictionary page scan.
ayathābhipretamfn. not desired, not agreeable View this entry on the original dictionary page scan.
ayathādevatam(/a-yathā-) ind. not consonant or suitable to a deity View this entry on the original dictionary page scan.
ayatheṣṭamfn. not according to wish, not intended commentator or commentary View this entry on the original dictionary page scan.
ayatnenaind. without effort or exertion. [ ] View this entry on the original dictionary page scan.
ayeind. a vocative particle, an interjection (of surprise, recollection, fatigue, fear, passion, especially used in dramas, see ayi-). View this entry on the original dictionary page scan.
āye equals aye- q.v View this entry on the original dictionary page scan.
ayogakṣema(/a-yoga-) m. no secure possession of what has been acquired, no prosperity and View this entry on the original dictionary page scan.
ayogapeśalamfn. unskilled in emergencies, . View this entry on the original dictionary page scan.
ayonijeśvaratīrthan. equals -ja-tīrtha-, q.v View this entry on the original dictionary page scan.
ayuddhasenamfn. whose arrows or armies are un conquered, irresistible View this entry on the original dictionary page scan.
ayugmanetram. having an odd number of eyes (id est three) , Name of śiva- View this entry on the original dictionary page scan.
ayugmanetra q.v , View this entry on the original dictionary page scan.
āyuḥśeṣam. remainder of life View this entry on the original dictionary page scan.
āyuḥśeṣamfn. having still a short space of life left, not yet about to die View this entry on the original dictionary page scan.
āyuḥśeṣatāf. the state of being not yet about to die View this entry on the original dictionary page scan.
ayuṅnetram. equals ayuma-netra- q.v View this entry on the original dictionary page scan.
āyurvedam. the science of health or medicine (it is classed among sacred sciences, and considered as a supplement of the atharva-- veda-;it contains eight departments: 1. śalya- or (removal of) any substance which has entered the body (as extraction of darts, of splinters, etc.);2. śālākya- or cure of diseases of the eye or ear etc. by śalākā-s or sharp instruments;3. kāya-cikitsā- or cure of diseases affecting the whole body;4. bhūtavidyā- or treatment of mental diseases supposed to be produced by demoniacal influence;5. kaumāra-bhṛtya- or treatment of children;6. agada-tantra- or doctrine of antidotes;7. rāsāyana-tantra- or doctrine of elixirs;8. vājīkaraṇa-tantra- or doctrine of aphrodisiacs etc.)
āyurvedadṛśm. a physician View this entry on the original dictionary page scan.
āyurvedamayamfn. acquainted with medical sciences View this entry on the original dictionary page scan.
āyurvedarasāyanan. Name of work View this entry on the original dictionary page scan.
āyurvedasarvasvan. Name of work View this entry on the original dictionary page scan.
āyurvedasaukhyan. Name of work View this entry on the original dictionary page scan.
āyurvedikam. acquainted or familiar with medical science, a physician View this entry on the original dictionary page scan.
āyurvedinm. idem or 'm. acquainted or familiar with medical science, a physician ' View this entry on the original dictionary page scan.
āyustejasm. Name of a buddha-. View this entry on the original dictionary page scan.
bābef. Name of a city View this entry on the original dictionary page scan.
babhrudeśam. Name of a country View this entry on the original dictionary page scan.
babhrukeśamf(ī-)n. brown-haired View this entry on the original dictionary page scan.
badarīkedāramāhātmyan. Name of work View this entry on the original dictionary page scan.
baddhadveṣamfn. entertaining hatred View this entry on the original dictionary page scan.
baddhakesaramfn. having the filaments formed View this entry on the original dictionary page scan.
baddhanepathyamfn. attired in a theatrical dress View this entry on the original dictionary page scan.
baddhanetramf(ā-)n. having the eyes fixed on anything, gazing steadfastly View this entry on the original dictionary page scan.
baddhasnehamfn. conceiving affection for (locative case) View this entry on the original dictionary page scan.
baddhavepathumfn. seized with tremor, trembling View this entry on the original dictionary page scan.
bāḍeyīputram. Name of a teacher View this entry on the original dictionary page scan.
bādhapūrvapakṣagranthavivecanan. View this entry on the original dictionary page scan.
bādhasiddhāntagranthavivecanan. Name of work View this entry on the original dictionary page scan.
bādhyaretasm. one whose generative fluid is obstructed, impotent on View this entry on the original dictionary page scan.
baheṭakam. Terminalia Belrica View this entry on the original dictionary page scan.
bahiranteind. externally and internally View this entry on the original dictionary page scan.
bahirdeśam. a foreign country View this entry on the original dictionary page scan.
bahirdeśam. a place without a town or village View this entry on the original dictionary page scan.
bahirgehamind. outside the house, abroad View this entry on the original dictionary page scan.
bahirvedif. the space outside the vedi- or sacrificial altar View this entry on the original dictionary page scan.
bahirvediind. outside the sacrificial altar View this entry on the original dictionary page scan.
bahirvedikamfn. being or taking place outside the vedi- (See prec.) View this entry on the original dictionary page scan.
bāhirvedikamf(ī-)n. (fr. bahirvedi-). situated or taking place outside the vedi- (see bahir-vedika-).
bāhubhedinm. "arm-breaker", Name of viṣṇu- View this entry on the original dictionary page scan.
bāhudanteyam. equals -dantin- View this entry on the original dictionary page scan.
bahudeśadarśinmfn. one who has seen many countries, a great traveller View this entry on the original dictionary page scan.
bahudevatamfn. (a hymn) addressed to many deities ( bahudevatatva -tva- n.) View this entry on the original dictionary page scan.
bahudevatāf. an offering for many deities, View this entry on the original dictionary page scan.
bahudevatatvan. bahudevata
bahudevatyamfn. belonging to many deities View this entry on the original dictionary page scan.
bahudeyan. munificence, liberality View this entry on the original dictionary page scan.
bahudhaneśvaram. a very rich man View this entry on the original dictionary page scan.
bahudhenūkan. a great multitude of milch cows View this entry on the original dictionary page scan.
bahudheya(!) m. plural Name of a school , View this entry on the original dictionary page scan.
bahuketum. Name of a mountain View this entry on the original dictionary page scan.
bāhukuleyakam. patronymic fr. bahu-kula- View this entry on the original dictionary page scan.
bahuletarapakṣam. dual number the dark and the other (i.e. light) half of a month View this entry on the original dictionary page scan.
bāhuleyam. metron. of skanda- (fr. bahulā-,the Pleiades) View this entry on the original dictionary page scan.
bāhuleyaa bull, View this entry on the original dictionary page scan.
bāhulyenaind. usually, ordinarily, as a rule View this entry on the original dictionary page scan.
bahuphef. a species of plant (equals tala-) View this entry on the original dictionary page scan.
bahuphenarasāf. equals saptalā- View this entry on the original dictionary page scan.
bahupreyasīmfn. having many loved ones View this entry on the original dictionary page scan.
bahupuṣpaphalopetamfn. having many flowers and fruits View this entry on the original dictionary page scan.
bahurekham. plural many lines or wrinkles, marks of care or pain View this entry on the original dictionary page scan.
bahuretasm. "having much seed", Name of brahmā- View this entry on the original dictionary page scan.
bahuśreyasīmfn. Va1rtt. 3 View this entry on the original dictionary page scan.
bāhūtkṣepamind. so as to lift up the arms or hands View this entry on the original dictionary page scan.
bahuvelammfn. oftentimes, View this entry on the original dictionary page scan.
bāhuvikṣepam. moving the arm, swimming View this entry on the original dictionary page scan.
bahuvyālaniṣevitamfn. infested or inhabited by many snakes or wild beasts View this entry on the original dictionary page scan.
bahvenasmfn. very sinful View this entry on the original dictionary page scan.
bāhyeind. outside, without, out etc. View this entry on the original dictionary page scan.
bāhyenaind. outside, without, out etc. View this entry on the original dictionary page scan.
bāhyendriyan. an outer organ of sense View this entry on the original dictionary page scan.
baijaladevam. Name of a prince and author (see bijala-under bīja-). View this entry on the original dictionary page scan.
baijeyam. patronymic fr. bīja- gaRa śubhrādi-. View this entry on the original dictionary page scan.
bailmavegarudram. plural Name of a particular class of śaiva- ascetics
bakerukāf. a small crane View this entry on the original dictionary page scan.
bakerukāf. the branch of a tree bent by the wind View this entry on the original dictionary page scan.
bakeśam. Name of a temple founded by baka- View this entry on the original dictionary page scan.
bakulamedhīf. Name of a temple View this entry on the original dictionary page scan.
balābalākṣepaparihāram. Name of work View this entry on the original dictionary page scan.
baladevam. wind View this entry on the original dictionary page scan.
baladevam. Name of the elder brother of kṛṣṇa- (said to have been produced from a white hair of viṣṇu-, and regarded as a nāga-) etc. View this entry on the original dictionary page scan.
baladevam. of a nāga-rāja- View this entry on the original dictionary page scan.
baladevam. of a Brahman View this entry on the original dictionary page scan.
baladevam. of several authors (also with vidyābhūṣaṇa-) View this entry on the original dictionary page scan.
bāladevam. Name of a man View this entry on the original dictionary page scan.
bāladevam. patronymic fr. bala-d- View this entry on the original dictionary page scan.
baladevāhnikan. Name of work View this entry on the original dictionary page scan.
baladevāhnikāf. Ficus Heterophylla View this entry on the original dictionary page scan.
baladevapattanan. Name of a town View this entry on the original dictionary page scan.
baladevasvasṛf. Name of śiva-'s wife View this entry on the original dictionary page scan.
baladeyan. bestowal of strength View this entry on the original dictionary page scan.
bālagrahapratiṣedham. Name of work View this entry on the original dictionary page scan.
balajyeṣṭhamfn. one whose superiority is dependent on his strength or power View this entry on the original dictionary page scan.
bālakeli f. child's play or amusement View this entry on the original dictionary page scan.
bālakef. child's play or amusement View this entry on the original dictionary page scan.
bālālokasaṃkṣepam. Name of work View this entry on the original dictionary page scan.
bālamallavenasiddhāntam. Name of work View this entry on the original dictionary page scan.
bālāmayapratithedham. Name of work View this entry on the original dictionary page scan.
bālanetramf(ā-)n. guided or steered by a fool (as a ship) View this entry on the original dictionary page scan.
balasenam. Name of a warrior View this entry on the original dictionary page scan.
balasef. a strong army, an army, host View this entry on the original dictionary page scan.
balātkāreṇaind. balātkāra
balāvalepam. pride of strength or prowess View this entry on the original dictionary page scan.
balavarmadevam. idem or 'm. Name of a king ' View this entry on the original dictionary page scan.
balavarmadevam. Name of a merchant View this entry on the original dictionary page scan.
balavipulahetumatin. Name of an asura- View this entry on the original dictionary page scan.
bālavivekinīf. Name of work View this entry on the original dictionary page scan.
bālendum. the new or waxing moon View this entry on the original dictionary page scan.
baleśam. the chief or commander of an army View this entry on the original dictionary page scan.
bāleṣṭam. "liked by children", a jujube tree View this entry on the original dictionary page scan.
bāleśvaram. Name of an author View this entry on the original dictionary page scan.
bāleyamfn. fit or proper for children View this entry on the original dictionary page scan.
bāleyamfn. tender, soft (for 2.See below) . View this entry on the original dictionary page scan.
bāleyamfn. (fr. bali-) fit for an offering or oblation View this entry on the original dictionary page scan.
bāleyamfn. descended from bali- View this entry on the original dictionary page scan.
bāleyam. an ass View this entry on the original dictionary page scan.
bāleyam. a species of Cyperus View this entry on the original dictionary page scan.
bāleyam. equals -śāka- View this entry on the original dictionary page scan.
bāleyam. a kind of radish (prob. wrong reading for śāleya-) View this entry on the original dictionary page scan.
bāleyam. patronymic fr. bali- View this entry on the original dictionary page scan.
bāleyamfn. (plural) View this entry on the original dictionary page scan.
bāleyamfn. Name of a daitya- View this entry on the original dictionary page scan.
bāleyārdhikamfn. pāt-. View this entry on the original dictionary page scan.
bāleyaśākam. a kind of vegetable (equals aṅgāra-vallī-) View this entry on the original dictionary page scan.
bāḷheind. bāḍha
bālhikeyamiśram. Name of an author View this entry on the original dictionary page scan.
baliceṣṭitavarṇanan. Name of chapter of View this entry on the original dictionary page scan.
balimahānarendrākhyānan. Name of work View this entry on the original dictionary page scan.
baliśeṣam. the remains of an oblation, View this entry on the original dictionary page scan.
balīvardineyam. metron. fr. balīvardī- View this entry on the original dictionary page scan.
bālīvardineyam. patronymic fr. balīvardin- gaRa śubhrādi- View this entry on the original dictionary page scan.
bālīvardineyam. metron. fr. balīvardī- gaRa kalyāṇy-ādi- (see balīvardineya-). View this entry on the original dictionary page scan.
baliveśmann. equals mandira- View this entry on the original dictionary page scan.
ballāladeva(with daiva-jña-) m. Name of the author of the bhoja-prabandha- View this entry on the original dictionary page scan.
ballālasenadevam. Name of an author View this entry on the original dictionary page scan.
balopetamfn. idem or 'mfn. idem or 'mfn. endowed with power or strength ' ' View this entry on the original dictionary page scan.
bamburevaṇam. or n. (?) Name of a place View this entry on the original dictionary page scan.
bāṇarekhāf. "arrow-line", a long wound made by an arrow View this entry on the original dictionary page scan.
bandhadeśam. Name of a country
bāndhakeyam. idem or 'm. (fr. bandhakī-) the son of an unmarried woman, a bastard (gaRa kalyāṇy-ādi-).' gaRa śubhrādi-.
bāndhakineyam. (fr. bandhakī-) the son of an unmarried woman, a bastard (gaRa kalyāṇy-ādi-). View this entry on the original dictionary page scan.
bandhanaveśmann. "house of bondage", a prison View this entry on the original dictionary page scan.
bāndhukineyam. metron. fr. bandhukī- gaRa kalyāṇy-ādi-. View this entry on the original dictionary page scan.
bandhveṣam. inquiring after kindred View this entry on the original dictionary page scan.
bāṇeśvaram. Name of a liṅga- (prob. equals bāṇa-l-) View this entry on the original dictionary page scan.
bāṇeśvaram. Name of several authors View this entry on the original dictionary page scan.
bāṇeyam. an adherent of the asura- bāṇa- View this entry on the original dictionary page scan.
bāpūdevam. Name of an author View this entry on the original dictionary page scan.
bāpyadevam. Name of the writer of a particular inscription View this entry on the original dictionary page scan.
bārejyaName of a town View this entry on the original dictionary page scan.
barhaketum. Name of a son of sagara- View this entry on the original dictionary page scan.
barhaketum. of a son of the ninth manu- View this entry on the original dictionary page scan.
barhanetran. the eye in a peacock's tail View this entry on the original dictionary page scan.
barhiṣkeśam. "grass-haired", fire or the god of fire View this entry on the original dictionary page scan.
bāṣpahatekṣaṇamfn. blinded by tears, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
bāṣpaparyākulekṣana() mfn. having eyes suffused with tears. View this entry on the original dictionary page scan.
bāṣpāvilekṣaṇamfn. having eyes dimmed by tears View this entry on the original dictionary page scan.
bāsteyasee vāsteya-. View this entry on the original dictionary page scan.
baudheyam. plural Name of a school (see bodheya-). View this entry on the original dictionary page scan.
bāvādevaand bāvā-śāstrin- m. Name of authors View this entry on the original dictionary page scan.
bāveru= babiru-, Babylon, View this entry on the original dictionary page scan.
bāverujātakan. Name of work View this entry on the original dictionary page scan.
bebhiditavyamfn. ( bhid-, Intensive) to be repeatedly split View this entry on the original dictionary page scan.
beḍāf. a boat (see veḍa-). View this entry on the original dictionary page scan.
bedarakaram. (prob.) an inhabitant of the city Bedar or Bidar (also proper N.) View this entry on the original dictionary page scan.
beh (also written veh-) cl.1 A1. vehate-, to strive, make effort ; cl.1 P. vehati- equals vehāya- View this entry on the original dictionary page scan.
bekanāṭam. a usurer ()
bekurāf. (see bakura-) a voice, sound (see ) . View this entry on the original dictionary page scan.
bekurif. (prob.) playing a musical instrument (said of apsaras-) (vek- ; bhek- ; bhāk- ) View this entry on the original dictionary page scan.
bembam. Name of a man. View this entry on the original dictionary page scan.
bembāravam. a particular sound (see bambhā-r-). View this entry on the original dictionary page scan.
beś cl.1 P. beśati-, to go (= pis-, pes-) View this entry on the original dictionary page scan.
beṭīf. (prob.) a courtezan (confer, compare Hindi beṭī-). View this entry on the original dictionary page scan.
bhādrabāheyam. metron. fr. bhadra-bāhu- View this entry on the original dictionary page scan.
bhadradeham. Name of a son of vasu-deva- View this entry on the original dictionary page scan.
bhadradeva varia lectio for next. View this entry on the original dictionary page scan.
bhadrakarṇeśvaram. Name of a tīrtha- View this entry on the original dictionary page scan.
bhadrareṇum. Name of indra-'s elephant (varia lectio -veṇu-). View this entry on the original dictionary page scan.
bhadrasenam. Name of a man with the patronymic ājātaśatrava- View this entry on the original dictionary page scan.
bhadrasenam. of a son of vasu-deva- and devakī- View this entry on the original dictionary page scan.
bhadrasenam. of a son of ṛṣabha- View this entry on the original dictionary page scan.
bhadrasenam. of a son of mahiṣmat- (also naka-)
bhadrasenam. of a king of kaśmīra- View this entry on the original dictionary page scan.
bhadrasenam. (with Buddhists) Name of the leader of the host of the evil spirit māra-pāpīyas- View this entry on the original dictionary page scan.
bhadraśreṇyam. Name of a king View this entry on the original dictionary page scan.
bhadraveṇum. See -reṇu-. View this entry on the original dictionary page scan.
bhadrendram. Name of a man View this entry on the original dictionary page scan.
bhadreśaSee bhadreśa- etc. 1. bhadrā- below. View this entry on the original dictionary page scan.
bhadreśam. "husband of bhadrā- id est durgā- ", Name of śiva- (see umeśa-). View this entry on the original dictionary page scan.
bhadreśvaraSee bhadreśa- etc. 1. bhadrā- below. View this entry on the original dictionary page scan.
bhadreśvaram. Name of various statues and liṅga-s of śiva- (see prec.) View this entry on the original dictionary page scan.
bhadreśvaram. of a place View this entry on the original dictionary page scan.
bhadreśvaram. of a kāyastha- View this entry on the original dictionary page scan.
bhadreśvaram. of an author (also -sūri-and cārya-). View this entry on the original dictionary page scan.
bhagadevamfn. "whose god is the female organ", lustful, a libertine View this entry on the original dictionary page scan.
bhagadevatamf(ā-)n. having bhaga- for a deity View this entry on the original dictionary page scan.
bhagadevatāf. a hymeneal divinity View this entry on the original dictionary page scan.
bhagadheyam. Name of a man View this entry on the original dictionary page scan.
bhāgadheyan. a share, portion, property, lot, fate, destiny etc. etc. happiness, prosperity View this entry on the original dictionary page scan.
bhāgadheyamfn. the share of a king, tax, impost View this entry on the original dictionary page scan.
bhāgadheyam. one to whom a share is due, heir, co-heir View this entry on the original dictionary page scan.
bhāgadheyamf(ī-)n. due as a share or part (see ) . View this entry on the original dictionary page scan.
bhāgaleyam. patronymic fr. bhāgali- View this entry on the original dictionary page scan.
bhaganetra(in the beginning of a compound) bhaga-'s eyes View this entry on the original dictionary page scan.
bhaganetraghnam. "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetrahanm. "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetraharam. () "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetrahṛtm. () "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetranipātanam. "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetrāntakam. () "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhaganetrāpahārinm. () "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhāgānubhāgenaind. wish a greater or smaller share, at a different rate View this entry on the original dictionary page scan.
bhagavadbhaktivivekam. Name of work View this entry on the original dictionary page scan.
bhagavadgītāhetunirṇayam. Name of work View this entry on the original dictionary page scan.
bhagavadviśeṣam. Name of a man View this entry on the original dictionary page scan.
bhagavantadevam. Name of a prince (king of bhareha-, son of sāhi-deva- and a patron of nīlakaṇṭha- see next) View this entry on the original dictionary page scan.
bhāgavatasaṃkṣepavyākhyāf. Name of work View this entry on the original dictionary page scan.
bhāgavatasamuccayesahasranāmastotran. Name of work View this entry on the original dictionary page scan.
bhagavatīkeśādipādastavam. Name of work View this entry on the original dictionary page scan.
bhagavedanamfn. proclaiming connubial felicity (varia lectio for -daivata-). View this entry on the original dictionary page scan.
bhāgavijñeyam. Name of a man View this entry on the original dictionary page scan.
bhāgavivekam. Name of work on inheritance. View this entry on the original dictionary page scan.
bhageśaSee . View this entry on the original dictionary page scan.
bhageśam. the lord of fortune or prosperity View this entry on the original dictionary page scan.
bhagevita(equals bhage-+ avita- ), satisfied with good fortune or prosperity View this entry on the original dictionary page scan.
bhāgineya m. (fr. bhaginī-) a sister's son etc. (also in friendly address to any younger person ) View this entry on the original dictionary page scan.
bhāgineyakam. (fr. bhaginī-) a sister's son etc. (also in friendly address to any younger person ) View this entry on the original dictionary page scan.
bhāginef. a sister's daughter View this entry on the original dictionary page scan.
bhagnaceṣṭamfn. broken in effort, disappointed View this entry on the original dictionary page scan.
bhagnanetramfn. affecting the eyes (said of a kind of fever) View this entry on the original dictionary page scan.
bhagnayugeind. when the yoke is broken View this entry on the original dictionary page scan.
bhāgyakrameṇaind. in course of fortune View this entry on the original dictionary page scan.
bhāgyenaind. bhāgya
bhaimasena(bh/aima--) m. patronymic fr. bhīma-s-, View this entry on the original dictionary page scan.
bhaimasenim. (fr. bhīma-sena-) patronymic of divo-dāsa- View this entry on the original dictionary page scan.
bhaimasenim. of ghaṭotkaca- View this entry on the original dictionary page scan.
bhaimasenyam. patronymic fr. bhima-sena- Va1rtt. 7 View this entry on the original dictionary page scan.
bhairavendram. Name of a king View this entry on the original dictionary page scan.
bhairaveśam. "lord of terror", Name of viṣṇu- (properly of śiva-; see bhairava-tarjaka-). View this entry on the original dictionary page scan.
bhaiṣajyasenam. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
bhājanenaind. bhājana
bhajenya() mfn. equals janīya-. View this entry on the original dictionary page scan.
bhajeratha ( bhaje-+ aratha-), prob. bhaj/e- (infinitive mood) or bh/aje- (1. sg. fr. bhaj-) + r/athasya-. View this entry on the original dictionary page scan.
bhakṣitaśeṣam. remnants of food, leavings View this entry on the original dictionary page scan.
bhaktadveṣam. aversion from food, loss of appetite View this entry on the original dictionary page scan.
bhaktadveṣinmfn. one who has lost his appetite View this entry on the original dictionary page scan.
bhakticchedam. plural divided lines or streaks of painting or decoration (especially the separating or distinguishing marks on the forehead, nose, cheeks, breast and arms, which denote devotion to viṣṇu-, kṛṣṇa- etc.) View this entry on the original dictionary page scan.
bhaktihetunirṇayam. Name of work View this entry on the original dictionary page scan.
bhaktimārgopadeśadīkṣāf. Name of work View this entry on the original dictionary page scan.
bhaktoddeśakam. "food-prescriber", a particular official in a Buddhist monastery View this entry on the original dictionary page scan.
bhāllapāleyamfn. (fr. bhalla-pāla-) gaRa sakhy-ādi- varia lectio View this entry on the original dictionary page scan.
bhāllaveyam. patronymic fr. bhāllavi- on View this entry on the original dictionary page scan.
bhāllaveyam. Name of indra-dyumna- View this entry on the original dictionary page scan.
bhāllaveyam. of a teacher View this entry on the original dictionary page scan.
bhāllaveyaśrutif. Name of work View this entry on the original dictionary page scan.
bhāllaveyopaniṣadf. Name of an upaniṣad-. View this entry on the original dictionary page scan.
bhālleyamfn. (fr. bhalla-) gaRa sakhy-ādi-. View this entry on the original dictionary page scan.
bhānemim. "light-circle", the sun View this entry on the original dictionary page scan.
bhāṅgileyam. Name of a man (or mfn."coming from bhāṅgila-"?) View this entry on the original dictionary page scan.
bhaṅgyantareṇaind. in an indirect manner View this entry on the original dictionary page scan.
bhaṅgyantareṇaind. in another manner View this entry on the original dictionary page scan.
bhānudevam. Name of a king View this entry on the original dictionary page scan.
bhānukesaram. "ray-maned", the sun View this entry on the original dictionary page scan.
bhānuṣeṇam. Name of a poet View this entry on the original dictionary page scan.
bhānusenam. Name of a man View this entry on the original dictionary page scan.
bharadvājagārgapariṇayapratiṣedhavādārtham. Name of work View this entry on the original dictionary page scan.
bhāradvājagārgyapariṇayapratiṣedhavādārtham. Name of work View this entry on the original dictionary page scan.
bharaheśvaravṛttif. Name of work (see bhareha-nagarī-). View this entry on the original dictionary page scan.
bhārameyam. patronymic fr. bharama- or bhārama- View this entry on the original dictionary page scan.
bharaṇḍakeṣṇa(of unknown meaning), . View this entry on the original dictionary page scan.
bharaṇiṣeṇa m. Name of a man View this entry on the original dictionary page scan.
bharaṇisenam. Name of a man View this entry on the original dictionary page scan.
bhāratadeśajam. born in India, an Indian View this entry on the original dictionary page scan.
bharatasenam. Name of Scholiast or Commentator on various poems (lived about 100 years ago) View this entry on the original dictionary page scan.
bharataśreṣṭha m. the best of the bharata-varṣa- View this entry on the original dictionary page scan.
bharateśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
bhārateyam. patronymic fr. bhārata- (or bharata-) gaRa śubhrādi-. View this entry on the original dictionary page scan.
bharehanagarīf. Name of a town (see bharaha-pāla-). View this entry on the original dictionary page scan.
bhareṇaind. bhara
bhareṣujāmfn. existing in id est fit for wars and battles (said of soma-) View this entry on the original dictionary page scan.
bhareṣujāSee . View this entry on the original dictionary page scan.
bhārgaleśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
bhārgavaśreṣṭham. the best of the descendants of bhṛgu- View this entry on the original dictionary page scan.
bhartṛdevatā f. idolizing a husband View this entry on the original dictionary page scan.
bhartṛhemam. equals -hari- View this entry on the original dictionary page scan.
bhartṛmeṇṭham. Name of a poet ( bhartṛmeṇṭhatā -- f.), View this entry on the original dictionary page scan.
bhartṛmeṇṭhatāf. bhartṛmeṇṭha
bhartṛsneham. love of a husband View this entry on the original dictionary page scan.
bhartṛsnehaparītamfn. filled with love to a husband View this entry on the original dictionary page scan.
bhāryācelan. cela
bhāsāketumfn. (fr. instrumental case of 2. bh/ās +k-) perceivable by or appearing through light View this entry on the original dictionary page scan.
bhāṣaṇīkṣaulemam. bhāṣaṇī
bhāṣāparicchedam. "definition of (the categories of) speech", Name of a compendium of the nyāya- system by viśva-nātha- View this entry on the original dictionary page scan.
bhāskaradevam. Name of a poet View this entry on the original dictionary page scan.
bhāskarasenam. Name of a poet View this entry on the original dictionary page scan.
bhāskareṣṭāf. Polanisia Icosandra View this entry on the original dictionary page scan.
bhasmalepanan. smearing with ashes View this entry on the original dictionary page scan.
bhasmameham. a sort of gravel View this entry on the original dictionary page scan.
bhasmānteind. near ashes View this entry on the original dictionary page scan.
bhasmareṇum. the dust of ashes View this entry on the original dictionary page scan.
bhasmāvaśeṣamfn. of whom nothing remains but ashes View this entry on the original dictionary page scan.
bhasmavedhakam. camphor View this entry on the original dictionary page scan.
bhasmeśvaram. a particular medicinal preparation View this entry on the original dictionary page scan.
bhasmeśvaram. Name of śiva- as a future tathā-gata- View this entry on the original dictionary page scan.
bhāspheru View this entry on the original dictionary page scan.
bhāsuradehamfn. having a splendid body or from View this entry on the original dictionary page scan.
bhāsurahemarāśim. a glittering heap of gold View this entry on the original dictionary page scan.
bhaṭapeṭakan. a troop of soldiers View this entry on the original dictionary page scan.
bhāṭṭadeśam. the country of the bhāṭṭa-s View this entry on the original dictionary page scan.
bhaṭṭakedāram. equals kedāra-bh- q.v View this entry on the original dictionary page scan.
bhāṭṭaśabdaparicchedam. Name of work View this entry on the original dictionary page scan.
bhāṭṭaśabdenduśekharam. Name of work View this entry on the original dictionary page scan.
bhaṭṭasomeśvara m. Name of various scholars and authors View this entry on the original dictionary page scan.
bhaṭṭaviśveśvaram. Name of various scholars and authors View this entry on the original dictionary page scan.
bhaumadevalipif. Name of a kind of writing View this entry on the original dictionary page scan.
bhavabandheśam. "lord of the fetters of worldly existence", Name of śiva- View this entry on the original dictionary page scan.
bhāvaceṣṭitan. amorous gesture, wanton sport View this entry on the original dictionary page scan.
bhavadbhūtabhavyeind. in present, past, and future View this entry on the original dictionary page scan.
bhavaddevam. Name of a man (for bhava-deva-?). View this entry on the original dictionary page scan.
bhavadevam. Name of various authors (also with paṇḍita kavi-, bāla-valabhī-bhujaṃga-, bhaṭṭa-and miśra-) View this entry on the original dictionary page scan.
bhāvadef. Name of a poetess View this entry on the original dictionary page scan.
bhāvāgaṇeśadīkṣitam. Name of a man View this entry on the original dictionary page scan.
bhāvakeralīyan. Name of work View this entry on the original dictionary page scan.
bhavaketum. Name of a particular phenomenon in the sky View this entry on the original dictionary page scan.
bhāvaleśaprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhāvanāvivekam. Name of work View this entry on the original dictionary page scan.
bhāvanerim. a kind of dance View this entry on the original dictionary page scan.
bhavaneśam. the regent of a horoscope or natal star View this entry on the original dictionary page scan.
bhavanigaḍanibandhacchedanamf(ī-)n. () destroying the chains and fetters of worldly existence. View this entry on the original dictionary page scan.
bhavanigaḍanibandhacchedhavināśin() mfn. destroying the chains and fetters of worldly existence. View this entry on the original dictionary page scan.
bhāvasāravivekam. Name of work View this entry on the original dictionary page scan.
bhavaśekharam. " śiva-'s crest", the moon, View this entry on the original dictionary page scan.
bhāvasenam. Name of a grammarian View this entry on the original dictionary page scan.
bhavatsneham. the love for your ladyship or for you View this entry on the original dictionary page scan.
bhāvavidyeśvaram. Name of an author View this entry on the original dictionary page scan.
bhāvavivekam. Name of a teacher View this entry on the original dictionary page scan.
bhāvavivekam. Name of various works. View this entry on the original dictionary page scan.
bhāvenaind. bhāva
bhaveṇumfn. = bhavya-, View this entry on the original dictionary page scan.
bhaveśam. "lord of worldly existence", Name of śiva- View this entry on the original dictionary page scan.
bhaveśam. of a king (father of hara-siṃha-) View this entry on the original dictionary page scan.
bhaveśam. of two authors View this entry on the original dictionary page scan.
bhāveśaphalan. Name of work View this entry on the original dictionary page scan.
bhaviṣyadākṣepam. an objection with regard to the future View this entry on the original dictionary page scan.
bhavocchedam. equals va-ccheda- View this entry on the original dictionary page scan.
bhayahetum. cause for fear, danger View this entry on the original dictionary page scan.
bhayānakarasanirdeśam. Name of chapter of View this entry on the original dictionary page scan.
bhayeḍakam. a wild ram View this entry on the original dictionary page scan.
bhedaetc. See p.766. View this entry on the original dictionary page scan.
bheḍam. a ram (see eḍa-, bheḍra-and bheṇḍa-) View this entry on the original dictionary page scan.
bheḍam. a raft, float (see bhela-) View this entry on the original dictionary page scan.
bheḍam. Name of a lexicographer and a physician View this entry on the original dictionary page scan.
bheḍam. of a ṛṣi- View this entry on the original dictionary page scan.
bhedam. ( bhid-) breaking, splitting, cleaving, rending, tearing, piercing (also pass. the being broken etc.) etc. View this entry on the original dictionary page scan.
bhedam. breaking open, disclosing, divulging, betrayal (of a secret see rahasya-bh-) View this entry on the original dictionary page scan.
bhedam. bursting asunder, opening, gaping, parting asunder View this entry on the original dictionary page scan.
bhedam. bursting forth or out, expanding, blossoming, shooting out, sprouting View this entry on the original dictionary page scan.
bhedam. a cleft, fissure, chasm (see śilā-bh-; dual number pudendum muliebre) View this entry on the original dictionary page scan.
bhedam. rupture, breach, hurt, injury, seduction View this entry on the original dictionary page scan.
bhedam. shooting pain (in the limbs), paralysis (see ardhabh-) View this entry on the original dictionary page scan.
bhedam. separation, division, partition, part, portion View this entry on the original dictionary page scan.
bhedam. distinction, difference, kind, sort, species, variety etc. View this entry on the original dictionary page scan.
bhedam. disturbance, interruption, violation, dissolution View this entry on the original dictionary page scan.
bhedam. disuniting, winning over to one's side by sowing dissension (see upāya-) View this entry on the original dictionary page scan.
bhedam. disunion, schism, dissension between (instrumental case) or in (compound) View this entry on the original dictionary page scan.
bhedam. change, alteration, modification View this entry on the original dictionary page scan.
bhedam. contraction (see bhrūbh-)
bhedam. evacuation (of the bowels) View this entry on the original dictionary page scan.
bhedam. (in astronomy) a particular crossing or conjunction of the planets View this entry on the original dictionary page scan.
bhedam. one of the ways in which an eclipse ends (see kukṣi-bh-) View this entry on the original dictionary page scan.
bhedam. (in mathematics) the hypothenuse of a right-angled triangle View this entry on the original dictionary page scan.
bhedam. (in dramatic language) equals saṃhati-bhedana-, or equals protsāhana-, View this entry on the original dictionary page scan.
bhedam. (in philosophy) dualism, duality (see compound) View this entry on the original dictionary page scan.
bhedam. Name of a man View this entry on the original dictionary page scan.
bhedam. plural Name of a people View this entry on the original dictionary page scan.
bhedābhedam. disunion and union, dualism and non-dualism View this entry on the original dictionary page scan.
bhedābhedavādinm. a maintainer of the doctrine both of the difference and the identity of God and the Universe View this entry on the original dictionary page scan.
bhedabuddhif. perception or idea of a difference or distinction View this entry on the original dictionary page scan.
bhedadarpaṇam. "mirror of duality", Name of work View this entry on the original dictionary page scan.
bhedadarśinmfn. equals -dṛṣṭi- View this entry on the original dictionary page scan.
bhedadhikkāram. "refutation of duality", Name of a vedānta- work by nṛsiṃhāśrama- View this entry on the original dictionary page scan.
bhedadhikkāranyakkārahuṃkṛtif. Name of work View this entry on the original dictionary page scan.
bhedadhikkāranyakkāranirūpaṇan. Name of work View this entry on the original dictionary page scan.
bhedadhikkārasatkriyāf. Name of work View this entry on the original dictionary page scan.
bhedadhikkṛtif. (in compound) equals -dhik-kāra- View this entry on the original dictionary page scan.
bhedadhikkṛtitattvanivecanan. Name of work View this entry on the original dictionary page scan.
bhedadīpikāf. "illustration of duality", Name of work View this entry on the original dictionary page scan.
bhedadṛṣṭimfn. viewing or holding the Universe and the deity to be different and distinct View this entry on the original dictionary page scan.
bheḍagirim. Name of a mountain View this entry on the original dictionary page scan.
bhedakamfn. breaking into or through, piercing, perforating View this entry on the original dictionary page scan.
bhedakamfn. diverting (water-courses) View this entry on the original dictionary page scan.
bhedakamfn. destroying (boundary-marks) View this entry on the original dictionary page scan.
bhedakamfn. seducing (ministers) View this entry on the original dictionary page scan.
bhedakamfn. making a difference, distinguishing, determining, defining. View this entry on the original dictionary page scan.
bhedakan. a determinative id est an adjective (see bhedya-). View this entry on the original dictionary page scan.
bhedakaramf(ī-)n. breaking through or down View this entry on the original dictionary page scan.
bhedakaramf(ī-)n. sowing dissension among or in (genitive case or compound) View this entry on the original dictionary page scan.
bhedakārinmfn. causing dissension or disunion View this entry on the original dictionary page scan.
bhedakārinmfn. making or showing a difference, altered View this entry on the original dictionary page scan.
bhedakhaṇḍanan. "refutation of duality", Name of a vedānta- work View this entry on the original dictionary page scan.
bhedakṛtmfn. equals -kara- View this entry on the original dictionary page scan.
bhedanaetc. See p.766.
bhedanamfn. breaking, cleaving, splitting, rending, piercing, dividing, separating etc. View this entry on the original dictionary page scan.
bhedanamfn. (in fine compositi or 'at the end of a compound') causing to flow, giving free course (to a river) View this entry on the original dictionary page scan.
bhedanamfn. causing pain in the joints or limbs View this entry on the original dictionary page scan.
bhedanamfn. loosening (the faeces), cathartic, purgative View this entry on the original dictionary page scan.
bhedanamfn. destroying, dissolving, relieving (see hṛdaya-granthi-bh-) View this entry on the original dictionary page scan.
bhedanam. a hog View this entry on the original dictionary page scan.
bhedanam. Rumex Vesicarius View this entry on the original dictionary page scan.
bhedanan. the act of breaking, cleaving etc. etc. View this entry on the original dictionary page scan.
bhedanan. bursting, parting asunder, breach, fracture View this entry on the original dictionary page scan.
bhedanan. the passing (through an asterism) View this entry on the original dictionary page scan.
bhedanan. disclosure, betrayal (of a secret) View this entry on the original dictionary page scan.
bhedanan. embroilment, disunion, discord View this entry on the original dictionary page scan.
bhedanan. discrimination View this entry on the original dictionary page scan.
bhedanan. a purgative View this entry on the original dictionary page scan.
bhedanan. Asa Foetida View this entry on the original dictionary page scan.
bhedanīkaSee ghaṭa-bho-. View this entry on the original dictionary page scan.
bhedanīyamfn. to be broken or split or cleft or divided ( bhedanīyatā -- f. ) View this entry on the original dictionary page scan.
bhedanīyamfn. causing the secretion of bad humours View this entry on the original dictionary page scan.
bhedanīyatāf. bhedanīya
bhedaprakāram. Name of work View this entry on the original dictionary page scan.
bhedaprakāśam. Name of work View this entry on the original dictionary page scan.
bhedapratyayam. belief in dualism (see -dṛṣṭi-) View this entry on the original dictionary page scan.
bheḍaram. Name of an agra-hāra- View this entry on the original dictionary page scan.
bhedasahamfn. capable of being disunited or seduced View this entry on the original dictionary page scan.
bheḍasaṃhitāf. Name of work View this entry on the original dictionary page scan.
bhedatasind. separately, singly, individually View this entry on the original dictionary page scan.
bhedatasind. according to difference or diversities View this entry on the original dictionary page scan.
bhedavādinm. one who maintains the duality of God and the Universe View this entry on the original dictionary page scan.
bhedavādinm. Name of commentator or commentary on View this entry on the original dictionary page scan.
bhedavādividāriṇīf. Name of work View this entry on the original dictionary page scan.
bhedavibhīṣikāf. Name of work View this entry on the original dictionary page scan.
bhedavidhim. the faculty of discriminating or discerning (between two different objects) View this entry on the original dictionary page scan.
bheḍīf. a ewe View this entry on the original dictionary page scan.
bheḍīf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
bhedikāf. the act of breaking down or asunder, destruction, annihilation View this entry on the original dictionary page scan.
bhedinmfn. breaking, splitting, piercing, perforating etc. View this entry on the original dictionary page scan.
bhedinmfn. beating or knocking out (See dvi-netra-bh-) View this entry on the original dictionary page scan.
bhedinmfn. shaking, penetrating View this entry on the original dictionary page scan.
bhedinmfn. causing to flow (as juice) View this entry on the original dictionary page scan.
bhedinmfn. loosening (the bowels), cathartic, purgative View this entry on the original dictionary page scan.
bhedinmfn. breaking, violating (an agreement etc.) View this entry on the original dictionary page scan.
bhedinmfn. interrupting (devotion) View this entry on the original dictionary page scan.
bhedinmfn. disturbing (a country) View this entry on the original dictionary page scan.
bhedinmfn. dividing, separating from (ablative) View this entry on the original dictionary page scan.
bhedinmfn. (fr. bheda-) having a distinction or division View this entry on the original dictionary page scan.
bhedinmfn. (in philosophy) one who separates spirit and matter or holds the doctrine of dualism View this entry on the original dictionary page scan.
bhedinm. Rumex Vesicarius View this entry on the original dictionary page scan.
bhedinīf. (with tāntrika-s) Name of a particular śakti- View this entry on the original dictionary page scan.
bhediran. equals bhidira-, a thunderbolt View this entry on the original dictionary page scan.
bheditamfn. (fr. Causal) broken, split, cleft etc. View this entry on the original dictionary page scan.
bheditamfn. (in fine compositi or 'at the end of a compound') divided into View this entry on the original dictionary page scan.
bheditvan. separation, division, parting asunder View this entry on the original dictionary page scan.
bhedīyaSee doṣa-bh-. View this entry on the original dictionary page scan.
bhedojjīvanan. Name of work View this entry on the original dictionary page scan.
bhedoktijīvana n. Name of work View this entry on the original dictionary page scan.
bhedonmukhamf(ī-)n. just about to burst into blossom View this entry on the original dictionary page scan.
bheḍram. a ram View this entry on the original dictionary page scan.
bhedyamfn. to be broken or split or pierced or perforated View this entry on the original dictionary page scan.
bhedyamfn. to be cut or opened View this entry on the original dictionary page scan.
bhedyamfn. to be set at variance or disunited View this entry on the original dictionary page scan.
bhedyamfn. to be divided or penetrated or betrayed or refuted (See a--, dur--, nir-bh-) View this entry on the original dictionary page scan.
bhedyamfn. to be (or being) determined View this entry on the original dictionary page scan.
bhedyan. a substantive (see bhedaka-).
bhedyakaSee utpala-bh-. View this entry on the original dictionary page scan.
bhedyaliṅgamfn. distinguished by gender View this entry on the original dictionary page scan.
bhedyarogam. any disease treated by incision or cutting View this entry on the original dictionary page scan.
bhekam. (probably onomatopoetic (i.e. formed from imitation of sounds);but see ) a frog etc. (according to to the croaking of frogs was caused by the curse of agni- who was betrayed by them to the gods when he took refuge in the water) View this entry on the original dictionary page scan.
bhekam. a cloud View this entry on the original dictionary page scan.
bhekam. a timid man (equals bhīru-) (see bhela-) View this entry on the original dictionary page scan.
bhekam. Name of a niṣāda- and a brāhmaṇī- View this entry on the original dictionary page scan.
bhekabhujm. "frog-eater", a snake View this entry on the original dictionary page scan.
bhekaparṇīf. "frog-leaved", a species of plant View this entry on the original dictionary page scan.
bhekaśabdam. the croaking of frogs View this entry on the original dictionary page scan.
bhef. a female frog Hydrocotyle Asiatica View this entry on the original dictionary page scan.
bhekīpatim. a male frog View this entry on the original dictionary page scan.
bhekurif. Name of a class of apsaras- (see bākura-and bhākuri-). View this entry on the original dictionary page scan.
bhelamfn. (only ) timid View this entry on the original dictionary page scan.
bhelamfn. foolish, ignorant View this entry on the original dictionary page scan.
bhelamfn. till View this entry on the original dictionary page scan.
bhelamfn. active, restless View this entry on the original dictionary page scan.
bhelamfn. (also laka-) equals laghiṣṭha- View this entry on the original dictionary page scan.
bhelam. a species of small tiger View this entry on the original dictionary page scan.
bhelam. (also bhelaka laka- mn.) a raft, boat View this entry on the original dictionary page scan.
bhelam. Name of a physician (see bheḍa-). View this entry on the original dictionary page scan.
bhelakamn. bhela
bhelanan. swimming View this entry on the original dictionary page scan.
bhelum. or n. (?) a particular high number View this entry on the original dictionary page scan.
bhelukam. śiva-'s servant View this entry on the original dictionary page scan.
bhelūpurāf. Name of a suburb of Benares (?) View this entry on the original dictionary page scan.
bhempuran. Name of a grāma- View this entry on the original dictionary page scan.
bhenam. "lord of stars", the sun or the moon View this entry on the original dictionary page scan.
bhena bh/eśa- See under 4. bha-, p.742. View this entry on the original dictionary page scan.
bheṇḍam. idem or 'm. a ram ' (see bhaiṇḍaka-). View this entry on the original dictionary page scan.
bheṇḍāf. Abelmoschus Esculentus (bheṇḍā-also"lotus-seed") View this entry on the original dictionary page scan.
bheṇḍīf. Abelmoschus Esculentus View this entry on the original dictionary page scan.
bheṇḍītakam. Abelmoschus Esculentus View this entry on the original dictionary page scan.
bheram. ( bhī-?) a kettle-drum View this entry on the original dictionary page scan.
bhef. (rarely ri-) a kettle-drum View this entry on the original dictionary page scan.
bherībhāṃkāram. idem or 'm. the sound of a kettle-drum ' View this entry on the original dictionary page scan.
bherībhāṃkāram. Name of a poet ( bherībhāṃkārīya rīya- n.his work) View this entry on the original dictionary page scan.
bherībhāṃkārīyan. bherībhāṃkāra
bherībhramakam. supposed Name of a poet View this entry on the original dictionary page scan.
bherīghnatm. "striking a kettle-drum", a kettle-drummer View this entry on the original dictionary page scan.
bherīnādam. the sound of a kettle-drum View this entry on the original dictionary page scan.
bherīśaṅkhavādamfn. sounding the drum and conch-shell, View this entry on the original dictionary page scan.
bherīsvanamahāsvanāf. "loud-sounding like the sound of a kettle-drum", Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
bherītādaṇan. "drum-beating", Name of work View this entry on the original dictionary page scan.
bherotsaSee puṣpa-bh-. View this entry on the original dictionary page scan.
bheruṇḍamf(ā-)n. (often varia lectio bheraṇḍa-) terrible, formidable, awful View this entry on the original dictionary page scan.
bheruṇḍam. a species of bird View this entry on the original dictionary page scan.
bheruṇḍam. (also ḍaka-) a beast of prey (wolf, jackal, fox, or hyena) (see pheru-) View this entry on the original dictionary page scan.
bheruṇḍam. a particular form of śiva- (?) View this entry on the original dictionary page scan.
bheruṇḍāf. Name of a goddess (equals kālī-) View this entry on the original dictionary page scan.
bheruṇḍam. of a yakṣiṇī- View this entry on the original dictionary page scan.
bheruṇḍan. ( bhṛ-?) pregnancy View this entry on the original dictionary page scan.
bhe cl.1 P. A1. bheṣati-, te-, to fear, dread (others"to move, go") see bhī-, bhyas-. View this entry on the original dictionary page scan.
bheśam. the regent of an asterism etc. View this entry on the original dictionary page scan.
bheṣajamf(ī-)n. (fr. 1. bhiṣaj-) curing, healing, sanative View this entry on the original dictionary page scan.
bheṣajan. a remedy, medicine, medicament, drug, remedy against (genitive case or compound) etc. View this entry on the original dictionary page scan.
bheṣajan. a spell or charm for curative purposes (generally from atharva-- veda-) View this entry on the original dictionary page scan.
bheṣajan. water View this entry on the original dictionary page scan.
bheṣajan. Nigella Indica View this entry on the original dictionary page scan.
bheṣajabhakṣaṇan. "drug-eating", the act of taking medicine View this entry on the original dictionary page scan.
bheṣajacandram. "moon of medicine", Name of a man View this entry on the original dictionary page scan.
bheṣajāgāran. "medicine-room", a druggist's or apothecary's shop View this entry on the original dictionary page scan.
bheṣajakalpam. Name of work View this entry on the original dictionary page scan.
bheṣajakalpasārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bheṣajakaraṇan. preparation of drugs or medicine View this entry on the original dictionary page scan.
bheṣajakṛtamfn. healed, cured View this entry on the original dictionary page scan.
bheṣajāṅgan. anything taken with or after medicine (as water gruel) View this entry on the original dictionary page scan.
bheṣajasarvasvan. Name of work View this entry on the original dictionary page scan.
bheṣajatā(j/a--) f. curativeness, healing power View this entry on the original dictionary page scan.
bheṣajatarkam. Name of work View this entry on the original dictionary page scan.
bheṣajavīryan. the healing power of medicine View this entry on the original dictionary page scan.
bheṣajyamf(-)n. curative, sanitary View this entry on the original dictionary page scan.
bheṭakam. buying, purchase View this entry on the original dictionary page scan.
bhetāla equals vetāla- View this entry on the original dictionary page scan.
bhetavyamfn. to be feared or dreaded (n. often impersonal or used impersonally, especially na bhetavyam-,with abl, or genitive case,"one need not be afraid of") View this entry on the original dictionary page scan.
bhetavyaSee . View this entry on the original dictionary page scan.
bhettavai bhettavya-, bhettṛ- See under bhid-, . View this entry on the original dictionary page scan.
bhettavyamfn. to be broken or split View this entry on the original dictionary page scan.
bhettavyamfn. to be betrayed or divulged View this entry on the original dictionary page scan.
bhettṛmfn. breaking, splitting, bursting through, piercing View this entry on the original dictionary page scan.
bhettṛmfn. a breaker etc. etc., etc. View this entry on the original dictionary page scan.
bhettṛmfn. a conqueror View this entry on the original dictionary page scan.
bhettṛmfn. an interrupter, disturber, frustrator View this entry on the original dictionary page scan.
bhettṛmfn. a divulger, betrayer View this entry on the original dictionary page scan.
bhettṛmfn. a factious or seditious man View this entry on the original dictionary page scan.
bhettṛm. Name of skanda- View this entry on the original dictionary page scan.
bhettṛm. Name of a particular magical spell recited over weapons View this entry on the original dictionary page scan.
bheyamfn. equals prec. (n. impersonal or used impersonally with ablative exempli gratia, 'for example' arer bheyam-"one must fear an enemy") View this entry on the original dictionary page scan.
bheyaSee . View this entry on the original dictionary page scan.
bheyapāla(?) m. Name of a prince View this entry on the original dictionary page scan.
bhidelimamfn. easily broken, brittle, fragile (see Va1rtt. 1 ) View this entry on the original dictionary page scan.
bhikṣopabheginmfn. living on alms, View this entry on the original dictionary page scan.
bhillīcakreśvaram. Name of viṣṇu- View this entry on the original dictionary page scan.
bhīmadevam. Name of authors View this entry on the original dictionary page scan.
bhīmādevam. Name of two men View this entry on the original dictionary page scan.
bhīmasenam. (bhīm/a--) "having a formidable army", Name of a deva-gandharva- View this entry on the original dictionary page scan.
bhīmasenam. of a yakṣa- View this entry on the original dictionary page scan.
bhīmasenam. of the second son of pāṇḍu- (see bhīm/a-) View this entry on the original dictionary page scan.
bhīmasenam. of various other men etc. View this entry on the original dictionary page scan.
bhīmasenam. a kind of camphor View this entry on the original dictionary page scan.
bhīmasenamayamfn. consisting of bhīma-sena- View this entry on the original dictionary page scan.
bhīmavegamfn. of fearful speed View this entry on the original dictionary page scan.
bhīmavegam. Name of a dānava- View this entry on the original dictionary page scan.
bhīmavegam. of one of the sons of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
bhīmavegaravamfn. possessing terrific velocity and giving a terrific sound View this entry on the original dictionary page scan.
bhīmavegaravam. Name of one of the sons of dhṛtarāṣṭra- View this entry on the original dictionary page scan.
bhīmeśan. Name of a place sacred to śiva- View this entry on the original dictionary page scan.
bhīmeśvaran. idem or 'n. Name of a place sacred to śiva- ' View this entry on the original dictionary page scan.
bhīmeśvarabhaṭṭam. Name of an author View this entry on the original dictionary page scan.
bhīmeśvaramāhātmyan. Name of work View this entry on the original dictionary page scan.
bhīmeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
bhinnadehamfn. "whose body is pierced", wounded View this entry on the original dictionary page scan.
bhinnadeśamfn. occurring or happening in various places View this entry on the original dictionary page scan.
bhinnadeśatvan. View this entry on the original dictionary page scan.
bhinnakleśamfn. one in whom the (Buddhistic) kleśa-s (sub voce, i.e. the word in the Sanskrit order) are destroyed View this entry on the original dictionary page scan.
bhinnakleśatvan.
bhīrucetasm. "timid-hearted", a deer View this entry on the original dictionary page scan.
bhle(varia lectio for bhreṣ-) View this entry on the original dictionary page scan.
bhogadeham. "the body of feeling"(the intermediate body which a dead person acquires through the śrāddha- after cremation, and with which, according to his works, he either enjoys happiness or suffers misery see adhiṣṭhāna-d-, sambhogakāya-) View this entry on the original dictionary page scan.
bhogadevam. Name of a man View this entry on the original dictionary page scan.
bhogasenam. Name of a man View this entry on the original dictionary page scan.
bhogeśvaratīrthan. Name of a sacred bathing-place (wrong reading for bhogīśv-?) . View this entry on the original dictionary page scan.
bhojadevam. Name of a celebrated king of dhārā- (who was a great patron of learning at the beginning of the 11th century, and is the reputed author of several works., especially of a commentator or commentary on the yoga-sūtra-s see ) etc. View this entry on the original dictionary page scan.
bhojadevam. of a king of kaccha- View this entry on the original dictionary page scan.
bhojadevaśabdānuśāsanan. Name of work View this entry on the original dictionary page scan.
bhojanarendram. Name of bhoja-deva-, king of dhārā- View this entry on the original dictionary page scan.
bhojanavef. plural course or act of eating, a meal View this entry on the original dictionary page scan.
bhojanavef. meal-time View this entry on the original dictionary page scan.
bhojanaviśeṣam. choice food, a dainty, delicacy View this entry on the original dictionary page scan.
bhojendram. a king of the bhoja-s View this entry on the original dictionary page scan.
bhoṭadeśam. the country of bhoṭa- View this entry on the original dictionary page scan.
bhramaṇārtheind. for the sake of travelling View this entry on the original dictionary page scan.
bhramaradevam. Name of a poet View this entry on the original dictionary page scan.
bhramarāmbākṣetran. "the bee-mother's id est durgā-'s district ", Name of the Kanara coast (see bhrāmarī-) View this entry on the original dictionary page scan.
bhramarāmbākṣetramāhātmyan. Name of work View this entry on the original dictionary page scan.
bhramarasadṛśakeśatāf. having hair dark like a bee (one of the 80 minor marks of a buddha-) View this entry on the original dictionary page scan.
bhramarasaṃdeśakāvyan. equals -dūta-k-, q.v View this entry on the original dictionary page scan.
bhramareṣṭam. "loved by bees", a sort of Bignonia View this entry on the original dictionary page scan.
bhramareṣṭāf. Clerodendrum Siphonantus View this entry on the original dictionary page scan.
bhramareṣṭaf. equals bhūmi-jambū- View this entry on the original dictionary page scan.
bhrāntākulitacetanamfn. one whose mind is troubled by doubt or error View this entry on the original dictionary page scan.
bhrāṣṭreyam. plural Name of a family (varia lectio tra-kṛt-). View this entry on the original dictionary page scan.
bhrāstreya varia lectio for bhrāṣṭreya-, . View this entry on the original dictionary page scan.
bhrātreyam. equals prec. m. View this entry on the original dictionary page scan.
bhrātṛvyadevatyamf(-)n. having a rivals for a deity View this entry on the original dictionary page scan.
bhrātṛvyadevatyamf(-)n. (ty/a-) View this entry on the original dictionary page scan.
bhrauveyam. metron, fr. bhrū- View this entry on the original dictionary page scan.
bhrauveyaSee above. View this entry on the original dictionary page scan.
bhrej (allied to1. bhrāj-) cl.1 A1. bhrāj- (perfect tense bibhreje-etc.) , to shine, glitter : Causal bhrejayati- (Aorist abibhrejat-) grammar View this entry on the original dictionary page scan.
bhre (allied to bhraṃś-and hreṣ-) cl.1 P. A1. () bhreṣati-, te- (perfect tense bibreṣa-, ṣe-etc. grammar), to totter, waver, slip, make a false step ; to be angry ; to fear ; to go (gatau- ) View this entry on the original dictionary page scan.
bhreṣam. tottering, slipping, going astray or amiss, failure View this entry on the original dictionary page scan.
bhreṣam. loss, deprivation View this entry on the original dictionary page scan.
bhreṣan. the act of going, moving etc. View this entry on the original dictionary page scan.
bhṛgudevam. Name of an author View this entry on the original dictionary page scan.
bhṛgudevatamfn. worshipping the bhṛgu-s View this entry on the original dictionary page scan.
bhṛgukṣetran. Name of a place View this entry on the original dictionary page scan.
bhṛgukṣetramāhātmyan. Name of wk View this entry on the original dictionary page scan.
bhṛguśreṣṭham. "best of bhṛgu-s", Name of paraśu-rāma- View this entry on the original dictionary page scan.
bhṛṅgeriṭim. () equals bhṛngariṭi- q.v View this entry on the original dictionary page scan.
bhṛṅgeśasaṃhitāf. Name of work View this entry on the original dictionary page scan.
bhṛṅgeṣṭāf. "liked by bees", Name of several plants (Aloe Indica;Clerodendrum Siphonanthus; equals kākajambū-; equals taruṇī-) View this entry on the original dictionary page scan.
bhṛśavedanāf. violent pain View this entry on the original dictionary page scan.
bhrūbhedam. idem or 'm. equals -kuṭī- ' View this entry on the original dictionary page scan.
bhrūbhedinmfn. frowning, attended with frowns View this entry on the original dictionary page scan.
bhrūkṣepam. equals -kuṭī- (also bhrūkṣepaṇa paṇa- n. ) View this entry on the original dictionary page scan.
bhrūkṣepajihman. (with vilocana-) a side look with contracted brows View this entry on the original dictionary page scan.
bhrūkṣepālāpam. the language of frowns View this entry on the original dictionary page scan.
bhrūkṣepaṇan. bhrūkṣepa
bhrūlatākṣepam. equals bhrū-kṣ- View this entry on the original dictionary page scan.
bhrūvibheda() m. idem or 'n. the bending or knitting of the brows, .' View this entry on the original dictionary page scan.
bhrūviceṣṭitan. playful movement of the eyebrows View this entry on the original dictionary page scan.
bhrūvikṣepam. equals kṣepa-. View this entry on the original dictionary page scan.
bhrūvikṣepamind. with a frown View this entry on the original dictionary page scan.
bhūdevam. a divinity upon earth, a Brahman (see -sura-) View this entry on the original dictionary page scan.
bhūdevam. Name of śiva- View this entry on the original dictionary page scan.
bhūdevam. of various men View this entry on the original dictionary page scan.
bhūdevaśuklam. Name of a poetry or poetic View this entry on the original dictionary page scan.
bhūdharevaram. "mountain-lord", Name of hima-vat- View this entry on the original dictionary page scan.
bhūgehan. an underground room View this entry on the original dictionary page scan.
bhugnanetramfn. accompanied by distortion of the eyes (as a fever) View this entry on the original dictionary page scan.
bhujagendram. "serpent-king", a large serpent View this entry on the original dictionary page scan.
bhujageśvaram. "serpent-lord", Name of śeṣa- View this entry on the original dictionary page scan.
bhujaṃgendram. the king of snakes View this entry on the original dictionary page scan.
bhujaṃgeritan. a kind of metre View this entry on the original dictionary page scan.
bhujaṃgeśam. "species-lord", Name of piṅgala-. View this entry on the original dictionary page scan.
bhujāṃsadeśam. the upper end of the arm, . View this entry on the original dictionary page scan.
bhūkeśam. (only ) "earth-hair", the Indian fig-tree View this entry on the original dictionary page scan.
bhūkeśam. Blyxa Octandra View this entry on the original dictionary page scan.
bhūkeśāf. a rākṣasī- View this entry on the original dictionary page scan.
bhūkeśīf. Vernonia Anthelminthica. View this entry on the original dictionary page scan.
bhuktamātreind. immediately on having eaten View this entry on the original dictionary page scan.
bhuktaśeṣan. the remnants of a meal, leavings (also ṣaka- ) View this entry on the original dictionary page scan.
bhuktaśeṣan. left from a meal View this entry on the original dictionary page scan.
bhuktavatvajjaneind. when people have eaten their meal View this entry on the original dictionary page scan.
bhūmahendram. a prince, king View this entry on the original dictionary page scan.
bhūmibhedinmfn. differing from (what exists on) earth View this entry on the original dictionary page scan.
bhūmidevam. "earth-god", a Brahman etc. View this entry on the original dictionary page scan.
bhūmidef. Name of various women View this entry on the original dictionary page scan.
bhūmilepanan. "earth-ointment", cow-dung View this entry on the original dictionary page scan.
bhūmisaṃniveśam. the general appearance or configuration of a country View this entry on the original dictionary page scan.
bhūmisenam. Name of one of the sons of the 10th manu- View this entry on the original dictionary page scan.
bhūmisenam. of a scholar View this entry on the original dictionary page scan.
bhūmyekadeśam. one portion of territory View this entry on the original dictionary page scan.
bhūnetṛm. "earth-leader", a king, prince View this entry on the original dictionary page scan.
bhūpativeśmann. a king's palace View this entry on the original dictionary page scan.
bhūrbhuveśvaratīrthan. Name of tīrtha-s View this entry on the original dictionary page scan.
bhūrijyeṣṭham. Name of a son of king vicakṣus- View this entry on the original dictionary page scan.
bhūriphef. a species of plant (equals saptalā-) View this entry on the original dictionary page scan.
bhūripremanm. "full of affection", Anas Casarca View this entry on the original dictionary page scan.
bhūriretas(bh/ūri--) mfn. abounding in seed, prolific View this entry on the original dictionary page scan.
bhūriṣeṇam. (fr. senā-) "having many armies"Name of a man View this entry on the original dictionary page scan.
bhūriṣeṇam. of a son of the 10th manu- View this entry on the original dictionary page scan.
bhūriṣeṇam. of king śaryāti- View this entry on the original dictionary page scan.
bhūriśreṣṭhakaor
bhūriśreṣṭhikam. or n. (?) Name of a place near Benares View this entry on the original dictionary page scan.
bhūritejasmfn. of great splendour, very glorious View this entry on the original dictionary page scan.
bhūritejasm. Name of a prince View this entry on the original dictionary page scan.
bhūritejasamfn. equals prec. mfn. (said of fire) View this entry on the original dictionary page scan.
bhūrivetasamfn. having many canes or reeds View this entry on the original dictionary page scan.
bhūṣaṇadevam. Name of a poet View this entry on the original dictionary page scan.
bhūṣaṇapeṭikāf. a jewel-casket View this entry on the original dictionary page scan.
bhūṣaṇendraprabham. Name of a king of the kiṃ-nara-s View this entry on the original dictionary page scan.
bhūṣāpeṭīf. a jewel-case
bhūśelum. the plant Cordia Myxa View this entry on the original dictionary page scan.
bhūtabhavyeśam. the lord of past and future View this entry on the original dictionary page scan.
bhūtakeśam. Corydalis Goveniana (also n.andf(ī-).) View this entry on the original dictionary page scan.
bhūtakesarāf. Trigonella Foenum Graecum View this entry on the original dictionary page scan.
bhūtakeśīf. a species of plant (L Nardostachys Jatamansi, Vitex Negundo and white basil) . View this entry on the original dictionary page scan.
bhūtaketum. Name of a son of manu- dakṣa-sāvarṇi- View this entry on the original dictionary page scan.
bhūtaketum. of a vetāla- View this entry on the original dictionary page scan.
bhūtamaheśvaram. equals -bhartṛ- View this entry on the original dictionary page scan.
bhūtamātṛtetsavan. (!) a particular festival View this entry on the original dictionary page scan.
bhūtapratiṣedham. the warding off evil spirits or demons View this entry on the original dictionary page scan.
bhūtapretapiśācādyam. plural the bhūta-s, preta-s, piśāca-s etc. (see ) . View this entry on the original dictionary page scan.
bhūtapuremāhātmyan. Name of work View this entry on the original dictionary page scan.
bhūtāveśam. demoniac possession View this entry on the original dictionary page scan.
bhūtaveṣīf. a white-flowering Vitex Negundo View this entry on the original dictionary page scan.
bhūtavivekam. Name of work View this entry on the original dictionary page scan.
bhūtechadf. plural Name of View this entry on the original dictionary page scan.
bhūtejyamfn. worshipping the bhūta-s or demons (see bhūta-yajña-). View this entry on the original dictionary page scan.
bhūtendriyajayinm. "one who has subdued both the elements (of the body) and the senses", a kind of ascetic or devotee View this entry on the original dictionary page scan.
bhūteśam. "lord of beings", Name of brahmā- or kṛṣṇa- View this entry on the original dictionary page scan.
bhūteśam. of the Sun View this entry on the original dictionary page scan.
bhūteśam. "lord of evil beings", Name of śiva- View this entry on the original dictionary page scan.
bhūteṣṭāf. "liked by the bhūta-s", Name of the 14th day of a half-month View this entry on the original dictionary page scan.
bhūteṣṭakāf. a particular kind of brick View this entry on the original dictionary page scan.
bhūteśvaram. "lord of (evil) beings", Name of śiva- View this entry on the original dictionary page scan.
bhūtopadeśam. referring to anything already occurring or existing View this entry on the original dictionary page scan.
bhuṭṭeśvaram. Name of a temple built by bhuṭṭa- View this entry on the original dictionary page scan.
bhuvanapraṇetṛm. "leader of being", Time (personified as the Creator) View this entry on the original dictionary page scan.
bhuvaneśam. lord of the world View this entry on the original dictionary page scan.
bhuvaneśam. Name of a rudra- View this entry on the original dictionary page scan.
bhuvaneśam. of a place View this entry on the original dictionary page scan.
bhuvaneśānīf. the mistress of the world View this entry on the original dictionary page scan.
bhuvaneśīf. Name of a goddess View this entry on the original dictionary page scan.
bhuvaneśīpārijātam. Name of work View this entry on the original dictionary page scan.
bhuvaneśīyantran. Name of a mystical diagram View this entry on the original dictionary page scan.
bhuvaneṣṭhāmfn. being in the world or in all existing things View this entry on the original dictionary page scan.
bhuvaneśvaram. "lord of the world", a prince, king View this entry on the original dictionary page scan.
bhuvaneśvaram. Name of śiva- View this entry on the original dictionary page scan.
bhuvaneśvaram. of an author View this entry on the original dictionary page scan.
bhuvaneśvaran. Name of a temple and city sacred to śiva- View this entry on the original dictionary page scan.
bhuvaneśvaramāhātmyan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīf. See below View this entry on the original dictionary page scan.
bhuvaneśvarīf. "mistress of the world", Name of various goddesses View this entry on the original dictionary page scan.
bhuvaneśvarīdaṇḍakamn. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīdīpadānan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīkakṣapuṭatantran. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīkalpam. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīkavacan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīpaddhatif. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīpañcāṅgan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīpaṭalan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīpūjāyantran. Name of a mystical diagram View this entry on the original dictionary page scan.
bhuvaneśvarīrahasyan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīsahasranāmann. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīsahasranāmastotran. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīśāntiprayogam. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīstotran. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīvarivasyārahasyan. Name of work View this entry on the original dictionary page scan.
bhuvaneśvaryarcanapaddhatif. Name of work View this entry on the original dictionary page scan.
bhūyastvenaind. for the most part, mostly View this entry on the original dictionary page scan.
bhūyiṣṭhenaind. mostly etc. View this entry on the original dictionary page scan.
bibhedayiṣumfn. (fr. Desiderative of Causal) desirous of dividing or disuniting View this entry on the original dictionary page scan.
bījapeśikāf. "semen-receptacle", the scrotum View this entry on the original dictionary page scan.
bījarecanan. Croton Jamalgota View this entry on the original dictionary page scan.
bījasektṛm. "sprinkler of seed", a generator on View this entry on the original dictionary page scan.
bījaśeṣamātran. nothing but seed as a remainder. View this entry on the original dictionary page scan.
bileśayamfn. and m. equals bila-ś- View this entry on the original dictionary page scan.
bileśayam. also Name of a teacher of the haṭha-vidyā- View this entry on the original dictionary page scan.
bilevāsinmfn. and m. equals bila-v- View this entry on the original dictionary page scan.
bilvapef. the dried shell of the bilva- fruit View this entry on the original dictionary page scan.
bilvapeśikā f. the dried shell of the bilva- fruit View this entry on the original dictionary page scan.
bilvatejasm. Name of a serpent-demon View this entry on the original dictionary page scan.
bilveśvaramāhātmyan. Name of work View this entry on the original dictionary page scan.
bilvodakeśvaram. Name of a temple of śiva- View this entry on the original dictionary page scan.
bimbeśvaram. Name of a temple founded by the princess bimbā- View this entry on the original dictionary page scan.
bindubhedam. Name of a particular yoga- posture View this entry on the original dictionary page scan.
bindudevam. equals ṇa-, a Buddhist deity View this entry on the original dictionary page scan.
bindudevam. Name of śiva- View this entry on the original dictionary page scan.
bindurekhāf. a row or line of points or dots View this entry on the original dictionary page scan.
bindurekhāf. Name of a daughter of caṇḍavarman- View this entry on the original dictionary page scan.
bindurekhakam. a kind of bird (see prec. and next) . View this entry on the original dictionary page scan.
bindusenam. Name of a king (son of kṣatraujas-) View this entry on the original dictionary page scan.
bisakisalayacchedapatheyavatmfn. having pieces of fibres of young lotus as provisions for a journey View this entry on the original dictionary page scan.
bleṣkam. a snare, noose for catching View this entry on the original dictionary page scan.
bodhendram. Name of an author View this entry on the original dictionary page scan.
bodheyam. plural Name of a Vedic school (see addhā-b-and baudheya-). View this entry on the original dictionary page scan.
bodhipakṣadharmanirdeśam. Name of work View this entry on the original dictionary page scan.
bodhisattvapakṣanirdeśam. Name of work View this entry on the original dictionary page scan.
bopadevaSee vopadeva-. View this entry on the original dictionary page scan.
brahmabileya(?) m. Name of a man View this entry on the original dictionary page scan.
brahmadevam. (also with paṇḍita-) Name of various authors View this entry on the original dictionary page scan.
brahmadeyamfn. given in marriage after the manner of Brahmans (see ) View this entry on the original dictionary page scan.
brahmadeyam. (with vidhi-) marriage of this kind View this entry on the original dictionary page scan.
brahmadeyan. instruction in the veda- or sacred knowledge ( brahmadeyānusaṃtāna nusaṃtāna-, mfn.one in whose family Vedic teachings;is hereditary [ brahmadeyātmasaṃtāna tma-saṃtāna-,"the son of a woman married according to the brāhma- rite"; see ātma-s-])
brahmadeyan. gift to Brahmans View this entry on the original dictionary page scan.
brāhmadeyamfn. equals brahma-d- mfn. (Bombay edition) on View this entry on the original dictionary page scan.
brahmadeyānusaṃtānamfn. brahmadeya
brahmadeyātmasaṃtānamfn. brahmadeya
brahmadveṣam. hatred of sacred knowledge or of Brahmans View this entry on the original dictionary page scan.
brahmadveṣinmfn. equals -dviṣ- View this entry on the original dictionary page scan.
brahmajñānopadeśam. Name of work View this entry on the original dictionary page scan.
brahmajyeṣṭham. (printed ṭhya-) the elder brother of brahmā- View this entry on the original dictionary page scan.
brahmajyeṣṭhamfn. having brahmā- as first or chief View this entry on the original dictionary page scan.
brahmajyeyan. the act of oppressing Brahmans View this entry on the original dictionary page scan.
brahmaketum. Name of a man View this entry on the original dictionary page scan.
brahmakileya(?) m. Name of a man View this entry on the original dictionary page scan.
brāhmakṛteyam. patronymic fr. brahma-kṛta- gaRa śubhrādi-.
brahmakṣetran. Name of a sacred district View this entry on the original dictionary page scan.
brahmalekham. " brahmā-'s writing" equals -rekhā- View this entry on the original dictionary page scan.
brahmamaṅgaladevatāf. Name of lakṣmī- View this entry on the original dictionary page scan.
brahmamedhyāf. Name of a river (see -bodhyā-). View this entry on the original dictionary page scan.
brahmamekhalam. Saccharum Munjia (of which the sacred thread of a Brahman is made) View this entry on the original dictionary page scan.
brāhmaṇacelam. cela
brāhmaṇadveṣinmfn. hating brāhmaṇa- View this entry on the original dictionary page scan.
brāhmaṇakṛteyam. patronymic fr. prec. (f(ī-).) gaRa śārṅgaravādi-. View this entry on the original dictionary page scan.
brāhmaṇaprātiveśyam. a neighbouring Brahman View this entry on the original dictionary page scan.
brāhmaṇavedamind. (to feed etc.) as many Brahmans as one knows View this entry on the original dictionary page scan.
brāhmaṇāvekṣamfn. based on the brāhmaṇa-s, View this entry on the original dictionary page scan.
brahmāṇḍayāmalepañcamīsādhanan. Name of work View this entry on the original dictionary page scan.
brāhmaṇeṣṭam. the mulberry tree View this entry on the original dictionary page scan.
brāhmaṇicef. View this entry on the original dictionary page scan.
brāhmaṇicef. cela
brahmaṇyadevam. Name of viṣṇu- (= brahmaṇyānāṃ śreṣṭhaḥ- Scholiast or Commentator) View this entry on the original dictionary page scan.
brahmāpetam. Name of one of the rākṣasa-s said to dwell in the sun during the month māgha- View this entry on the original dictionary page scan.
brahmapurābhidheyamfn. (with nāma-) to be called by the name brahma-pura- View this entry on the original dictionary page scan.
brahmarekhāf. " brahmā-'s line", the lines of a man's destiny supposed to be written by brahmā- on the forehead of a child on the 6th day after its birth View this entry on the original dictionary page scan.
brahmarṣideśam. the country of the brahmarṣi-s (including kuru-kṣetra- and the country of the matsya-s. pañcāla-s, and śūra-senaka-s) View this entry on the original dictionary page scan.
brahmastenam. a thief of that which is sacred, one who obtains a knowledge of the veda- by illicit means View this entry on the original dictionary page scan.
brahmasteyan. unlawful acquisition of the veda- (see prec.) View this entry on the original dictionary page scan.
brahmatantregāyatrīpañjaran. Name of work View this entry on the original dictionary page scan.
brahmatejasn. the power and glory of brahma- etc. ( brahmatejomaya jo-maya- mf(ī-)n.formed of brahma-'s glory ) View this entry on the original dictionary page scan.
brahmatejasn. the glory or lustre supposed to surround a Brahman View this entry on the original dictionary page scan.
brahmatejasn. (br/ahma--) having the glory or power of brahma- () or of a Brahman () View this entry on the original dictionary page scan.
brahmatejasm. Name of a buddha- , View this entry on the original dictionary page scan.
brahmatejomayamf(ī-)n. brahmatejas
brahmāvabodhavivekasindhum. brahmāvabodha
brahmavedam. "the veda- of sacred spells or charms"the atharva-- veda- etc. View this entry on the original dictionary page scan.
brahmavedam. the veda- of the Brahmans (as opp. to kṣatra-veda- q.v) View this entry on the original dictionary page scan.
brahmavedam. knowledge of brahma- View this entry on the original dictionary page scan.
brahmavedam. knowledge of the veda-s View this entry on the original dictionary page scan.
brahmavedamayamf(ī-)n. consisting of the brahma-- veda- View this entry on the original dictionary page scan.
brahmavedapariśiṣṭan. Name of work View this entry on the original dictionary page scan.
brahmavedhyāSee -bodhyā-. View this entry on the original dictionary page scan.
brahmavedif. " brahmā-'s altar", Name of the country between the 5 lakes of rāma- in kuru-kṣetra- View this entry on the original dictionary page scan.
brahmavedinmfn. equals -vid-, acquainted with the veda- or spiritual knowledge View this entry on the original dictionary page scan.
brahmaviśeṣacittaparipṛcchāf. Name of a Buddhist sūtra- work View this entry on the original dictionary page scan.
brahmaviṣṇumaheśvaradānan. Name of work View this entry on the original dictionary page scan.
brahmayajñadevarṣipitṛtarpaṇan. Name of work View this entry on the original dictionary page scan.
brahmeddhamfn. lighted or kindled with prayers View this entry on the original dictionary page scan.
brahmendram. (with sarasvatī-or dra-svāmin-) Name of authors View this entry on the original dictionary page scan.
brahmeśavaiṣṇavamfn. descended from brahmā- and śiva- and viṣṇu- View this entry on the original dictionary page scan.
brahmeśayam. (for maṇi-ś-) "resting in brahma-", Name of kārttikeya- View this entry on the original dictionary page scan.
brahmeśayam. of viṣṇu- View this entry on the original dictionary page scan.
brāhmeṣṭif. a particular iṣṭi- View this entry on the original dictionary page scan.
brahmeśviram. Name of an author View this entry on the original dictionary page scan.
brahmeśviratīrthan. Name of a tīrtha- on the revā- or narmadā- river View this entry on the original dictionary page scan.
brahmopadeśam. instruction in sacred knowledge, View this entry on the original dictionary page scan.
brahmopadeśanetṛm. Butea Frondosa (see -mopanetṛ-). View this entry on the original dictionary page scan.
brahmopanetṛm. Butea Frondosa (see padeśa-netṛ-). View this entry on the original dictionary page scan.
brahmopetam. Name of a rakṣas- (see brahmāpeta-). View this entry on the original dictionary page scan.
bṛhacchandenduśekharam. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakavivekam. Name of work View this entry on the original dictionary page scan.
bṛhadātreyam. "the larger ātreya-", Name of a work on med. View this entry on the original dictionary page scan.
bṛhaddevasthānan. Name of a sāman- View this entry on the original dictionary page scan.
bṛhaddevatāf. Name of a large work (enumerating and explaining the deities to which each hymn of the is addressed). View this entry on the original dictionary page scan.
bṛhaddhemādri(d-he-) m. the larger hemādri-. View this entry on the original dictionary page scan.
bṛhaddiveṣuind. in heavenly heights View this entry on the original dictionary page scan.
bṛhadef. large cardamoms View this entry on the original dictionary page scan.
bṛhadreṇu(bṛh/ad--) mfn. stirring up thick dust View this entry on the original dictionary page scan.
bṛhannetramfn. "large-eyed", (perhaps) far-sighted (figuratively) View this entry on the original dictionary page scan.
bṛhanniveśamfn. having large dimensions, large, protuberant View this entry on the original dictionary page scan.
bṛhatketumfn. (h/at--) having great clearness or brightness (said of agni-) View this entry on the original dictionary page scan.
bṛhatketum. Name of a king View this entry on the original dictionary page scan.
bṛhatkṛṣṇagaṇoddeśadīpikāf. Name of work View this entry on the original dictionary page scan.
bṛhatkṣetram. See -kṣaṇa-. View this entry on the original dictionary page scan.
bṛhatpārevatam. a kind of fruit tree (= mahā-p-) View this entry on the original dictionary page scan.
bṛhatpracetasm. "the larger pracetas-", Name of a particular recension of a law-book by pracetas-. View this entry on the original dictionary page scan.
bṛhatsaṃketam. Name of work View this entry on the original dictionary page scan.
bṛhatsenam. Name of various kings. View this entry on the original dictionary page scan.
bṛhatsenam. of a son of kṛṣṇa- View this entry on the original dictionary page scan.
bṛhatsenam. of a son of su-nakṣatra- View this entry on the original dictionary page scan.
bṛhatsef. Name of damayantī-'s nurse
bṛhattejasmfn. having great energy View this entry on the original dictionary page scan.
bṛhattejasm. the planet Jupiter View this entry on the original dictionary page scan.
buddhadevam. Name of a man
buddhakṣetran. Buddha's district, the country in which a Buddha appears View this entry on the original dictionary page scan.
buddhakṣetrapariśodhakan. Name of one of the 3 kinds of praṇidhāna- View this entry on the original dictionary page scan.
buddhakṣetravaralocanan. a particular samādhi- View this entry on the original dictionary page scan.
buddhasenam. Name of a king View this entry on the original dictionary page scan.
buddhibheda() m. disturbance or aberration of mind. View this entry on the original dictionary page scan.
buddhidef. Name of a princess View this entry on the original dictionary page scan.
buddhiśreṣṭhamfn. best (when effected) by the intellect View this entry on the original dictionary page scan.
budhadeśam. Name of a place View this entry on the original dictionary page scan.
budheind. on a Wednesday (equals budha-vāre-) View this entry on the original dictionary page scan.
budheyam. plural Name of a school of the white yajur-veda- View this entry on the original dictionary page scan.
caceṇḍāf. Name of a creeper View this entry on the original dictionary page scan.
caikitāneyam. patronymic fr. (na- ), c/ekitāna- View this entry on the original dictionary page scan.
caileyamfn. made of cloth View this entry on the original dictionary page scan.
caitanyadevam. Name of a man View this entry on the original dictionary page scan.
caitrasenim. patronymic fr. citra-sena-, View this entry on the original dictionary page scan.
caitreyamfn. coming from a speckled cow (citr/ā-) View this entry on the original dictionary page scan.
caitreyam. metron. fr. citrā- View this entry on the original dictionary page scan.
cakoranetramf(ā-)n. idem or 'mfn. having (eyes like those of the cakora- bird id est having) beautiful eyes '
cakrabhedinīf. "dividing the cakra-(-va1ka) couples (see -bāndhava-) ", night View this entry on the original dictionary page scan.
cakradevam. "having the wheel (of a war-chariot) for his deity", Name of a warrior View this entry on the original dictionary page scan.
cakramedinīfor -bhedinī- View this entry on the original dictionary page scan.
cakramelakaName of a locality in Kashmir View this entry on the original dictionary page scan.
cakranemif. "wheel-felly", Name of one of the mothers attending on skanda- View this entry on the original dictionary page scan.
cākrapāleyafr. cakra-pāla- gaRa sakhy-ādī-. View this entry on the original dictionary page scan.
cakrasenam. Name of a son of tārā-candra- and father of siṃha- View this entry on the original dictionary page scan.
cakrasef. Name of a princess View this entry on the original dictionary page scan.
cakraśreṇīf. Odina pinnata (bearing a curved fruit) View this entry on the original dictionary page scan.
cākravākeyafr. cakra-vāka- gaRa sakhy-ādi- (vāleya-[fr. cakra-vāla-] ) View this entry on the original dictionary page scan.
cākravāleyaSee vākeya-. View this entry on the original dictionary page scan.
cakrendrakam. a kind of mustard View this entry on the original dictionary page scan.
cakreśam. (equals kra-vartin-) sovereign of the world View this entry on the original dictionary page scan.
cakreśvaram. "lord of the discus", viṣṇu- View this entry on the original dictionary page scan.
cakreśvaram. "lord of the troops", bhairava- View this entry on the original dictionary page scan.
cakreśvaram. equals śa- View this entry on the original dictionary page scan.
cakreśvarīf. one of the vidyā-devī-s (executing the orders of the 1st arhat-) View this entry on the original dictionary page scan.
cākreyafr. cakr/a- gaRa sakhy-ādi- (not in ) View this entry on the original dictionary page scan.
cakṣurapetamfn. one who has lost his eyes, blind View this entry on the original dictionary page scan.
calācaleṣumfn. one whose arrow wavers or flies unsteadily View this entry on the original dictionary page scan.
calaketum. (in astronomy) Name of a moving ketu- View this entry on the original dictionary page scan.
calaniketamfn. having a perishable abode View this entry on the original dictionary page scan.
calendriyamfn. having unsteady organs View this entry on the original dictionary page scan.
caleṣufor calācal- View this entry on the original dictionary page scan.
camasodbhedam. View this entry on the original dictionary page scan.
camasodbhedanan. Name of a place of pilgrimage (spot of bursting forth of the river sarasvatī-) View this entry on the original dictionary page scan.
campakadeśam. the Campaka country. View this entry on the original dictionary page scan.
campakaśreṣṭhikathānakan. Name (also title or epithet) of a tale. View this entry on the original dictionary page scan.
campeśam. "lord of campā-", karṇa- View this entry on the original dictionary page scan.
cāmpeyam. (fr. campā-) Michelia Campaka View this entry on the original dictionary page scan.
cāmpeyam. Mesua ferrea View this entry on the original dictionary page scan.
cāmpeyam. equals yaka- View this entry on the original dictionary page scan.
cāmpeyam. a prince of campā-
cāmpeyam. Name of a son of viśvā-mitra- View this entry on the original dictionary page scan.
cāmpeyamn. gold View this entry on the original dictionary page scan.
cāmpeyakan. a filament (especially of a lotus) View this entry on the original dictionary page scan.
camūrunetrāf. idem or 'f. an antelope-eyed woman ( iv, 3/4) .' View this entry on the original dictionary page scan.
caṇḍaketum. Name of a man View this entry on the original dictionary page scan.
candaladef. Name of the princess candralekhā- View this entry on the original dictionary page scan.
cāṇḍālaveśamfn. clothed like a caṇḍāla- View this entry on the original dictionary page scan.
caṇḍamahāsenam. Name of a king of ujjayinī- View this entry on the original dictionary page scan.
caṇḍavegamfn. having an impetuous course or current (said of the sea, of the battle, and of time) View this entry on the original dictionary page scan.
caṇḍavegam. Name of a metre View this entry on the original dictionary page scan.
caṇḍavegam. of a gandharva- chief. 27, 13 View this entry on the original dictionary page scan.
caṇḍavef. "Name of a river" View this entry on the original dictionary page scan.
caṇḍavegāsaṃgamatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
caṇḍeśaName of a liṅga- View this entry on the original dictionary page scan.
caṇḍeśvaram. " caṇḍā-'s lord", śiva- View this entry on the original dictionary page scan.
caṇḍeśvaram. Name of one of śiva-'s attendants View this entry on the original dictionary page scan.
caṇḍeśvaram. Name of a writer on jurisprudence, View this entry on the original dictionary page scan.
caṇḍeśvaram. of an astronomer View this entry on the original dictionary page scan.
caṇḍeśvaram. of an ancestor of jagaddhara- (mentioned in his commentator or commentary on ) View this entry on the original dictionary page scan.
caṇḍeśvaran. Name of a tīrtha- View this entry on the original dictionary page scan.
caṇḍeśvarapraśnavidyāf. "knowledge of caṇḍeśvara-'s questions", Name of work View this entry on the original dictionary page scan.
caṇḍeśvararasam. Name of a medical preparation (made of mercury, arsenic, etc.) View this entry on the original dictionary page scan.
caṇḍīdevīśarmanm. Name of a scholiast. View this entry on the original dictionary page scan.
cāndrabhāgeyam. metron. fr. candra-bhāgā- View this entry on the original dictionary page scan.
candradevam. Name of a warrior View this entry on the original dictionary page scan.
candradevam. of a Brahman (of kāśyapa-'s family) View this entry on the original dictionary page scan.
candradevam. of a poet View this entry on the original dictionary page scan.
candradhvajaketum. Name of a samādhi- View this entry on the original dictionary page scan.
candrakeśam. Name of a hero of kālikā-, View this entry on the original dictionary page scan.
candrakesarinm. idem or 'm. Name of a hero of kālikā-, ' View this entry on the original dictionary page scan.
candraketum. Name of a son of lakṣmaṇa- View this entry on the original dictionary page scan.
candraketum. of several other men View this entry on the original dictionary page scan.
candraketum. of a vidyādhara- View this entry on the original dictionary page scan.
candraketum. of a prince of cakora- (slain by an emissary of king śūdraka-) View this entry on the original dictionary page scan.
candraketum. of a prince (emissary of king śūdrika-)
candraketum. of a hero of kālikā-, View this entry on the original dictionary page scan.
candralekham. Name of a rakṣas- View this entry on the original dictionary page scan.
candralekhāf. equals -rekhā-, a digit of the moon View this entry on the original dictionary page scan.
candralekhāf. Serratula anthelminthica View this entry on the original dictionary page scan.
candralekhāf. a metre of 4 x 13 syllables View this entry on the original dictionary page scan.
candralekhāf. another of 4 x 15 syllables View this entry on the original dictionary page scan.
candralekhāf. Name of a daughter of the nāga- su-śravas- View this entry on the original dictionary page scan.
candralekhāf. of kṣema-gupta-'s wife, View this entry on the original dictionary page scan.
candralekhāf. of a princess (whose teacher was bilhaṇa-;also called śaśi-kalā-) View this entry on the original dictionary page scan.
candralekhāf. of two other women View this entry on the original dictionary page scan.
candrārdhakṛtaśekharamfn. one who has adorned his forehead with a crescent mark View this entry on the original dictionary page scan.
candrarekhāf. a digit of the moon View this entry on the original dictionary page scan.
candrarekhāf. Serratula anthelminthica View this entry on the original dictionary page scan.
candrarekhāf. Name of a surāṅganā- View this entry on the original dictionary page scan.
candrareṇum. "having only the dust of the moon", a plagiarist View this entry on the original dictionary page scan.
candraśekharam. equals -mukuṭa- View this entry on the original dictionary page scan.
candraśekharam. Name of a minister (father of the author of ) View this entry on the original dictionary page scan.
candraśekharam. of the author of a commentator or commentary on View this entry on the original dictionary page scan.
candraśekharam. of the author of the play madhurā-niruddha- View this entry on the original dictionary page scan.
candraśekharam. of a prince View this entry on the original dictionary page scan.
candraśekharam. of a mountain (see -parvata-) View this entry on the original dictionary page scan.
candraśekharacampūprabandham. Name of work View this entry on the original dictionary page scan.
candrasenam. Name of a prince (son of samudra-sena-) View this entry on the original dictionary page scan.
candrasenam. equals -vāhana- View this entry on the original dictionary page scan.
candrasenam. Name of a hero of kālikā-, View this entry on the original dictionary page scan.
candrātreyam. plural Name of a family View this entry on the original dictionary page scan.
candreśaliṅgan. Name of a liṅga- View this entry on the original dictionary page scan.
candreṣṭāf. "moon-loved", a night lotus View this entry on the original dictionary page scan.
candreśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
caṇeśvarīf. Name of caṇin-'s wife View this entry on the original dictionary page scan.
caṅgef. idem or 'f. idem or 'n. a basket ', ' , View this entry on the original dictionary page scan.
cāṅgef. wood-sorrel View this entry on the original dictionary page scan.
caṅgerikan. a basket View this entry on the original dictionary page scan.
caṅgerikāf. idem or 'n. a basket ' , View this entry on the original dictionary page scan.
cāpalekhāf. Name of a woman, . View this entry on the original dictionary page scan.
cāpavedam. equals dhanur-v- View this entry on the original dictionary page scan.
capeṭam. a slap with the open hand View this entry on the original dictionary page scan.
capeṭāf. idem or 'm. a slap with the open hand ' Va1rtt. 13 View this entry on the original dictionary page scan.
capeṭāf. of ṭa-. View this entry on the original dictionary page scan.
capeṭāghātam. a slap with the open hand View this entry on the original dictionary page scan.
capeṭāpātanan. "id.", in compound capeṭāpātanātithi tithi- mfn. blown with the open hand View this entry on the original dictionary page scan.
capeṭāpātanātithimfn. capeṭāpātana
capeṭīf. idem or 'f. idem or 'm. a slap with the open hand ' Va1rtt. 13 ' View this entry on the original dictionary page scan.
capeṭīf. the 6th day in the bright half of month bhādrapada- View this entry on the original dictionary page scan.
capeṭikāf. equals ṭa- View this entry on the original dictionary page scan.
caradevam. Name of a man View this entry on the original dictionary page scan.
caraṇasef. "service on one's feet", devotion View this entry on the original dictionary page scan.
cārekṣaṇamfn. equals ra-dṛś- View this entry on the original dictionary page scan.
caritrāvaśeṣamfn. having only virtue left, View this entry on the original dictionary page scan.
carmacelaa garment with the hide turned outwards View this entry on the original dictionary page scan.
carmaprabhedikāf. a shoemaker's awl View this entry on the original dictionary page scan.
carmaprasevakam. equals -puṭa- View this entry on the original dictionary page scan.
carmaprasevikāf. idem or 'm. equals -puṭa- ' View this entry on the original dictionary page scan.
carucelinmfn. (for cār-?) having portions of offerings on the clothes (śiva-) View this entry on the original dictionary page scan.
cārudeham. Name of a son of kṛṣṇa-, View this entry on the original dictionary page scan.
cārudeṣṇam. Name of a son of gaṇḍūṣa- View this entry on the original dictionary page scan.
cārudeṣṇam. of a son of kṛṣṇa- View this entry on the original dictionary page scan.
cārudevam. Name of the father of the author of View this entry on the original dictionary page scan.
cārukesarāf. "beautiful-filamented", a kind of Cyperus View this entry on the original dictionary page scan.
cārukesarāf. another plant (taruṇī-) View this entry on the original dictionary page scan.
cārunetramf(ā-)n. beautiful-eyed View this entry on the original dictionary page scan.
cārunetram. a kind of antelope View this entry on the original dictionary page scan.
cārunetrāf. Name of an apsaras- View this entry on the original dictionary page scan.
cāruveṇīf. "a handsome braid" View this entry on the original dictionary page scan.
cāruveṇīf. Name of a river. View this entry on the original dictionary page scan.
cāruveśam. "well-dressed" View this entry on the original dictionary page scan.
cāruveṣam. idem or 'm. "well-dressed" ' , Name of a son of kṛṣṇa- View this entry on the original dictionary page scan.
cāṭakadeśam. Name of a country View this entry on the original dictionary page scan.
caturanteśam. caturantā
caturdaśamatavivekam. "disquisition on the 14 philos. systems", Name of work by śaṃkara- View this entry on the original dictionary page scan.
caturlekhamfn. having 4 lines on the forehead View this entry on the original dictionary page scan.
cāturmāsyadevatāf. the deity of a cāturmāsya- sacrifice View this entry on the original dictionary page scan.
caturmedham. one who has offered 4 sacrifices (aśva--, puruṣa--, sarva--, and pitṛ-medha-) or one who knows the mantra-s required for them View this entry on the original dictionary page scan.
caturnetṛmfn. bringing near the 4 objects desired for by men View this entry on the original dictionary page scan.
caturthakāleind. idem or 'ind. at the 4th meal-time id est at the evening of every 2nd day (of any one's fasting) ' View this entry on the original dictionary page scan.
caturvedamfn. (gaRa brāhmaṇādi-) containing the 4 veda-s (brahmā-) (viṣṇu-) View this entry on the original dictionary page scan.
caturvedamfn. ( ) equals -vidya- View this entry on the original dictionary page scan.
caturvedam. plural the 4 veda-s View this entry on the original dictionary page scan.
caturvedam. a class of manes View this entry on the original dictionary page scan.
caturvedinmfn. equals -vidya- (in Prakrit). View this entry on the original dictionary page scan.
cāturvedyan. (fr. catur-veda-) a number of men versed in the 4 veda-s View this entry on the original dictionary page scan.
caturvidhasaṃśayodbhedam. "removal of doubts of 4 kinds", Name of a work View this entry on the original dictionary page scan.
catuṣkaveśmann. a hall resting on 4 columns View this entry on the original dictionary page scan.
catuṣpathanikef. "abiding on a cross-way", Name of one of the mothers attending on skanda- View this entry on the original dictionary page scan.
catustridvyekabhāgamfn. plural receiving 4, 3, 2, and 1 part respectively View this entry on the original dictionary page scan.
cauḍadeśam. the coḍa- (cola-) country, View this entry on the original dictionary page scan.
ceccedind. "if-if!"be quiet! (address to a dog) View this entry on the original dictionary page scan.
cedind. ( ca id-) (never found at the beginning of a sentence or verse) equals ca-,"and" (c/ed-ca-,"as well as") View this entry on the original dictionary page scan.
cedind. "when"(the verb being accentuated see ) View this entry on the original dictionary page scan.
cedind. "if"(the verb being accentuated see ;with proper [ etc. see ] subjunctive [ ] Potential [ etc. (for Conditional and ); see ], perf. [ perf. p. ] Aorist [ ; see ] future [ ; see ] Conditional [ ; see ] , perf. or future Passive voice parasmE-pada or with an auxiliary verb to be supplied ) View this entry on the original dictionary page scan.
cedind. atha ced- "but if." View this entry on the original dictionary page scan.
cedind. api ced- "even" View this entry on the original dictionary page scan.
cedind. iti cen- (often placed at the end of an objector's statement)"if it be argued that..", na- "no, it is not so" View this entry on the original dictionary page scan.
cedind. na ced- (gaRa di-,also separated by the verb[ ]or the verb preceded by na-placed at the end of the sentence[ ] , rarely cen na-in reversed order beginning the apodosis ) "if not" (equals no ced-forming a sentence by itself. ) View this entry on the original dictionary page scan.
cedind. no ced- (gaRa di-) idem or 'ind. na ced- (gaRa di-,also separated by the verb[ ]or the verb preceded by na-placed at the end of the sentence[ ] , rarely cen na-in reversed order beginning the apodosis ) "if not" (equals no ced-forming a sentence by itself. ) ' (forming a sentence by itself. exempli gratia, 'for example' dūram apasara no ced dhantavyo 'si mayā-,"depart to a distance, if not id est if thou departest not, thou art to be killed by me") ; View this entry on the original dictionary page scan.
cedind. no ced- exceptionally equals na ced- (beginning a sentence) View this entry on the original dictionary page scan.
cedind. na ced- or no ced- (with Potential) "would that not!" (exempli gratia, 'for example' no cet pradahet-,"would that he did not burn down!") , View this entry on the original dictionary page scan.
cedind. na ced- or no ced- (with proper or Potential,the apodosis containing an imperative) "if not" id est "in order that not", View this entry on the original dictionary page scan.
cedind. yadi ced- (also separated by the verb) equals ced-,"if"(with proper Potential future) (see ned-.) View this entry on the original dictionary page scan.
ceḍam. a servant View this entry on the original dictionary page scan.
ceḍakam. equals ḍa-, ib-. View this entry on the original dictionary page scan.
ceḍīf. equals ceṭī- View this entry on the original dictionary page scan.
cedim. pl. Name of a people (who lived in Bundelkhand; renowned for their attachment to ancient laws and institutions ; their capital was śuktimatī-; some of their kings were vasu- uparicara-, subāhu-, dhṛṣṭa-ketu-, dama-ghoṣa-, śiśu-pāla- etc.) etc. View this entry on the original dictionary page scan.
cedim. sg. Name of the supposed ancestor of the cedi-s (son of kaiśika- or uśika-) View this entry on the original dictionary page scan.
cedibhūbhṛtm. "protector of the country of the cedi-s", śiśu-pāla- View this entry on the original dictionary page scan.
cedibhūbhujm. "earth-enjoyer of the cedi-s", equals -pati- View this entry on the original dictionary page scan.
cedihūṇam. plural the cedi-s and the hūṇa-s View this entry on the original dictionary page scan.
ceḍikāf. equals ḍī- View this entry on the original dictionary page scan.
cedikam. plural the cedi-s View this entry on the original dictionary page scan.
cedinagarīf. equals tri-purī- View this entry on the original dictionary page scan.
cedipam. equals -pati- View this entry on the original dictionary page scan.
cedipam. Name of a son of vasu- uparicara- View this entry on the original dictionary page scan.
cedipatim. a prince of the cedi-s () , xiii. View this entry on the original dictionary page scan.
cedipurīf. the city of the cedi-s View this entry on the original dictionary page scan.
cedirājm. "king of the cedi-s" idem or 'm. "protector of the country of the cedi-s", śiśu-pāla- ' View this entry on the original dictionary page scan.
cedirājm. equals -pati- View this entry on the original dictionary page scan.
cedirājam. equals -pati- śiśu-pāla- View this entry on the original dictionary page scan.
cedisaṃvatsee kalacuri-- saṃvatsara-, parasmE-pada 1324. View this entry on the original dictionary page scan.
cediviṣayam. the country of the cedi-s View this entry on the original dictionary page scan.
cekitānamfn. See 4. cit-, Intensive View this entry on the original dictionary page scan.
cekitānamfn. intelligent (śiva-) View this entry on the original dictionary page scan.
cekitānam. Name of a prince (ally of the pāṇḍu-s) View this entry on the original dictionary page scan.
cekitānaSee cit-.
cekriyamfn. (1. kṛ-, Intensive) active, industrious View this entry on the original dictionary page scan.
cekrīyitan. the characteristic of the Intensive verb View this entry on the original dictionary page scan.
cel cl.1. = cal- View this entry on the original dictionary page scan.
celan. ( cil-) clothes, garment etc. (in fine compositi or 'at the end of a compound' f(ā-). ) View this entry on the original dictionary page scan.
celan. in fine compositi or 'at the end of a compound' "the mere outward appearance of", a bad representative of (exempli gratia, 'for example' bhāryācela bhāryā-cela- n."a bad wife" and ;also mf(ī-)n. exempli gratia, 'for example' brāhmaṇicelī brāhmaṇicelī- f."a bad wife of a brahman-", brāhmaṇacela brāhmaṇa-cela- m."a bad brahman-" ) View this entry on the original dictionary page scan.
celam. equals ceṭa-, a servant, slave View this entry on the original dictionary page scan.
celam. see ku--, āhara-celā- View this entry on the original dictionary page scan.
celam. pāpa-celī- and likā-. View this entry on the original dictionary page scan.
celacīrāf. a piece torn off from a garment View this entry on the original dictionary page scan.
celagaṅgāf. Name of a river View this entry on the original dictionary page scan.
celakam. for chel- View this entry on the original dictionary page scan.
celakam. Name of a man (see c/ailaki-) View this entry on the original dictionary page scan.
celakamn. equals cela- in fine compositi or 'at the end of a compound' a bad representative of. View this entry on the original dictionary page scan.
celakaṇṭhinmfn. for śveta-k- View this entry on the original dictionary page scan.
celaknopamind. so as to wet the clothes (rain) View this entry on the original dictionary page scan.
celālam. Cucumis sativus View this entry on the original dictionary page scan.
celānam. a kind of cucumber View this entry on the original dictionary page scan.
celanirṇejakam. a washerman View this entry on the original dictionary page scan.
celāpahāram. theft of garments View this entry on the original dictionary page scan.
celāpahāram. (see ) View this entry on the original dictionary page scan.
celaprakṣālakam. idem or 'm. a washerman ' View this entry on the original dictionary page scan.
celarucikāf. a mourning band (?) (varia lectio) View this entry on the original dictionary page scan.
celāśakam. "clothes-eater", a moth View this entry on the original dictionary page scan.
celicīmam. equals cilic- View this entry on the original dictionary page scan.
celikāf. a corset, bodice View this entry on the original dictionary page scan.
celīmam. idem or 'm. equals cilic- ' View this entry on the original dictionary page scan.
cell varia lectio for cel-. View this entry on the original dictionary page scan.
celukam. a Buddhist novice View this entry on the original dictionary page scan.
ceraName of a southern kingdom View this entry on the original dictionary page scan.
cerakam. (equals mīmāṃsaka-?) View this entry on the original dictionary page scan.
ceralam. plural Name of a family View this entry on the original dictionary page scan.
cerapādam. plural Name of a people (? see īra-p-) View this entry on the original dictionary page scan.
cerumfn. ( cāy-) behaving respectfully, worshipping View this entry on the original dictionary page scan.
ceṣṭ cl.1. c/eṣṭati-, te- (inf ṭitum-) to move the limbs, move, stir ; to make effort, exert one's self, struggle, strive, be active ; to be busy or occupied with (accusative) ; to act, do, perform, care for ; to prepare (ind.p. ceṣṭitv/ā-): Causal ṭayati-, te- (Aorist aciceṣṭat-[ ] or acac- ) to cause to move, set in motion, impel, drive View this entry on the original dictionary page scan.
ceṣṭam. "moving", a kind of fish (tapasvin-) View this entry on the original dictionary page scan.
ceṣṭan. moving the limbs, gesture View this entry on the original dictionary page scan.
ceṣṭan. behaviour, manner of life View this entry on the original dictionary page scan.
ceṣṭāf. () moving any limb, gesture etc. (in fine compositi or 'at the end of a compound' ) View this entry on the original dictionary page scan.
ceṣṭāf. action, activity, effort, endeavour, exertion (in fine compositi or 'at the end of a compound') etc. View this entry on the original dictionary page scan.
ceṣṭāf. doing, performing View this entry on the original dictionary page scan.
ceṣṭāf. behaving, manner of life (in fine compositi or 'at the end of a compound') etc. View this entry on the original dictionary page scan.
ceṣṭāf. see a--, naṣṭa--, niś--. View this entry on the original dictionary page scan.
ceṣṭāf. See ṭa-. View this entry on the original dictionary page scan.
ceṣṭakamfn. making effort or exertion View this entry on the original dictionary page scan.
ceṣṭakam. a kind of fish (equals ṭa-) View this entry on the original dictionary page scan.
ceṣṭakam. a kind of coitus. View this entry on the original dictionary page scan.
ceṣṭanan. making effort View this entry on the original dictionary page scan.
ceṣṭanan. motion View this entry on the original dictionary page scan.
ceṣṭanamfn. in fine compositi or 'at the end of a compound' performing View this entry on the original dictionary page scan.
ceṣṭanan. effort, exertion View this entry on the original dictionary page scan.
ceṣṭānāśam. ceasing of every motion View this entry on the original dictionary page scan.
ceṣṭānāśam. destruction of the world View this entry on the original dictionary page scan.
ceṣṭānirūpaṇan. observing any one's actions View this entry on the original dictionary page scan.
ceṣṭāpṛthaktvanivartinmfn. to be (or being) carried out by separate (repeated) acts, View this entry on the original dictionary page scan.
ceṣṭārha(ṭār-) mfn. worthy of effort View this entry on the original dictionary page scan.
ceṣṭāvatmfn. moveable View this entry on the original dictionary page scan.
ceṣṭāvatmfn. full of activity, active View this entry on the original dictionary page scan.
ceṣṭayitṛmfn. one who sets in motion View this entry on the original dictionary page scan.
ceṣṭitamfn. set in motion View this entry on the original dictionary page scan.
ceṣṭitamfn. done with effort, exerted View this entry on the original dictionary page scan.
ceṣṭitamfn. done (varia lectio) View this entry on the original dictionary page scan.
ceṣṭitamfn. frequented View this entry on the original dictionary page scan.
ceṣṭitan. moving any limb, gesture View this entry on the original dictionary page scan.
ceṣṭitan. doing, action, behaviour, manner of life etc. (in fine compositi or 'at the end of a compound' f(ā-). ) . View this entry on the original dictionary page scan.
ceṣṭitavyan. impersonal or used impersonally to be done or managed View this entry on the original dictionary page scan.
cetNom. (fr. c/etas-) tati- (; Aorist 3. plural acetiṣur-) to recover consciousness View this entry on the original dictionary page scan.
cetNom. tati-. See cit-. View this entry on the original dictionary page scan.
cetSee c/ed-. View this entry on the original dictionary page scan.
ceṭam. a servant, slave (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
ceṭam. a kind of fish View this entry on the original dictionary page scan.
cetaḥin compound equals tas-. View this entry on the original dictionary page scan.
cetaḥetc. See View this entry on the original dictionary page scan.
cetaḥpīḍāf. grief View this entry on the original dictionary page scan.
cetakamfn. causing to think View this entry on the original dictionary page scan.
cetakamfn. sentient View this entry on the original dictionary page scan.
ceṭakam. a servant, slave (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
ceṭakam. a paramour View this entry on the original dictionary page scan.
cetakaetc. See View this entry on the original dictionary page scan.
cetakīf. equals tanikā- View this entry on the original dictionary page scan.
cetakīf. Jasminum grandiflorum View this entry on the original dictionary page scan.
cetanamf(-)n. visible, conspicuous, distinguished, excellent View this entry on the original dictionary page scan.
cetanamf(-)n. percipient, conscious, sentient, intelligent etc. View this entry on the original dictionary page scan.
cetanam. an intelligent being, man View this entry on the original dictionary page scan.
cetanam. soul, mind View this entry on the original dictionary page scan.
cetanan. conspicuousness View this entry on the original dictionary page scan.
cetanan. soul, mind View this entry on the original dictionary page scan.
cetanāf. consciousness, understanding, sense, intelligence etc. (often in fine compositi or 'at the end of a compound' [f(ā-).] ) (see a--, niś--, puru-c/et-, vi--, sa--, s/u--). View this entry on the original dictionary page scan.
cetanaetc. See View this entry on the original dictionary page scan.
cetanabhāvam. idem or 'n. idem or 'f. the state of a sentient or conscious being, intelligence.' ' View this entry on the original dictionary page scan.
cetanācetana plural sentient and unsentient beings View this entry on the original dictionary page scan.
cetanakāf. equals nikā- View this entry on the original dictionary page scan.
cetanakīf. equals nikā- View this entry on the original dictionary page scan.
cetanāṣṭakan. Name of work View this entry on the original dictionary page scan.
cetanatāf. the state of a sentient or conscious being, intelligence. View this entry on the original dictionary page scan.
cetanatvan. idem or 'f. the state of a sentient or conscious being, intelligence.' View this entry on the original dictionary page scan.
cetanāvatmfn. having consciousness, knowing, understanding, reasonable View this entry on the original dictionary page scan.
cetanīind. for na-. View this entry on the original dictionary page scan.
cetanībhūto become conscious
cetanikāf. Terminalia Chebula View this entry on the original dictionary page scan.
cetanīkṛto cause to perceive or become conscious View this entry on the original dictionary page scan.
cetanīyāf. the medicinal herb ṛddhi- View this entry on the original dictionary page scan.
cetasn. splendour View this entry on the original dictionary page scan.
cetasn. () consciousness, intelligence, thinking soul, heart, mind etc. (in fine compositi or 'at the end of a compound' etc.) View this entry on the original dictionary page scan.
cetasn. will View this entry on the original dictionary page scan.
cetasn. see a-cet/as-, dabhr/a--, pr/a--, laghu--, v/i--, s/a--, su-c/etas-. View this entry on the original dictionary page scan.
cetasetc., tāya- etc. See cit-. View this entry on the original dictionary page scan.
cetasakam. plural Name of a people View this entry on the original dictionary page scan.
cetasamind. in fine compositi or 'at the end of a compound' fr. tas- View this entry on the original dictionary page scan.
cetavyamfn. to be piled up View this entry on the original dictionary page scan.
cetavyamfn. equals cayanīya- View this entry on the original dictionary page scan.
cetavyaSee 1. ci-. View this entry on the original dictionary page scan.
cetayamfn. sentient View this entry on the original dictionary page scan.
cetāyaNom. (fr. tas-), yale-, . View this entry on the original dictionary page scan.
cetayānamfn. (irreg. pr. p.) having sense, reasonable View this entry on the original dictionary page scan.
cetayitavyamfn. to be perceived View this entry on the original dictionary page scan.
cetayitṛmfn. equals ya- View this entry on the original dictionary page scan.
ceind. in compound for tas-. View this entry on the original dictionary page scan.
ceṭīf. a female servant View this entry on the original dictionary page scan.
ceṭikāf. equals ṭī- View this entry on the original dictionary page scan.
cetīkṛ View this entry on the original dictionary page scan.
cetiṣṭhamfn. (fr. c/ettṛ-) most attentive (with genitive case) View this entry on the original dictionary page scan.
cetiṣṭhamfn. (fr. citr/a-) most conspicuous View this entry on the original dictionary page scan.
cetoin compound for tas-. View this entry on the original dictionary page scan.
cetobhavam. equals citta-ja- View this entry on the original dictionary page scan.
cetobhūm. id., View this entry on the original dictionary page scan.
cetoharamf(ā-)n. captivating the heart View this entry on the original dictionary page scan.
cetomatmfn. endowed with consciousness, living View this entry on the original dictionary page scan.
cetomukhamfn. one whose mouth is intelligence, View this entry on the original dictionary page scan.
cetovikāram. disturbance of mind View this entry on the original dictionary page scan.
cetovikārinmfn. disturbed in mind View this entry on the original dictionary page scan.
cetṛm. an observer View this entry on the original dictionary page scan.
cetṛm. a revenger View this entry on the original dictionary page scan.
cetti c/etya- See cit-. View this entry on the original dictionary page scan.
cettṛmfn. attentive, guardian, (See also sub voce, i.e. the word in the Sanskrit order 4. cit-) (cett/ṛ-) View this entry on the original dictionary page scan.
cetum. heedfulness View this entry on the original dictionary page scan.
cetuyāName of a place View this entry on the original dictionary page scan.
cetyamfn. perceivable View this entry on the original dictionary page scan.
cetyāf. equals t/u- (?) View this entry on the original dictionary page scan.
cef. Name of a rāgiṇī- (in music) View this entry on the original dictionary page scan.
ceyamfn. ( on ;on ) to be piled View this entry on the original dictionary page scan.
ceyamfn. equals cayanīya- View this entry on the original dictionary page scan.
ceyaSee 1. ci-,
chādiṣeyamfn. suitable for the roof of a carriage or house (chad/is-) Va1rtt. 2 View this entry on the original dictionary page scan.
chadmarūpeṇa instrumental case ind. in disguise View this entry on the original dictionary page scan.
chadmaveṣam. a deceptive dress, disguise View this entry on the original dictionary page scan.
chadmaveṣinmfn. of a pretended appearance View this entry on the original dictionary page scan.
chadmaveṣinmfn. a cheat View this entry on the original dictionary page scan.
chāgaleyamfn. fr. chagal/a- gaRa sakhy-ādi- View this entry on the original dictionary page scan.
chāgaleyam. Name of the author of a law-book Introd. View this entry on the original dictionary page scan.
chāgaleyam. View this entry on the original dictionary page scan.
chāgaleyam. (plural) equals geya- View this entry on the original dictionary page scan.
chāgaleyinm. plural () the pupils of chagalin- View this entry on the original dictionary page scan.
chāgeyam. plural Name of a school of the black yajur-veda-, View this entry on the original dictionary page scan.
chandenaind. instrumental case ([also with svena-, ;or in fine compositi or 'at the end of a compound' with sva--() or ātma-- ]) according to one's own wish View this entry on the original dictionary page scan.
chandodevam. Name of mataṅga- View this entry on the original dictionary page scan.
chandodef. "metre-goddess", gāyatrī- View this entry on the original dictionary page scan.
chāndogeyam. plural Name of a family (varia lectio gi-). View this entry on the original dictionary page scan.
chāndogyavedam. equals gya- View this entry on the original dictionary page scan.
channeind. locative case secretly View this entry on the original dictionary page scan.
chedamfn. in fine compositi or 'at the end of a compound' "cutting off" See sthāṇu-- View this entry on the original dictionary page scan.
chedam. divisor, denominator View this entry on the original dictionary page scan.
chedam. a cut, section, piece, portion etc. View this entry on the original dictionary page scan.
chedam. an incision, cleft, slit, View this entry on the original dictionary page scan.
chedam. View this entry on the original dictionary page scan.
chedam. cutting off, tearing off dividing (often in fine compositi or 'at the end of a compound') etc. View this entry on the original dictionary page scan.
chedam. separation (of syllables or words) View this entry on the original dictionary page scan.
chedam. dissipating (doubt, etc.) View this entry on the original dictionary page scan.
chedam. interruption, vanishing, cessation, deprivation, want, etc. View this entry on the original dictionary page scan.
chedam. limit of (in compound) View this entry on the original dictionary page scan.
chedam. smoothing (a conflict, by an ordeal, divya--) View this entry on the original dictionary page scan.
chedādia gaṇa- of ( ). View this entry on the original dictionary page scan.
chedagamam. disappearance of the denominator. View this entry on the original dictionary page scan.
chedakamfn. in fine compositi or 'at the end of a compound' cutting off View this entry on the original dictionary page scan.
chedakam. the denominator of a fraction View this entry on the original dictionary page scan.
chedakam. see granthi--. View this entry on the original dictionary page scan.
chedakaramfn. making incisions View this entry on the original dictionary page scan.
chedakaram. a wood-cutter View this entry on the original dictionary page scan.
chedanamfn. cutting asunder, splitting View this entry on the original dictionary page scan.
chedanamfn. destroying, removing (in fine compositi or 'at the end of a compound'), View this entry on the original dictionary page scan.
chedanan. an instrument for cutting View this entry on the original dictionary page scan.
chedanan. section, part View this entry on the original dictionary page scan.
chedanan. (chiefly in fine compositi or 'at the end of a compound') cutting, removal (of doubts, saṃśaya--) View this entry on the original dictionary page scan.
chedanan. a medicine for removing the humors of the body View this entry on the original dictionary page scan.
chedanīyamfn. to be cut up or divided View this entry on the original dictionary page scan.
chedanīyam. Strychnos potatorum View this entry on the original dictionary page scan.
chef. gaRa gaurādi- (not in ) View this entry on the original dictionary page scan.
chem. see ṛṇa--. View this entry on the original dictionary page scan.
chedimfn. one who cuts or breaks View this entry on the original dictionary page scan.
chedim. a carpenter View this entry on the original dictionary page scan.
chedinmfn. in fine compositi or 'at the end of a compound' cutting off, tearing asunder View this entry on the original dictionary page scan.
chedinmfn. removing View this entry on the original dictionary page scan.
cheditamfn. cut, divided View this entry on the original dictionary page scan.
cheditavyamfn. to be cut, divisable View this entry on the original dictionary page scan.
chedopasthāpanīyan. taking the (Jain) vows after having broken with doctrines or practices adhered to formerly View this entry on the original dictionary page scan.
chedyamfn. to be cut or divided or split or cut off or mutilated View this entry on the original dictionary page scan.
chedyan. cutting off, cutting, tearing (with teeth or nails) ; View this entry on the original dictionary page scan.
chedyan. see kuḍya--, duḥkka--, pattra--, laghu--, saṃśaya--. View this entry on the original dictionary page scan.
chedyakan. drawing, projection View this entry on the original dictionary page scan.
chedyakādhyāyam. Name of View this entry on the original dictionary page scan.
chekamf(ā-)n. clever, shrewd () View this entry on the original dictionary page scan.
chekamf(ā-)n. domesticated View this entry on the original dictionary page scan.
chekam. a bee View this entry on the original dictionary page scan.
chekam. equals nuprāsa- View this entry on the original dictionary page scan.
chekala([ ]), mfn. clever. View this entry on the original dictionary page scan.
chekāla([ ]) mfn. clever. View this entry on the original dictionary page scan.
chekānuprāsam. a kind of alliteration (with single repetitions of several consonants as in ;opposed to lāṭān-), View this entry on the original dictionary page scan.
chekilamfn. idem or '([ ]) mfn. clever.' View this entry on the original dictionary page scan.
chektoktif. indirect speech, hint, double entendre View this entry on the original dictionary page scan.
chelakam. (fr. chagal-) a he-goat View this entry on the original dictionary page scan.
chelikāf. a she-goat, 76. View this entry on the original dictionary page scan.
cheluVernonia anthelminthica View this entry on the original dictionary page scan.
chemaṇḍam. equals cham-, an orphan View this entry on the original dictionary page scan.
chemuṇāf. idem or 'm. equals cham-, an orphan ' View this entry on the original dictionary page scan.
chemuṇāf. see chā- View this entry on the original dictionary page scan.
cheppa(fr. s/epa-) tail View this entry on the original dictionary page scan.
chettavyamfn. to be cut off View this entry on the original dictionary page scan.
chettavyamfn. to be cut View this entry on the original dictionary page scan.
chettavya ttṛ-, etc. See 1. chid-. View this entry on the original dictionary page scan.
chettṛmfn. one who cuts off, cutter, woodcutter (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
chettṛmfn. a remover (of doubts, saṃśayānām-,2, 21) View this entry on the original dictionary page scan.
chidrānveṣaṇan. searching for faults View this entry on the original dictionary page scan.
chidrānveṣinm. equals nusaṃdhānin- View this entry on the original dictionary page scan.
chidravaidef. id View this entry on the original dictionary page scan.
chiduretaramfn. not breaking, strong View this entry on the original dictionary page scan.
chinnakeśamfn. having the hair cut View this entry on the original dictionary page scan.
chinnaveṣikāf. Clypea hernandifolia View this entry on the original dictionary page scan.
ciketasSee na--. View this entry on the original dictionary page scan.
cilladef. Name of a goddess. View this entry on the original dictionary page scan.
cintāveśmann. a council room View this entry on the original dictionary page scan.
cintāvidheyamfn. influenced by a thought, View this entry on the original dictionary page scan.
ciraceṣṭitamfn. long sought for, of rare occurrence View this entry on the original dictionary page scan.
ciramehinm. "urining for a long time", an ass View this entry on the original dictionary page scan.
cirarātrepsitamfn. equals cirābhilaṣita- View this entry on the original dictionary page scan.
cirasevakam. an old servant View this entry on the original dictionary page scan.
ciratamenaind. instrumental case extremely slowly Va1rtt. 4 View this entry on the original dictionary page scan.
ciratareṇaind. instrumental case more slowly Va1rtt. 4 View this entry on the original dictionary page scan.
ciravef. View this entry on the original dictionary page scan.
ciravelayāind. instrumental case at so late a time View this entry on the original dictionary page scan.
cireind. locative case with some delay, not immediately View this entry on the original dictionary page scan.
cireṇaind. instrumental case after a long time, late, not immediately, slowly Va1rtt. 4 View this entry on the original dictionary page scan.
cireṇaind. for a long time (See also k/iyat-) View this entry on the original dictionary page scan.
cireṇaind. ever, at all times View this entry on the original dictionary page scan.
citāpraveśam. equals dhirohaṇa- View this entry on the original dictionary page scan.
citrabheṣajāf. "yielding various remedies", Ficus oppositifolia View this entry on the original dictionary page scan.
citradevam. Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
citradef. mahendra-vāruṇī- View this entry on the original dictionary page scan.
citrahetum. a particular rhetoric fignre, View this entry on the original dictionary page scan.
citrakeśatāf. the having beautiful hair (one of the 80 minor marks of a buddha-), View this entry on the original dictionary page scan.
citraketum. Name of a son (of garuḍa- ;of vasiṣṭha- ;of kṛṣṇa-, x, 61, 12;of lakṣmaṇa-, ix, 11, 12;of devabhāga-, 24, 39) View this entry on the original dictionary page scan.
citraketum. of a sūrasena- king, View this entry on the original dictionary page scan.
citralekhāf. a picture, portrait two metres of 4 x 17 syllables View this entry on the original dictionary page scan.
citralekhāf. another of 4 x 18 syllables View this entry on the original dictionary page scan.
citralekhāf. Name of an apsaras- (skilful in painting) View this entry on the original dictionary page scan.
citralekhāf. of a daughter of kumbhāṇḍa-, 9930 View this entry on the original dictionary page scan.
citralekhakam. equals -kara- (not in ) View this entry on the original dictionary page scan.
citralekhanikāf. equals -tūlikā- View this entry on the original dictionary page scan.
citramekhala View this entry on the original dictionary page scan.
citramekhalam. equals -piccha- View this entry on the original dictionary page scan.
citramekhalaka View this entry on the original dictionary page scan.
citramekhalakam. equals -piccha- View this entry on the original dictionary page scan.
citranetrāf. "variegated-eyed", the bird sārikā- View this entry on the original dictionary page scan.
citrarekhāf. Name of a surāṅganā- View this entry on the original dictionary page scan.
citrarepham. Name of a son of medhātithi- (king of śāka-dvīpa-) View this entry on the original dictionary page scan.
citrasenamfn. (tr/a--) having a bright spear, View this entry on the original dictionary page scan.
citrasenam. Name of a snake-demon View this entry on the original dictionary page scan.
citrasenam. of a leader of the gandharva-s (son of viśvā-vasu-) View this entry on the original dictionary page scan.
citrasenam. of a son (of dhṛta-rāṣṭra- ;of parikṣit-, ;of śambara- ;of nariṣyanta- ;of the 13th manu- ;of gada- or kṛṣṇa- ) View this entry on the original dictionary page scan.
citrasenam. of an adversary of kṛṣṇa-, 5059 View this entry on the original dictionary page scan.
citrasenam. of tarāsandha-'s general (ḍimbhaka-) View this entry on the original dictionary page scan.
citrasenam. of a divine recorder of the deeds of men View this entry on the original dictionary page scan.
citrasenam. (equals -gupta-) the secretary of a man of rank View this entry on the original dictionary page scan.
citrasenam. Name of a scholiast on piṅgala-'s work on metres View this entry on the original dictionary page scan.
citrasef. Name of an apsaras- View this entry on the original dictionary page scan.
citrasef. of one of the mothers in skanda-'s retinue View this entry on the original dictionary page scan.
citrasef. of a courtesan View this entry on the original dictionary page scan.
citrasef. of a river (see caitraseni-.) View this entry on the original dictionary page scan.
citravegikam. "having a wonderful velocity", Name of a nāga- View this entry on the original dictionary page scan.
citraveṣam. "having a variegated dress", śiva-. View this entry on the original dictionary page scan.
citreśam. "lord of citrā-", the moon View this entry on the original dictionary page scan.
citsabheśānandatīrtham. Name of an author. View this entry on the original dictionary page scan.
cittabhedam. contrariety of purpose or will View this entry on the original dictionary page scan.
cittacetasikam. thought View this entry on the original dictionary page scan.
cittakhedam. grief View this entry on the original dictionary page scan.
cittavedanāf. equals -kheda- View this entry on the original dictionary page scan.
cittavikṣepam. absence of mind, View this entry on the original dictionary page scan.
cittaviśleṣam. "parting of hearts", breach of friendship View this entry on the original dictionary page scan.
cūḍālaveśamfn. varia lectio for cāṇḍ-. View this entry on the original dictionary page scan.
cukravedhakan. a kind of sour rice-gruel View this entry on the original dictionary page scan.
cūrṇakeśam. equals -kuntala- View this entry on the original dictionary page scan.
cūrṇapeṣamind. (with piṣ-,to grind) so as to pulverise View this entry on the original dictionary page scan.
dabhracetas(r/a--) mfn. little-minded, . View this entry on the original dictionary page scan.
dadhidhenuf. a cow represented by d/adhi- (offered to priests) View this entry on the original dictionary page scan.
dadhisneham. equals -maṇḍa- View this entry on the original dictionary page scan.
dadhisvedam. butter-milk View this entry on the original dictionary page scan.
dādhreyakam. a patronymic (also plural) View this entry on the original dictionary page scan.
dagdheṣṭakāf. a burnt brick View this entry on the original dictionary page scan.
ḍāgineya yaka- Name of a gambler, . View this entry on the original dictionary page scan.
dahanaketanam. "mark of burning", smoke View this entry on the original dictionary page scan.
daiśeyam. metron. fr. 2. dis- gaRa śubhrādi-. View this entry on the original dictionary page scan.
daiteyam. (fr. diti-) a son or descendant of diti-, an asura- etc. View this entry on the original dictionary page scan.
daiteyam. Name of rāhu- View this entry on the original dictionary page scan.
daiteyamf(ī-)n. proceeding from or belonging to the daiteya-s View this entry on the original dictionary page scan.
daitef. a female descendant of diti- View this entry on the original dictionary page scan.
daityadevam. "god of the daitya-s", varuṇa- View this entry on the original dictionary page scan.
daityadevam. Wind View this entry on the original dictionary page scan.
daityamedajam. "produced from the marrow of daitya-s", a kind of bdellium View this entry on the original dictionary page scan.
daityamedajāf. the earth (supposed to be produced from the marrow of madhu- and kaiṭabha-) View this entry on the original dictionary page scan.
daityasef. Name of a daughter of prajā-pati- and sister of deva-senā- View this entry on the original dictionary page scan.
daityejyam. equals tya-guru- View this entry on the original dictionary page scan.
daityendram. " daitya-s-prince", Name of pātāla--ketu View this entry on the original dictionary page scan.
daityendrapūjyam. equals tyejya- View this entry on the original dictionary page scan.
daivalekhakam. fortune-teller, astrologer View this entry on the original dictionary page scan.
daivatareyam. patronymic fr. deva-tara- gaRa śubhrādi-. 2. View this entry on the original dictionary page scan.
daivayāneyam. metron. fr. deva-yānī- View this entry on the original dictionary page scan.
daivayogenaind. by chance, accidentally View this entry on the original dictionary page scan.
daivejyamfn. sacred to the planet Jupiter (topaz) View this entry on the original dictionary page scan.
dākṣāyaṇyagnipraveśam. Name of a chapter of View this entry on the original dictionary page scan.
daksehiṇāvartamfn. turning (from the left) to the right (a conch-shell ; kuṇḍala- ;a fruit ;a woman's navel ) View this entry on the original dictionary page scan.
daksehiṇāvartamfn. moving in the southern course (the sun) View this entry on the original dictionary page scan.
daksehiṇāvartam. a conch-shell opening to the right View this entry on the original dictionary page scan.
dakṣeśvaraliṅgan. Name of a liṅga-, View this entry on the original dictionary page scan.
dākṣeyam. "son of dākṣī-", metron. of pāṇini- (see ) View this entry on the original dictionary page scan.
dākṣef. "daughter of dākṣi-"(?), metron. of the mother of parrots (see ) . View this entry on the original dictionary page scan.
dakṣiṇādeśanan. (ṇād-) thanksgiving View this entry on the original dictionary page scan.
dakṣiṇādeśanāf. View this entry on the original dictionary page scan.
dakṣiṇapūrveṇaind. instrumental case south-east from (accusative), View this entry on the original dictionary page scan.
dakṣiṇeind. locative case on the right side View this entry on the original dictionary page scan.
dakṣiṇenaind. instrumental case on the right or south (), on the right side of or southward from (accusative; ) etc. (with kṛ-,to place or leave on the right ) View this entry on the original dictionary page scan.
dakṣiṇermamfn. broken on the right side (a cart) View this entry on the original dictionary page scan.
dakṣiṇermanmfn. (1 26) equals ṇālrus- View this entry on the original dictionary page scan.
dakṣiṇetaramfn. "other than right", left View this entry on the original dictionary page scan.
dakṣiṇetif. (equals ṇāyana-) the sun's progress south of the equator View this entry on the original dictionary page scan.
dākṣiṇeyamfn. having a claim on the sacrificial gift, View this entry on the original dictionary page scan.
dalegandhim. "fragrance in the leaf", Alstonia scholaris View this entry on the original dictionary page scan.
dāmodaradevam. Name of a man View this entry on the original dictionary page scan.
damopetamfn. endowed with self-control, View this entry on the original dictionary page scan.
daṃśerafor daś- View this entry on the original dictionary page scan.
daṃṣṭrāsenam. Name of a scholar
dānahemādrim. equals -khaṇḍa-. View this entry on the original dictionary page scan.
dānakelikaumudīf. Name of work View this entry on the original dictionary page scan.
dānavendram. chief of the danu- View this entry on the original dictionary page scan.
dānaveyam. a dānava- or demon View this entry on the original dictionary page scan.
daṇḍaketum. Name of a man View this entry on the original dictionary page scan.
daṇḍaleśan. a small fine View this entry on the original dictionary page scan.
daṇḍaneṭrim. "rod-applier" See adhi-- View this entry on the original dictionary page scan.
daṇḍaneṭritvan. judicature () . View this entry on the original dictionary page scan.
daṇḍasenam. Name of a son of viṣvak-sena- View this entry on the original dictionary page scan.
daṇḍasenam. of another prince (equals -dhāra-) View this entry on the original dictionary page scan.
daṇḍeśam. equals ḍa-mukha- View this entry on the original dictionary page scan.
dantacchedanan. biting through View this entry on the original dictionary page scan.
dāntadevam. Name of men. View this entry on the original dictionary page scan.
dantalekhakam. one who lives by painting the teeth on View this entry on the original dictionary page scan.
dantapraveṣṭaa case round an elephant's tusk View this entry on the original dictionary page scan.
dāntasenam. Name of men. View this entry on the original dictionary page scan.
dantaveṣṭan. equals tana- View this entry on the original dictionary page scan.
dantaveṣṭan. the gums (dual number"the gums of the upper and lower jaw") (of an elephant) , tumour of the gums, View this entry on the original dictionary page scan.
dantaveṣṭakam. idem or 'n. the gums (dual number"the gums of the upper and lower jaw") (of an elephant) , tumour of the gums, ' , 11 View this entry on the original dictionary page scan.
dantaveṣṭakam. dual number the gums of the upper and lower, jaw View this entry on the original dictionary page scan.
dantaveṣṭanan. equals -praveṣṭa- View this entry on the original dictionary page scan.
danteyam. indra- (varia lectio datt-) View this entry on the original dictionary page scan.
dantodbhedam. appearance of the teeth, dentition View this entry on the original dictionary page scan.
danujedram. a dānava- prince View this entry on the original dictionary page scan.
darbheṇḍvacovering for the hands made of darbha- grass (?), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
darbheṣīkāf. a stalk of d- grass View this entry on the original dictionary page scan.
darendram. viṣṇu-'s conch View this entry on the original dictionary page scan.
darśanavivekam. Name of work View this entry on the original dictionary page scan.
darśanepsumfn. equals na-lālasa-. View this entry on the original dictionary page scan.
darśapaurṇamāseṣṭi - f. equals darśa-pūrṇ-. View this entry on the original dictionary page scan.
darśapūrṇamāsadevatāf. the deity presiding on those days View this entry on the original dictionary page scan.
darśapūrṇamāseṣṭif. a new and full moon sacrifice. View this entry on the original dictionary page scan.
dārteyam. patronymic (fr. dṛti-) View this entry on the original dictionary page scan.
dārukeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
darvīpralepam. Name of an unguent View this entry on the original dictionary page scan.
dāsaketum. Name of a son of manu- dakṣasāvarṇa- View this entry on the original dictionary page scan.
dāsameyam. pI. Name of a people to the north of madhya-deśa- (Scholiast or Commentator dāś-). View this entry on the original dictionary page scan.
daśapeyam. Name of a soma- libation (part of a rāja-sūya-) View this entry on the original dictionary page scan.
dāśārṇeśam. a king of the daśārṇa- View this entry on the original dictionary page scan.
daśārṇeyum. Name of a son of raudrāśva- View this entry on the original dictionary page scan.
dāśāśvamedha wrong reading for daś- (q.v) View this entry on the original dictionary page scan.
daśāśvamedhan. the tīrtha- of the 10 horse-sacrifices, View this entry on the original dictionary page scan.
daśāśvamedhan. see dāś-. View this entry on the original dictionary page scan.
daśāśvamedhikan. idem or 'n. see dāś-.' View this entry on the original dictionary page scan.
dāsaveśa(s/a-.) m. probably Name of a man View this entry on the original dictionary page scan.
daśāviśeṣam. any particular state , View this entry on the original dictionary page scan.
daśendhanam. "wick-kindling", a lamp View this entry on the original dictionary page scan.
daśendramfn. worshipping the 10 indrāṇī-s on Va1rtt. 2 and Va1rtt. 2 ; View this entry on the original dictionary page scan.
daśendriyan. plural the 10 organs (ind- q.v) View this entry on the original dictionary page scan.
dāśeram. fisherman (varia lectio dās-) View this entry on the original dictionary page scan.
dāśeram. camel View this entry on the original dictionary page scan.
dāseram. = dāseya-1 View this entry on the original dictionary page scan.
dāseram. a fisherman (see dāś-) View this entry on the original dictionary page scan.
dāseram. a camel View this entry on the original dictionary page scan.
daśeramfn. ( daṃś-) mordaceous, injuring View this entry on the original dictionary page scan.
daśeramfn. attacking or killing any one when asleep View this entry on the original dictionary page scan.
daśeran. a beast of prey View this entry on the original dictionary page scan.
dāśerakam. fisherman View this entry on the original dictionary page scan.
dāśerakam. plural Name of a people (equals daś-) View this entry on the original dictionary page scan.
dāśerakaa camel, . View this entry on the original dictionary page scan.
dāserakam. = dāseya-1 View this entry on the original dictionary page scan.
dāserakam. a fisherman (see dāś-) View this entry on the original dictionary page scan.
dāserakam. a camel Name of a man plural in fine compositi or 'at the end of a compound' his descendants View this entry on the original dictionary page scan.
dāserakam. of a people (see dāś-) View this entry on the original dictionary page scan.
daśerakam. an ass (see dasra-) View this entry on the original dictionary page scan.
daśerakam. plural Name of a people (equals maru-; see dāś- sg. their country ) (śair-derived fr. 2. daśa-) ; vii, 397 View this entry on the original dictionary page scan.
daśerakam. see agniveśa-- View this entry on the original dictionary page scan.
daśerakagaḍerakam. plural the descendants of daśera- and gaḍeraka- gaRa tika-kitavādi- () View this entry on the original dictionary page scan.
dāserakīf. a female camel View this entry on the original dictionary page scan.
dāserakim. patronymic fr. dāseraka- , View this entry on the original dictionary page scan.
daśeśam. equals śa-pa- View this entry on the original dictionary page scan.
dāśeyam. (fr. dāśī-) the son of a fisherman's wife View this entry on the original dictionary page scan.
dāśeya dāśera- See above. View this entry on the original dictionary page scan.
dāseyam. (fr. dāsī-) the son of a female slave View this entry on the original dictionary page scan.
dāseyam. slave, servant View this entry on the original dictionary page scan.
dāseyaSee dāśeya-. View this entry on the original dictionary page scan.
dāśef. equals dāśa-nandinī- (also written dāseya- f. ī-). View this entry on the original dictionary page scan.
dasradevatāf. "having the aśvin-s as deity", the nakṣatra- aśvinī- View this entry on the original dictionary page scan.
dātreyam. a patron., ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
dattātreyam. Name of a sage (son of atri- by anasūyā- who favoured arjuna- kārtavīrya-). (brahmā-, viṣṇu-, and śiva- propitiated by his penance became in portions of themselves severally his sons soma-, datta-, and dur-vāsas-;hence worshipped as representing the Triad) View this entry on the original dictionary page scan.
dattātreyam. Name of an author View this entry on the original dictionary page scan.
dattātreyam. plural Name of a family View this entry on the original dictionary page scan.
dattatreyāpaniṣadf. Name of an View this entry on the original dictionary page scan.
dattatreyāṣṭottaraśatanāmastotran. Name of a chapter of View this entry on the original dictionary page scan.
dattātreyīyan. "story of treya- ", Name of View this entry on the original dictionary page scan.
dātteyam. metron. fr. dattā-, 1, 121 View this entry on the original dictionary page scan.
datteyam. indra- View this entry on the original dictionary page scan.
dauḥśaleyam. prob. metron. fr. duh-śala- View this entry on the original dictionary page scan.
dauleyam. (fr. duli-) a turtle or tortoise View this entry on the original dictionary page scan.
daurbhāgineyam. the son of a woman disliked by her husband (gaRa kalyāṇy-ādi-) View this entry on the original dictionary page scan.
daurbhāginef. the daughter of a disliked woman. View this entry on the original dictionary page scan.
daureśravasam. (fr. dūre-śravas-) patronymic of the serpent-priest pṛthu-śravas- View this entry on the original dictionary page scan.
daureśrutam. (fr. dūre-śruta-) patronymic of the serpent-priest timirgha- View this entry on the original dictionary page scan.
dauṣkuleyamf(ī-)n. sprung from a bad or low race View this entry on the original dictionary page scan.
de cl.1 A1. dayate- ; perfect tense digye- , to protect, defend: Desiderative ditsate-, [ confer, compare 1. datta-;4. 5. -.] View this entry on the original dictionary page scan.
debeśvaram. "lord of the body", the soul View this entry on the original dictionary page scan.
dedīpyamāna( dīp-, Intensive) shining intensely, glowing, blazing View this entry on the original dictionary page scan.
dedīyitavai dative case infinitive mood of 1. -, Intensive View this entry on the original dictionary page scan.
dehamn. ( dih-,to plaster, mould, fashion) the body etc. View this entry on the original dictionary page scan.
deham. (in a triad with manas-and vāc-) View this entry on the original dictionary page scan.
deham. (haṃdhāraya-,to support the body id est exist ) View this entry on the original dictionary page scan.
deham. form, shape, mass, bulk (as of a cloud; in fine compositi or 'at the end of a compound' f(ā-).) View this entry on the original dictionary page scan.
deham. person, individual View this entry on the original dictionary page scan.
deham. appearance, manifestation in fine compositi or 'at the end of a compound' having the appearance of (saṃdeha-- ) View this entry on the original dictionary page scan.
deham. Name of a country View this entry on the original dictionary page scan.
dehabaddhamfn. embodied, View this entry on the original dictionary page scan.
dehabandhamfn. furnished with a body (baddha-?). View this entry on the original dictionary page scan.
dehabhājm. "possessed of a body", corporeal View this entry on the original dictionary page scan.
dehabhājm. living creature (especially man), View this entry on the original dictionary page scan.
dehabhedam. "destruction of the body", death View this entry on the original dictionary page scan.
dehabhṛtmfn. "carrying a body", embodied, corporeal View this entry on the original dictionary page scan.
dehabhṛtm. a living creature (especially man) View this entry on the original dictionary page scan.
dehabhṛtm. Name of śiva- (see -bhuj-) View this entry on the original dictionary page scan.
dehabhṛtm. life, vitality View this entry on the original dictionary page scan.
dehabhujm. "possessing a body", Name of śiva- View this entry on the original dictionary page scan.
dehacaramfn. being on or in a body, bodily (as disease) View this entry on the original dictionary page scan.
dehacaryāf. care of the body View this entry on the original dictionary page scan.
dehacatuṣṭayavyavasthālakṣaṇan. Name of work View this entry on the original dictionary page scan.
dehacyutamfn. separated from the body (as excrement or the spirit) View this entry on the original dictionary page scan.
dehadam. "body-(life?) giving", quicksilver (see pāra--). View this entry on the original dictionary page scan.
dehadāham. "body-heat", fever View this entry on the original dictionary page scan.
dehadhārakam. "body Supporter", bone
dehadhāraṇan. "supporting the body", living, life, existence View this entry on the original dictionary page scan.
dehadhārinmfn. having a body, living, alive View this entry on the original dictionary page scan.
dehadharmam. function or law of the body View this entry on the original dictionary page scan.
dehadhātṛm. (for dhātu-?) chief part or element of the body (see dhātu-). View this entry on the original dictionary page scan.
dehadhim. "body-receptacle", wing View this entry on the original dictionary page scan.
dehadhṛkm. (Nominal verb) "sustaining the body", air, wind View this entry on the original dictionary page scan.
dehadīpam. "body-lamp", the eye View this entry on the original dictionary page scan.
dehagatamfn. "gone into a body", incarnate View this entry on the original dictionary page scan.
dehagrahaṇan. assuming a body or visible form View this entry on the original dictionary page scan.
dehajam. "body-born", a son (see tanu--) View this entry on the original dictionary page scan.
dehajam. the god of love, diś-. View this entry on the original dictionary page scan.
dehakaram. "body-former", a father View this entry on the original dictionary page scan.
dehakartṛm. idem or 'm. "body-former", a father ' View this entry on the original dictionary page scan.
dehakartṛm. Name of the sun View this entry on the original dictionary page scan.
dehakośam. "body-covering", skin or wing (see -dhi-). View this entry on the original dictionary page scan.
dehakṛtm. a father View this entry on the original dictionary page scan.
dehakṛtm. Name of śiva- View this entry on the original dictionary page scan.
dehakṣayam. "body-decay", sickness, disease View this entry on the original dictionary page scan.
dehalāf. spirituous liquor View this entry on the original dictionary page scan.
dehalakṣaṇan. "body-mark", mole View this entry on the original dictionary page scan.
dehalīf. (rarely li-) the threshold of a door or a raised terrace in front of it View this entry on the original dictionary page scan.
dehalīdīpanyāyam. the rule of the lamp placed over the threshold (id est giving light to both sides, and so serving a twofold purpose), View this entry on the original dictionary page scan.
dehalīmuktapuṣpan. a flower dropped on the threshold View this entry on the original dictionary page scan.
dehalīśastotran. "praise of the lord of the threshold", Name of two hymns. View this entry on the original dictionary page scan.
dehalīśastutif. View this entry on the original dictionary page scan.
dehamadhyan. "middle of the body", waist View this entry on the original dictionary page scan.
dehamāninmfn. proud of the body View this entry on the original dictionary page scan.
dehamātrāvaśeṣitamfn. having merely the body left View this entry on the original dictionary page scan.
dehambharamfn. intent (only) upon nourishing the body or prolonging life View this entry on the original dictionary page scan.
dehambharavārttikamfn. idem or 'mfn. intent (only) upon nourishing the body or prolonging life ' View this entry on the original dictionary page scan.
dehambharavārttikamfn. voracious, gluttonous (see udaram-bh-). View this entry on the original dictionary page scan.
dehāntam. end of the body, death View this entry on the original dictionary page scan.
dehāntaran. another body View this entry on the original dictionary page scan.
dehāntaraprāptif. obtaining another body, transmigration idem or 'n. another body ' View this entry on the original dictionary page scan.
dehapātam. () "decay of the body", death. View this entry on the original dictionary page scan.
dehapatanan. () "decay of the body", death. View this entry on the original dictionary page scan.
deharakṣāf. "care of the body", chastity View this entry on the original dictionary page scan.
dehārim. "foe of the body", Name of śiva- (as varia lectio for kāhali-). View this entry on the original dictionary page scan.
dehasaṃcāriṇīf. "issued from or passing through (her father's) body (?)", a daughter View this entry on the original dictionary page scan.
dehaśaṅkum. a pillar of stone (?) View this entry on the original dictionary page scan.
dehasāram. "body essence", marrow View this entry on the original dictionary page scan.
dehāsavam. "body-liquid", urine View this entry on the original dictionary page scan.
dehasiddhisādhanan. Name of work View this entry on the original dictionary page scan.
dehasthavarodayam. Name of work View this entry on the original dictionary page scan.
dehasukhamfn. agreeable to the body View this entry on the original dictionary page scan.
dehatantramfn. whose chief kind of existence is corporeal View this entry on the original dictionary page scan.
dehātmavādam. "assertion that the soul is body", materialism View this entry on the original dictionary page scan.
dehātmavādinm. materialist, cārvāka- View this entry on the original dictionary page scan.
dehatvan. the state or condition of a body View this entry on the original dictionary page scan.
dehatyāgam. relinquishing the body, death View this entry on the original dictionary page scan.
dehāvaraṇan. "body-screen", armour, dress View this entry on the original dictionary page scan.
dehavarmann. "body-armour", the skin View this entry on the original dictionary page scan.
dehāvasānan. equals nta- View this entry on the original dictionary page scan.
dehavatmfn. furnished with a body, embodied View this entry on the original dictionary page scan.
dehavatm. a living creature, man View this entry on the original dictionary page scan.
dehavāyum. "body-wind", vital air View this entry on the original dictionary page scan.
dehavimuktif. abandonment of the body or of life, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
dehavisarjanan. "quitting the body", death View this entry on the original dictionary page scan.
dehavrintan. "body-stalk", navel View this entry on the original dictionary page scan.
dehavṛttif. support of the body View this entry on the original dictionary page scan.
dehayātrāf. supporting the body or prolonging life View this entry on the original dictionary page scan.
dehayātrāf. food, nourishment View this entry on the original dictionary page scan.
dehayātrāf. passing away of the body, dying, death View this entry on the original dictionary page scan.
def. mound, bank, rampart, surrounding wall View this entry on the original dictionary page scan.
dehikāf. a sort of ant or insect which throw's up the earth (see ud--, upa--.). View this entry on the original dictionary page scan.
dehinmfn. having a body, corporeal View this entry on the original dictionary page scan.
dehinm. a living creature, man etc. View this entry on the original dictionary page scan.
dehinm. the spirit, soul (enveloped in the body) View this entry on the original dictionary page scan.
dehinīf. the earth View this entry on the original dictionary page scan.
dehodbhava mfn. born in the body, innate View this entry on the original dictionary page scan.
dehodbhūtamfn. born in the body, innate View this entry on the original dictionary page scan.
dehotkampam. trembling of the body, View this entry on the original dictionary page scan.
delimam. or n. Name of a place View this entry on the original dictionary page scan.
deṅgapālam. Name of a man View this entry on the original dictionary page scan.
deṇṭikāSee nāga--. View this entry on the original dictionary page scan.
erikāf. a musk rat View this entry on the original dictionary page scan.
deśam. (1. diś-) point, region, spot, place, part, portion & etc. View this entry on the original dictionary page scan.
deśam. province, country, kingdom View this entry on the original dictionary page scan.
deśam. institute, ordinance (deśam- ā- vas-,or ni-viś-,to settle in a place ; śe-,in the proper place [ especially with kāle-] Often in fine compositi or 'at the end of a compound' [f(ā-). ] especially after a word denoting a country or a part of the body exempli gratia, 'for example' kāmboja--, magadha--; aṃsa--, kaṇṭha--, skandha--; ātmīya--,one's own country or home) View this entry on the original dictionary page scan.
deśabhan. the asterism dominating a country View this entry on the original dictionary page scan.
deśabhaṅgam. ruin of a country View this entry on the original dictionary page scan.
deśabhāṣāf. the language or dialect of a country View this entry on the original dictionary page scan.
deśabhāṣāntaran. a foreign language or dialect View this entry on the original dictionary page scan.
deśabhāṣāvijñānan. its knowledge (one of the 64 kalā-s) View this entry on the original dictionary page scan.
deśabhramaṇan. wandering about a country, peregrination, touring View this entry on the original dictionary page scan.
deśabhraṃśam. ruin of a country, View this entry on the original dictionary page scan.
deśācāram. local usage or custom View this entry on the original dictionary page scan.
deśacyutif. banishment or flight from one's country View this entry on the original dictionary page scan.
deśadharmam. law or usage of a country View this entry on the original dictionary page scan.
deśadṛṣṭamfn. seen (id est usual or customary) in a country View this entry on the original dictionary page scan.
deśadṛṣṭamfn. locally considered, judged as to place View this entry on the original dictionary page scan.
deśaja mfn. "country born", native, born or produced in the right place, genuine (as horses, elephants etc.) View this entry on the original dictionary page scan.
deśajātamfn. "country born", native, born or produced in the right place, genuine (as horses, elephants etc.) View this entry on the original dictionary page scan.
deśajñamfn. knowing a district, familiar with places View this entry on the original dictionary page scan.
deśakamfn. (in fine compositi or 'at the end of a compound') showing, pointing out View this entry on the original dictionary page scan.
deśakam. shower, indicator (san-mārga-- ; dharma-- varia lectio d-) View this entry on the original dictionary page scan.
deśakam. ruler, instructor View this entry on the original dictionary page scan.
deśakālam. dual number place and time View this entry on the original dictionary page scan.
deśakālam. (sg.) place and time for (genitive case) View this entry on the original dictionary page scan.
deśakālajñamfn. knowing place and time () View this entry on the original dictionary page scan.
deśakālavibhāgam. apportioning of place and time View this entry on the original dictionary page scan.
deśakālavidmfn. knowing place and time () View this entry on the original dictionary page scan.
deśakālavirodhinmfn. neglecting place and time View this entry on the original dictionary page scan.
deśakālavyatītamfn. regardless of place and time View this entry on the original dictionary page scan.
deśakālavyavasthitamfn. regulated by place and time View this entry on the original dictionary page scan.
deśakaṇṭakam. "country's thorn", public calamity View this entry on the original dictionary page scan.
deśakapaṭun. a mushroom View this entry on the original dictionary page scan.
deśakārīf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
deśākhyam. (in music) Name of a rāga- View this entry on the original dictionary page scan.
deśākhyāf. of a rāgiṇī- (also khyikā-). View this entry on the original dictionary page scan.
deśākramaṇan. invasion of a country View this entry on the original dictionary page scan.
deśamānikam. plural Name of a people (varia lectio daśa--) View this entry on the original dictionary page scan.
deśanāf. direction, instruction View this entry on the original dictionary page scan.
deśanirṇayam. "description of country", Name of work View this entry on the original dictionary page scan.
deśāntaran. another country, abroad View this entry on the original dictionary page scan.
deśāntaran. longitude, the difference from the prime meridian View this entry on the original dictionary page scan.
deśāntarabhāṇḍānayanan. importing wares from foreign countries View this entry on the original dictionary page scan.
deśāntaragamanan. going abroad, travelling View this entry on the original dictionary page scan.
deśāntaramṛtakriyānirūpaṇan. Name of work View this entry on the original dictionary page scan.
deśāntaraphalan. the equation for difference of meridian View this entry on the original dictionary page scan.
deśāntarasthamfn. being in a foreign country, View this entry on the original dictionary page scan.
deśāntarinmfn. belonging to a foreign country, a foreigner View this entry on the original dictionary page scan.
deśāntaritamfn. living in a foreign country View this entry on the original dictionary page scan.
deśapālīf. (in music) Name of a rāga-. View this entry on the original dictionary page scan.
deśāpokṣāf. spying or inspecting a land View this entry on the original dictionary page scan.
deśarājacaritan. "history of native princes", Name of work View this entry on the original dictionary page scan.
deśarakṣinm. protector of a country, king View this entry on the original dictionary page scan.
deśarūpan. conformity with place, propriety, fitness View this entry on the original dictionary page scan.
deśasaukhyan. Name of a chapter of the ṭoḍarānanda-. View this entry on the original dictionary page scan.
deśasthamfn. situated or living in a country View this entry on the original dictionary page scan.
deśasvāminm. lord or prince of a country View this entry on the original dictionary page scan.
deśāṭanan. roaming through a land, travelling View this entry on the original dictionary page scan.
deśātithim. "land-guest", foreigner View this entry on the original dictionary page scan.
deśāvakāśikan. (with jaina-s) a particular vow or observance View this entry on the original dictionary page scan.
deśāvakāśikavratan. idem or 'n. (with jaina-s) a particular vow or observance' View this entry on the original dictionary page scan.
deśavāsinmfn. residing in a country View this entry on the original dictionary page scan.
deśavibhraṃśam. equals -bhaṅga- View this entry on the original dictionary page scan.
deśavirodhin (), mfn. contradictory as to time. View this entry on the original dictionary page scan.
deśaviruddha(), mfn. contradictory as to time. View this entry on the original dictionary page scan.
deśavṛttan. a circle depending upon its relative position to the place of the observer View this entry on the original dictionary page scan.
deśavyavahāram. custom or usage of a country View this entry on the original dictionary page scan.
deśīf. See deśī-. View this entry on the original dictionary page scan.
deśīf. (scilicet bhāṣā-) the vulgar dialect of a country (opp. to saṃskṛta-), provincialism View this entry on the original dictionary page scan.
deśīf. deśītva -tva- n. ; ; View this entry on the original dictionary page scan.
deśīf. a vulgar mode of singing View this entry on the original dictionary page scan.
deśīf. dance (opp. to mārga-,pantomime) View this entry on the original dictionary page scan.
deśīf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
deśikamfn. familiar with a place, a guide (literally and figuratively) (varia lectio daiś- see a--[add.]) View this entry on the original dictionary page scan.
deśikam. a Guru or spiritual teacher View this entry on the original dictionary page scan.
deśikam. a traveller View this entry on the original dictionary page scan.
deśīkaṭṭarif. (in music) a kind of dance (mus.) View this entry on the original dictionary page scan.
deśikavijayam. Name of work View this entry on the original dictionary page scan.
deśikopaniṣadf. Name of work View this entry on the original dictionary page scan.
deśīkośam. a vocabulary of provincialisms View this entry on the original dictionary page scan.
deśinmfn. showing, instructing, guiding etc. View this entry on the original dictionary page scan.
deśinmfn. of or belonging to a country View this entry on the original dictionary page scan.
deśīnāmamālāf. Name of a dictionary of provincialisms by View this entry on the original dictionary page scan.
deśinīf. the index or forefinger View this entry on the original dictionary page scan.
deśīnṛtyan. (in music) country dance. View this entry on the original dictionary page scan.
deśīprakāśam. Name of a dictionary of provincialisms Scholiast or Commentator on View this entry on the original dictionary page scan.
deśīśabdasaṃgraham. equals -nāma-mālā- View this entry on the original dictionary page scan.
deśitamfn. shown, directed, instructed View this entry on the original dictionary page scan.
deśītālan. (in music) a kind of measure. View this entry on the original dictionary page scan.
deśītvan. deśī View this entry on the original dictionary page scan.
deśīvarāḍīf. (in music) Name of a rāga-. View this entry on the original dictionary page scan.
deśīyamfn. peculiar or belonging to or inhabiting a country, provincial, native (especially in fine compositi or 'at the end of a compound' exempli gratia, 'for example' māgadha--a native of magadha-, ) View this entry on the original dictionary page scan.
deśīyamfn. bordering on, resembling, almost, nearly (in fine compositi or 'at the end of a compound' and regarded asa suffix ; see pañca-varṣaka--., paṭu--, ṣaḍvarṣa-.). View this entry on the original dictionary page scan.
deśīyarājaśekharakośam. Name of work View this entry on the original dictionary page scan.
deśīyaśabdasaṃgraham. equals śī-ś- View this entry on the original dictionary page scan.
deśīyavarāḍīf. equals śī-v- View this entry on the original dictionary page scan.
deṣṇan. giving, a gift (see kumāra--, cāru--, tuvi--etc.) View this entry on the original dictionary page scan.
deṣṇumfn. giving, liberal View this entry on the original dictionary page scan.
deṣṇumfn. equals dur-dama- or dur-gama- View this entry on the original dictionary page scan.
deṣṇum. (fr. dai-) a washerman. View this entry on the original dictionary page scan.
deśopadeśam. Name of a poem (see śa-nirṇaya-). View this entry on the original dictionary page scan.
desopasargam. distress of a country, calamity in a country
deṣṭavyamfn. to be pointed out or shown or declared View this entry on the original dictionary page scan.
deṣṭhamfn. (fr.1. -) giving most or best View this entry on the original dictionary page scan.
deṣṭṛm. pointer, indicator (kupatha-- ) View this entry on the original dictionary page scan.
deṣṭran. indication, direction View this entry on the original dictionary page scan.
deṣṭrīf. Name of a divine female View this entry on the original dictionary page scan.
deśyamfn. to be pointed or picked out, excellent in its kind, standard View this entry on the original dictionary page scan.
deśyamfn. being on the spot or present, witness (? varia lectio deśa-) View this entry on the original dictionary page scan.
deśyamfn. equals deśīya-, in all meanings (-tva-, ) (see tad--, nānā--, paṭu--, vanāyu--, vitasti--, śiśu--) View this entry on the original dictionary page scan.
deśyamfn. born in the country, indigenous, a true native (see deśa-ja-) View this entry on the original dictionary page scan.
deśyan. the proposition or statement (equals pūrva-pakṣa-) View this entry on the original dictionary page scan.
deśyan. the fact or charge to be proved or substantiated View this entry on the original dictionary page scan.
deśyabhikṣum. a native mendicant View this entry on the original dictionary page scan.
deśyanidarśanan. Name of glossaries. View this entry on the original dictionary page scan.
deśyanighaṇṭum. View this entry on the original dictionary page scan.
deuliyan. (Prakritfor devakulya-?) Name of a grāma- View this entry on the original dictionary page scan.
devSee 1. 2. div-. View this entry on the original dictionary page scan.
devamf(ī-)n. (fr. 3. div-) heavenly, divine (also said of terrestrial things of high excellence) (superl. devatama dev/a-tama-m. ; devitamā devi-tamā- f., ) View this entry on the original dictionary page scan.
devam. (according to d/eva-) a deity, god etc. etc. View this entry on the original dictionary page scan.
devam. (rarely applied to) evil demons View this entry on the original dictionary page scan.
devam. (plural the gods as the heavenly or shining ones; v/iśve dev/ās-,all the gods , or a particular class of deities [see under v/iśva-],often reckoned as 33, either 11 for each of the 3 worlds [ see tri-daśa-],or 8 vasu-s, 11 rudra-s, and 12 āditya-s [to which the 2 aśvin-s must be added] ; see also ;with jaina-s 4 classes, viz. bhavanādhīśa-, vyantara-, jyotiṣka-,and vaimānika-; dev/ānām p/atnyas-,the wives of the gods [ see deva-patnī-below])
devam. Name of the number 33 (See above) View this entry on the original dictionary page scan.
devam. Name of indra- as the god of the sky and giver of rain etc. View this entry on the original dictionary page scan.
devam. a cloud View this entry on the original dictionary page scan.
devam. (with jaina-s) the 22nd arhat- of the future ut-sarpiṇī- View this entry on the original dictionary page scan.
devam. the image of a god, an idol View this entry on the original dictionary page scan.
devam. a god on earth or among men, either Brahman, priest (see bhū-d-), or king, prince (as a title of honour, especially in the vocative case"your majesty"or"your honour";also in fine compositi or 'at the end of a compound' exempli gratia, 'for example' śrī-harṣa-d-, vikramāṅka-d-,king śrī-- harṣa- or vikramāṅka-, and in names as puruṣottama-d-[lit. having viṣṇu- as one's deity; see atithi-d-, ācārya-d-, pitṛ-d-, mātṛ-d-];rarely preceding the name exempli gratia, 'for example' deva-caṇḍamahāsena- ) etc. (see kṣiti--, nara--,etc.) View this entry on the original dictionary page scan.
devam. a husband's brother (see devṛ-and devara-) View this entry on the original dictionary page scan.
devam. a fool, dolt View this entry on the original dictionary page scan.
devam. a child View this entry on the original dictionary page scan.
devam. a man following any particular line or business View this entry on the original dictionary page scan.
devam. a spearman, lancer View this entry on the original dictionary page scan.
devam. emulation, wish to excel or overcome View this entry on the original dictionary page scan.
devam. sport, play View this entry on the original dictionary page scan.
devam. a sword View this entry on the original dictionary page scan.
devam. Name of men View this entry on the original dictionary page scan.
devam. of a disciple of nāgārjuna- View this entry on the original dictionary page scan.
devam. diminutive for devadatta- Va1rtt.4 Sch. View this entry on the original dictionary page scan.
devan. () an organ of sense View this entry on the original dictionary page scan.
def. Hibiscus Mutabilis or Marsilia Quadrifolia View this entry on the original dictionary page scan.
devabāhum. "the arm of the gods", Name of an ancient ṛṣi- View this entry on the original dictionary page scan.
devabāhum. of a son of hṛdika- View this entry on the original dictionary page scan.
devabalam. "having divine strength", Name of a general View this entry on the original dictionary page scan.
devabalāf. Sida Rhomboidea View this entry on the original dictionary page scan.
devabalim. oblation to the gods View this entry on the original dictionary page scan.
devabandhumfn. (v/a--) related to the gods View this entry on the original dictionary page scan.
devabandhum. Name of a ṛṣi- View this entry on the original dictionary page scan.
devabhadram. Name of an author View this entry on the original dictionary page scan.
devabhāgam. "the portion of the gods", the northern hemisphere (opp. to asura--) View this entry on the original dictionary page scan.
devabhāgam. (g/a-), Name of a teacher called also srauta- or śrautarṣa- View this entry on the original dictionary page scan.
devabhāgam. of a son of sūra- and brother of vasu-deva- View this entry on the original dictionary page scan.
devabhakta(v/a--) mfn. distributed by the gods View this entry on the original dictionary page scan.
devabhaktif. service of the gods View this entry on the original dictionary page scan.
devabhāṣyasnānavidhipaddhatif. Name of work View this entry on the original dictionary page scan.
devabhaṭṭam. Name of a man View this entry on the original dictionary page scan.
devabhavanan. "divine abode", heaven View this entry on the original dictionary page scan.
devabhavanan. temple View this entry on the original dictionary page scan.
devabhavanan. Ficus Religiosa View this entry on the original dictionary page scan.
devābhimukham. a particular samādhi- View this entry on the original dictionary page scan.
devabhiṣajm. physician of the gods (the aśvin-s) View this entry on the original dictionary page scan.
devābhīṣṭāf. "desired by the gods", Piper Betel View this entry on the original dictionary page scan.
devabhītif. fear of the gods (?) gaRa dāsī-bhārādi-.
devabhogam. pleasure of the gods, heavenly joy View this entry on the original dictionary page scan.
devabhojyan. "food of gods", amṛta- View this entry on the original dictionary page scan.
devabhojyan. nectar View this entry on the original dictionary page scan.
devabhrājm. (Nominal verb -),"shining like a god", Name of a son of mahya-, son of vivasvat- (the sun) View this entry on the original dictionary page scan.
devabhūm. a god or (f.?) heaven View this entry on the original dictionary page scan.
devabhūto become a god View this entry on the original dictionary page scan.
devabhūmiv l for prec. m. View this entry on the original dictionary page scan.
devabhūrim. varia lectio for ti- m. View this entry on the original dictionary page scan.
devabhūtamfn. having become a god View this entry on the original dictionary page scan.
devabhūtim. Name of the last prince of the śuṅga- dynasty (varia lectio mi-and ri-) View this entry on the original dictionary page scan.
devabhūtif. the Ganges of the sky View this entry on the original dictionary page scan.
devabhūyan. godhead, divinity ( devabhūyaṃgata yaṃgata- mfn.gone to divine, i.e. dead ) View this entry on the original dictionary page scan.
devabhūyaṃgatamfn. devabhūya
devabodham. "having divine knowledge", Name of a poet and a Scholiast or Commentator on View this entry on the original dictionary page scan.
devabodhim. "god-inspired", Name of a poet View this entry on the original dictionary page scan.
devabodhisattvam. Name of a Buddhist saint. View this entry on the original dictionary page scan.
devabrahmanm. "a Brahman among the gods", Name of nārada- Brahman esteemed by the gods View this entry on the original dictionary page scan.
devabrahmaṇasātkṛto present to the gods and Brahmans (wrongly sata-kṛ-). View this entry on the original dictionary page scan.
devācmf(ā-)n. directed towards the gods View this entry on the original dictionary page scan.
devacakran. a divine wheel View this entry on the original dictionary page scan.
devacakran. (with śākta-s)"the holy circle" , Name of a mystical diagram View this entry on the original dictionary page scan.
devacandram. Name of a man View this entry on the original dictionary page scan.
devacaritan. the course of action or practices of the gods View this entry on the original dictionary page scan.
devacaryāf. service of the gods View this entry on the original dictionary page scan.
devācāryam. "divine teacher", Name of a man View this entry on the original dictionary page scan.
devācāryam. of several authors View this entry on the original dictionary page scan.
devācāryadigvijayam. Name of work View this entry on the original dictionary page scan.
devacaryopaśobhitamfn. beautified by it (as a hermitage) View this entry on the original dictionary page scan.
devacchandam. a necklace of pearls (composed of 100 or 103 or 81 or 108 strings) View this entry on the original dictionary page scan.
devacchandaprāsādam. a temple consecrated to a god View this entry on the original dictionary page scan.
devacchandas n. a divine metre View this entry on the original dictionary page scan.
devacchandasan. a divine metre View this entry on the original dictionary page scan.
devacikitsakam. divine physician View this entry on the original dictionary page scan.
devacikitsakam. dual number the two aśvin-s View this entry on the original dictionary page scan.
devacittan. the will of the gods View this entry on the original dictionary page scan.
devadaivatyamfn. "having the gods as deity", destined for the gods View this entry on the original dictionary page scan.
devadālīf. a kind of pumpkin View this entry on the original dictionary page scan.
devadālikā f. a kind of pumpkin View this entry on the original dictionary page scan.
devadamanīf. Name of a woman View this entry on the original dictionary page scan.
devadamanikā f. Name of a woman View this entry on the original dictionary page scan.
devadānīf. a kind of creeper (equals ghoṣakākṛti-) View this entry on the original dictionary page scan.
devadantinm. Name of śiva- (?) View this entry on the original dictionary page scan.
devadarśam. Name of a teacher of View this entry on the original dictionary page scan.
devadarśanamfn. seeing the gods, familiar with them View this entry on the original dictionary page scan.
devadarśanam. Name of nārada-, View this entry on the original dictionary page scan.
devadarśanam. of a Brahman View this entry on the original dictionary page scan.
devadarśanan. appearance of a god View this entry on the original dictionary page scan.
devadarśanin wrong reading for daiva-d-. View this entry on the original dictionary page scan.
devadarśīf. of a school of , View this entry on the original dictionary page scan.
devadarśinmfn. equals śana- View this entry on the original dictionary page scan.
devadarśinm. Name of a school of View this entry on the original dictionary page scan.
devadārumn. Pinus devadāru- or Deodar (also Avaria Longifolia and Erythrosylon Sideroxyloides) etc. View this entry on the original dictionary page scan.
devadārumayamf(ī-)n. made of its wood View this entry on the original dictionary page scan.
devadāruvanamāhātmyan. Name of work View this entry on the original dictionary page scan.
devadāsam. a servant of a monastery () View this entry on the original dictionary page scan.
devadāsam. Name of a merchant's son View this entry on the original dictionary page scan.
devadāsam. of the brother of śārṅgadhara-'s mother (also sa-deva-) View this entry on the original dictionary page scan.
devadāsam. of the son of a kālidāsa- View this entry on the original dictionary page scan.
devadāsam. of several authors View this entry on the original dictionary page scan.
devadāsīf. a temple Nach-girl View this entry on the original dictionary page scan.
devadāsīf. the wild citron tree View this entry on the original dictionary page scan.
devadattamfn. god-given etc. View this entry on the original dictionary page scan.
devadattam. Name of arjuna-'s conch-shell View this entry on the original dictionary page scan.
devadattam. of one of the vital airs (which is exhaled in yawning) View this entry on the original dictionary page scan.
devadattam. Name of a cousin (or younger brother) and opponent of gautama- buddha- View this entry on the original dictionary page scan.
devadattam. of a son of uru-śravas- and father of agni-veśya- View this entry on the original dictionary page scan.
devadattam. of a son of the Brahman govinda-datta- View this entry on the original dictionary page scan.
devadattam. of a son of hari-datta- View this entry on the original dictionary page scan.
devadattam. of a son of king jayadatta- View this entry on the original dictionary page scan.
devadattam. of several authors View this entry on the original dictionary page scan.
devadattam. of a nāga- View this entry on the original dictionary page scan.
devadattam. of a grāma- of the bāhīka-s View this entry on the original dictionary page scan.
devadattam. a common N. for men used in gr., philosophy etc. View this entry on the original dictionary page scan.
devadattāf. Name of the mother of deva-datta- who was the cousin of gautama- buddha- (See above) View this entry on the original dictionary page scan.
devadattaf. Name of a courtezan View this entry on the original dictionary page scan.
devadattakam. plural the party led by deva-datta- View this entry on the original dictionary page scan.
devadattamayamf(ī-)n. consisting of deva-datta- Va1rtt. 16 View this entry on the original dictionary page scan.
devadattikāf. diminutive for -datta-, Va1rtt. 4
devadatttacaramfn. formerly in the possession of deva-datta- View this entry on the original dictionary page scan.
devadatttāgrajam. "the elder brother of deva-datta-", Name of gautama- buddha- (see above) View this entry on the original dictionary page scan.
devadatttarūpyamfn. equals -cara-, View this entry on the original dictionary page scan.
devadatttaśatham. Name of a preceptor gaRa śaunakādi- in View this entry on the original dictionary page scan.
devadatttīyam. plural the pupils of deva-datta- Va1rtt. 5 View this entry on the original dictionary page scan.
devadevam. "the god of gods", Name of brahmā- View this entry on the original dictionary page scan.
devadevam. of rudra-- śiva-, 7324 View this entry on the original dictionary page scan.
devadevam. of viṣṇu-kṛṣṇa- View this entry on the original dictionary page scan.
devadevam. of gaṇeśa- View this entry on the original dictionary page scan.
devadevam. dual number brahmā- and śiva- View this entry on the original dictionary page scan.
devadevam. plural the Brahmans View this entry on the original dictionary page scan.
devadeveśam. "lord of the chiefs of the gods", Name of śiva- ; of indra-, View this entry on the original dictionary page scan.
devadeveśam. of viṣṇu-, View this entry on the original dictionary page scan.
devadef. Name of durgā- i View this entry on the original dictionary page scan.
devadhāmann. equals -gṛha- View this entry on the original dictionary page scan.
devadhānīf. "divine abode", Name of indra-'s city on the mānasottara- (east of meru-) View this entry on the original dictionary page scan.
devadhānyan. "god's grain", Andropogon Saccharatus, Andopogon Saccharatus, Holcus Saccharatus or Saccharatus Cernuum View this entry on the original dictionary page scan.
devadharam. (bhāgavatācārya-) Name of Scholiast or Commentator on View this entry on the original dictionary page scan.
devadharmam. religious duty or office View this entry on the original dictionary page scan.
devadharmanm. Name of a king View this entry on the original dictionary page scan.
devādhidevam. "god over gods"an arhat- View this entry on the original dictionary page scan.
devādhipam. "king of the gods", Name of indra- View this entry on the original dictionary page scan.
devādhipam. of a king identified with the asura- nikumbha-, View this entry on the original dictionary page scan.
devādhipatim. "id.", Name of śiva- View this entry on the original dictionary page scan.
devadhiṣṇyan. seat (i .e. chariot) of a god View this entry on the original dictionary page scan.
devadhiṣṇyan. bdellium View this entry on the original dictionary page scan.
devadhūpam. "divine incense", the resin of Shorea Robusta View this entry on the original dictionary page scan.
devadiṇṇam. corrupt form for -datta- View this entry on the original dictionary page scan.
devadinnam. idem or 'm. corrupt form for -datta- ' , Name of a son of devadatta- View this entry on the original dictionary page scan.
devadīpam. "divine lamp", the eye View this entry on the original dictionary page scan.
devadroṇīf. an idol procession (originally ablution; see droṇī-) View this entry on the original dictionary page scan.
devadroṇīf. Phlomis Ceylanica View this entry on the original dictionary page scan.
devadryacmf(/īcī-) turned towards the gods View this entry on the original dictionary page scan.
devadundubhim. "divine drum", holy basil with red flowers View this entry on the original dictionary page scan.
devadundubhim. Name of indra- View this entry on the original dictionary page scan.
devadurgamfn. inaccessible to the gods View this entry on the original dictionary page scan.
devadūtam. divine messenger etc. (also taka- ) View this entry on the original dictionary page scan.
devadutīf. female messenger of the gods View this entry on the original dictionary page scan.
devadutīf. the wild citron tree View this entry on the original dictionary page scan.
devadūti wrong reading for -hūti-. View this entry on the original dictionary page scan.
devadyumnam. "glory of the gods", Name of a prince (son of devatā-jit- and father of parame-ṣṭhin-) View this entry on the original dictionary page scan.
devagamamfn. going to the gods, View this entry on the original dictionary page scan.
devāgamālaṃkṛtif. Name of work View this entry on the original dictionary page scan.
devāgamastotran. Name of work View this entry on the original dictionary page scan.
devagaṇam. a troop or class of gods etc. View this entry on the original dictionary page scan.
devagaṇadevam. Name of a poet View this entry on the original dictionary page scan.
devagandhāf. "having divine fragrance", a kind of medicine plant (equals mahāmodā-) View this entry on the original dictionary page scan.
devagāndhāran. or m. a particular mode of singing (see -gandharva-) View this entry on the original dictionary page scan.
devagāndhārīf. (in music) Name of a rāgiṇī-.
devagandharvam. plural gods and gandharva-s View this entry on the original dictionary page scan.
devagandharvam. the divine gandharva-s (opp. to manuṣya--), Taitt. (nārada- so called ) View this entry on the original dictionary page scan.
devagandharvan. a mode of singing, 8449, (see -gāndhāra-). View this entry on the original dictionary page scan.
devagaṇeśvaram. "lord of the troop of gods", Name of indra- View this entry on the original dictionary page scan.
devagaṇikāf. "divine courtezan", apsaras- View this entry on the original dictionary page scan.
devāgāran. "house of the gods", temple View this entry on the original dictionary page scan.
devagarbham. divine child View this entry on the original dictionary page scan.
devagarbhāf. Name of a river in kuśa-dvīpa- View this entry on the original dictionary page scan.
devagarjanan. "celestial roaring", thunder View this entry on the original dictionary page scan.
devagavam. plural the bulls of the gods. View this entry on the original dictionary page scan.
devagavīf. plural the cows of the gods View this entry on the original dictionary page scan.
devagavīf. Name of particular verses or formulas View this entry on the original dictionary page scan.
devagāyanam. "celestial songster", a gandharva- View this entry on the original dictionary page scan.
devaghoṣam. Name of a man View this entry on the original dictionary page scan.
devagirim. "divine hill", Name of a mountain (see -pūrva-) View this entry on the original dictionary page scan.
devagirim. Name of Daulat-abad (situated between mountains) View this entry on the original dictionary page scan.
devagirīf. (in music) Name of a rāgiṇī- (see -kirī-). View this entry on the original dictionary page scan.
devagopāmfn. (v/a-.) having the gods for guardians View this entry on the original dictionary page scan.
devagopāf. divine protectress View this entry on the original dictionary page scan.
devagraham. "divine seizer", a class of demons who cause harmless madness View this entry on the original dictionary page scan.
devagrantham. Name of work View this entry on the original dictionary page scan.
devagranthim. a divine knot or tie View this entry on the original dictionary page scan.
devagṛhan. house of the gods View this entry on the original dictionary page scan.
devagṛhan. temple, chapel etc. View this entry on the original dictionary page scan.
devagṛhan. palace of a king View this entry on the original dictionary page scan.
devaguhīf. Name of a place View this entry on the original dictionary page scan.
devaguhyan. a secret known only to the gods (see -rahasya-). View this entry on the original dictionary page scan.
devaguptamfn. "god-guarded" View this entry on the original dictionary page scan.
devaguptam. Name of a man View this entry on the original dictionary page scan.
devagurum. the father or preceptor of the gods, id est kaśyapa- ( ) or bṛhaspati- () View this entry on the original dictionary page scan.
devagurum. god and preceptor (at the beg. of compound) View this entry on the original dictionary page scan.
devāhāram. "divine food", ambrosia View this entry on the original dictionary page scan.
devahavisn. oblation to the gods View this entry on the original dictionary page scan.
devahavyan. idem or 'n. oblation to the gods ' View this entry on the original dictionary page scan.
devahavyam. Name of a ṛṣi- View this entry on the original dictionary page scan.
devaheḍana n. offence against the gods View this entry on the original dictionary page scan.
devaheḍanan. Name of View this entry on the original dictionary page scan.
devaheḷanan. offence against the gods View this entry on the original dictionary page scan.
devaheḷanan. Name of View this entry on the original dictionary page scan.
devahetif. divine weapon View this entry on the original dictionary page scan.
devahiṃsakam. enemy of the gods View this entry on the original dictionary page scan.
devahitamfn. (v/a--) arranged or appointed or settled by the gods View this entry on the original dictionary page scan.
devahitam. the good or welfare of the gods View this entry on the original dictionary page scan.
devahitārthāyaind. for the sake of the gods View this entry on the original dictionary page scan.
devahiti(v/a--) f. divine ordinance or arrangement View this entry on the original dictionary page scan.
devahotram. Name of the father of yogeśvara- (a partial incarnation [ aṃśa-] of hari-) View this entry on the original dictionary page scan.
devahradam. "the divine lake", Name of a sacred bathing-place View this entry on the original dictionary page scan.
devahūmfn. invoking the gods (superl. -tama-) View this entry on the original dictionary page scan.
devahūm. Name of a man gaRa gargādi- View this entry on the original dictionary page scan.
devahūf. (scilicet dvār-) Name of the northern aperture of the human body, id est of the left ear (which is turned north wards if the face is directed towards the east) (see pitṛ--). View this entry on the original dictionary page scan.
devahūtif. (v/a--) invocation of the gods etc. (also - ) View this entry on the original dictionary page scan.
devahūtif. Name of a daughter of manu- svayam-bhū- and wife of kardama- (-, ) . View this entry on the original dictionary page scan.
devahūyan. invocation of the gods View this entry on the original dictionary page scan.
devāhvayam. "called deva-", Name of a prince View this entry on the original dictionary page scan.
devainasan. the curse of the gods View this entry on the original dictionary page scan.
devainasa according to to some,"sin committed by the gods". View this entry on the original dictionary page scan.
devajamfn. god-born, divine (as a sāman-) View this entry on the original dictionary page scan.
devajam. Name of a prince (son of saṃyama-) View this entry on the original dictionary page scan.
devajāmfn. "god-born" View this entry on the original dictionary page scan.
devajagdha n. "god-eaten", a kind of fragrant grass (equals kattṛṇa-) View this entry on the original dictionary page scan.
devajagdhakan. "god-eaten", a kind of fragrant grass (equals kattṛṇa-) View this entry on the original dictionary page scan.
devajāmimfn. (v/a--) peculiar to the gods View this entry on the original dictionary page scan.
devajāmif. (jāmi-) a sister of the gods View this entry on the original dictionary page scan.
devajanam. (generally plural) a troop or collection of gods or demons or serpents etc. etc. (see daiva--, itara--) View this entry on the original dictionary page scan.
devajana Name (also title or epithet) of a guhyaka-, View this entry on the original dictionary page scan.
devajananīf. the mother of the gods View this entry on the original dictionary page scan.
devajanavidmfn. knowing gods etc. View this entry on the original dictionary page scan.
devajanavidyāf. knowledge of serpents etc. View this entry on the original dictionary page scan.
devajapam. Name of a vidyā-dhara- View this entry on the original dictionary page scan.
devajātamfn. (v/a--) idem or 'mfn. "god-born" ' View this entry on the original dictionary page scan.
devajātan. (jāt/a-) a class or race of gods View this entry on the original dictionary page scan.
devajayam. Name of a poet View this entry on the original dictionary page scan.
devājīva m. a man subsisting by attending on an idol and receiving its offerings View this entry on the original dictionary page scan.
devājīvinm. a man subsisting by attending on an idol and receiving its offerings View this entry on the original dictionary page scan.
devajuṣṭa(v/a--) mfn. agreeable to the gods View this entry on the original dictionary page scan.
devajūta(v/a--) mfn. "god-sped", incited or inspired or procured by the gods View this entry on the original dictionary page scan.
devajūti(de-!) m. Name of an āditya- View this entry on the original dictionary page scan.
devakamf(ikā-)n. who or what sports or plays View this entry on the original dictionary page scan.
devakamf(ikā-)n. divine, celestial idem or 'mf(ikā-)n. who or what sports or plays ' View this entry on the original dictionary page scan.
devakam. (div-) a god, deity (at the end of an adjective (cf. mfn.) compound) (see daivaka-) View this entry on the original dictionary page scan.
devakam. Name of a man (?) View this entry on the original dictionary page scan.
devakam. of a gandharva- (at once a prince, son of āhuka- and father of devakī- [below] )
devakam. of a son of yudhi-ṣṭhira- and yaudheyī- or pauravī- (see vikā-below) View this entry on the original dictionary page scan.
devakam. familiar N. for deva-dattaka- View this entry on the original dictionary page scan.
devakam. plural Name of the śūdra-s in krauñca-dvīpa- View this entry on the original dictionary page scan.
devakāf. fam. for deva-dattikā- Va1rtt. 4 View this entry on the original dictionary page scan.
devakabhojaputrīf. patron. of devakī- View this entry on the original dictionary page scan.
devakaḍam. (for kṛta-?) Name of a grāma- (see devī-kṛti-). View this entry on the original dictionary page scan.
devakalaśam. Name of a man View this entry on the original dictionary page scan.
devakalpamfn. god-like View this entry on the original dictionary page scan.
devakāma(v/a-k-) mfn. loving the gods, pious View this entry on the original dictionary page scan.
devakamalapuran. Name of a town View this entry on the original dictionary page scan.
devakāñcanam. "divine gold", the tree Bauhinea Purpurea View this entry on the original dictionary page scan.
devakāntam. "god-loved"(?), magnet (see candra--, sūrya--). View this entry on the original dictionary page scan.
devakanyāf. idem or 'f. a celestial maiden, a nymph ' View this entry on the original dictionary page scan.
devakanyakāf. a celestial maiden, a nymph View this entry on the original dictionary page scan.
devakardamam. "divine paste", a fragrant paste of sandal, agallochum, camphor, and safflower View this entry on the original dictionary page scan.
devakarmam. master of divine or sacred work View this entry on the original dictionary page scan.
devakarmakṛtmfn. performing it View this entry on the original dictionary page scan.
devakarmann. religious act or rite, worship of the gods View this entry on the original dictionary page scan.
devakāryan. equals -karman- View this entry on the original dictionary page scan.
devakāryan. any matter concerning the gods, divine command View this entry on the original dictionary page scan.
devakāṣṭhan. "divine wood", Pinus devadāru- or some other kind of pine View this entry on the original dictionary page scan.
devakātmajāf. idem or 'f. patron. of devakī- ' View this entry on the original dictionary page scan.
devakavacan. divine armour (see devī--). View this entry on the original dictionary page scan.
devakhātamfn. "dug by the gods", hollow by nature View this entry on the original dictionary page scan.
devakhātan. (m. Scholiast or Commentator) a natural pond or reservoir View this entry on the original dictionary page scan.
devakhātan. a cave or cavern ( devakhātaka -ka- n. idem or 'n. (m. Scholiast or Commentator) a natural pond or reservoir ' ) View this entry on the original dictionary page scan.
devakhātabilan. cavern, chasm View this entry on the original dictionary page scan.
devakhātakan. devakhāta
devakhātatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
devakīf. See below. View this entry on the original dictionary page scan.
devakīf. Name of a daughter of devaka- (See above) who was wife of vasu-deva- and mother of kṛṣṇa- (identified with a-diti- ;with dākṣāyaṇī- ) View this entry on the original dictionary page scan.
devakilbiṣan. offence against the gods View this entry on the original dictionary page scan.
devakīmātṛm. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīnandana(or kin-) m. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīputram. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakirīf. (in music) Name of a rāgiṇī- regarded as wife of megha-rāga- (see -girī-, deśa-karī-, goṇḍa-kirī-, rāma-k-). View this entry on the original dictionary page scan.
devakīrtim. Name of an astronomer View this entry on the original dictionary page scan.
devakīsūnum. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīyamfn. (gaRa gahādi-) divine, belonging or relating to a divinity View this entry on the original dictionary page scan.
devakośam. divine cask or receptacle View this entry on the original dictionary page scan.
devakrīf. (in music) Name of a rāga- (see -kirī-). View this entry on the original dictionary page scan.
devākrīḍam. playing-place of the gods. View this entry on the original dictionary page scan.
devakṛta(v/a-k-) mfn. made or done by the gods View this entry on the original dictionary page scan.
devakṛtyan. equals -kārya- View this entry on the original dictionary page scan.
devākṣaramfn. whose syllables are divine beings View this entry on the original dictionary page scan.
devakṣatran. (v/a-k-) domain of the gods (-kṣetra-?) View this entry on the original dictionary page scan.
devakṣatram. Name of a prince (son of deva-rāta-) View this entry on the original dictionary page scan.
devakṣemam. Name of the author of the vijñāna-kāya- View this entry on the original dictionary page scan.
devakṣetran. domain of the gods View this entry on the original dictionary page scan.
devakulan. "deity-house", a temple etc. View this entry on the original dictionary page scan.
devakulāvāsam. plural buildings belonging to a temple View this entry on the original dictionary page scan.
devakulikam. attendant on a temple View this entry on the original dictionary page scan.
devakulikāf. a small temple, chapel View this entry on the original dictionary page scan.
devakulyāf. "river of the gods", personified as a daughter of pūrṇiman- and grand-daughter of marīci- View this entry on the original dictionary page scan.
devakulyāf. Name of the wife of ud-gītha- View this entry on the original dictionary page scan.
devakuṇḍan. a natural spring View this entry on the original dictionary page scan.
devakurum. Name of a people and country (associated with the uttara-k-) View this entry on the original dictionary page scan.
devakurumbāf. Name of a plant (equals mahādroṇa-) View this entry on the original dictionary page scan.
devakusuman. "divine flower", cloves View this entry on the original dictionary page scan.
devakūṭan. "divine peak", Name of a mountain View this entry on the original dictionary page scan.
devakyamfn. idem or 'mfn. (gaRa gahādi-) divine, belonging or relating to a divinity ' View this entry on the original dictionary page scan.
devakyamfn. godlike, corresponding to the number of the gods (said of the metre anuṣṭubh-) (varia lectio tya-). View this entry on the original dictionary page scan.
devalam. an attendant upon an idol (who subsists on the offerings made to it;oftener laka- ) View this entry on the original dictionary page scan.
devalam. a virtuous or pious man View this entry on the original dictionary page scan.
devalam. Name of a descendant of kaśyapa- and one of the authors of View this entry on the original dictionary page scan.
devalam. of asita- or a son of asita- View this entry on the original dictionary page scan.
devalam. of a man mentioned with asita-, View this entry on the original dictionary page scan.
devalam. of an astronomer View this entry on the original dictionary page scan.
devalam. of a legislator (also, -bhaṭṭa-) View this entry on the original dictionary page scan.
devalam. of a son of pratyūṣa- View this entry on the original dictionary page scan.
devalam. of an elder brother of dhaumya- View this entry on the original dictionary page scan.
devalam. of the husband of eka-parṇā- View this entry on the original dictionary page scan.
devalam. of the father of saṃnati- (the wife of brahma-datta-) View this entry on the original dictionary page scan.
devalam. of the grandfather of View this entry on the original dictionary page scan.
devalam. of a son of viśvā-mitra- (plural his descendants) View this entry on the original dictionary page scan.
devalam. of a son of kṛśāśva- by dhiṣaṇā- View this entry on the original dictionary page scan.
devala equals devara- (q.v) View this entry on the original dictionary page scan.
devālāf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
devalakṣman. divine characteristic View this entry on the original dictionary page scan.
devalakṣman. the Brahmanical cord View this entry on the original dictionary page scan.
devalāṅgulikāf. Tragia Involucrata View this entry on the original dictionary page scan.
devalasmṛtif. devala-'s law-book View this entry on the original dictionary page scan.
devalatāf. "divine creeper", double jasmine View this entry on the original dictionary page scan.
devalāti gaRa dāsībhārādi-. View this entry on the original dictionary page scan.
devālayam. "residence of the gods", heaven View this entry on the original dictionary page scan.
devālayam. temple View this entry on the original dictionary page scan.
devālayalakṣaṇan. Name of work View this entry on the original dictionary page scan.
devālayapratiṣṭhāf. Name of work View this entry on the original dictionary page scan.
devālayapratiṣṭhāvidhim. Name of work View this entry on the original dictionary page scan.
devālayotsavādikramam. Name of work View this entry on the original dictionary page scan.
devalekhāf. "having a divine outline", Name of a princess View this entry on the original dictionary page scan.
devaliṅgan. the image or statue of a deity View this entry on the original dictionary page scan.
devalokam. the world or sphere of any divinity View this entry on the original dictionary page scan.
devalokam. heaven or paradise View this entry on the original dictionary page scan.
devalokam. any one of the 3 or 21 () or 7 () superior worlds etc. (for the 6 divine lokas of See ) View this entry on the original dictionary page scan.
devalokapālam. "protector of the world of the gods", Name of indra- View this entry on the original dictionary page scan.
devalokegatamfn. gone to the gods, dead View this entry on the original dictionary page scan.
devamādanamfn. gladdening or inspiring the gods (soma-) View this entry on the original dictionary page scan.
devamadhun. divine honey View this entry on the original dictionary page scan.
devamālāf. "divine garland", Name of an apsaras- View this entry on the original dictionary page scan.
devamalimlucm. "robber of the gods", an asura- View this entry on the original dictionary page scan.
devamānan. dwelling of the gods View this entry on the original dictionary page scan.
devamānakam. equals -mañjara- View this entry on the original dictionary page scan.
devamaṇḍalam. Name of a particular samādhi- View this entry on the original dictionary page scan.
devamaṇim. divine amulet View this entry on the original dictionary page scan.
devamaṇim. equals prec. View this entry on the original dictionary page scan.
devamaṇim. a twist of hair on a horse's neck View this entry on the original dictionary page scan.
devamaṇim. Name of a drug belonging to the aṣṭa-varga- (equals mahāmedā-) View this entry on the original dictionary page scan.
devamaṇim. Name of śiva- View this entry on the original dictionary page scan.
devamañjaran. the jewel on viṣṇu-'s breast (see -kaustubha-). View this entry on the original dictionary page scan.
devamanuṣya() () m. plural gods and men. View this entry on the original dictionary page scan.
devamanuṣya() m. plural gods and men. View this entry on the original dictionary page scan.
devamārgam. "the way of the gods", the air or sky View this entry on the original dictionary page scan.
devamārgam. = anus (see ) . View this entry on the original dictionary page scan.
devamāsam. "the month of the gods", the 8th month of pregnancy View this entry on the original dictionary page scan.
devamatam. "god-approved", Name of a ṛṣi- View this entry on the original dictionary page scan.
devamātam. Name of a man View this entry on the original dictionary page scan.
devamatim. Name of a man View this entry on the original dictionary page scan.
devamatif. of a woman View this entry on the original dictionary page scan.
devamātṛf. plural the mother of the gods View this entry on the original dictionary page scan.
devamātṛf. sg. Name of aditi- or of dākṣāyaṇī- View this entry on the original dictionary page scan.
devamātṛkamfn. "having the god (indra-) or clouds as foster-mother", moistened only by rain-water (as corn, land) (see nadī--). View this entry on the original dictionary page scan.
devamayamf(ī-)n. consisting of or containing the gods View this entry on the original dictionary page scan.
devamāyam. Name of a prince View this entry on the original dictionary page scan.
devamāyāf. divine illusion View this entry on the original dictionary page scan.
devaṃgamamf(-)n. going to the gods View this entry on the original dictionary page scan.
devamīḍham. ( -ka-) "god-begotten (?)", Name of a yādava- and grandfather of vasu-deva- (see next) View this entry on the original dictionary page scan.
devamīḍham. of a descendant of nimi- and janaka- View this entry on the original dictionary page scan.
devamīḍhuṣam. Name of the grandfather of vasu-deva- (see prec.) View this entry on the original dictionary page scan.
devamiśram. Name of an author View this entry on the original dictionary page scan.
devamithunan. cohabitation of the gods View this entry on the original dictionary page scan.
devamitram. "having the gods as friends", Name of an ancient teacher called also śākalya- View this entry on the original dictionary page scan.
devamitram. of the father of viṣṇu-mitra- View this entry on the original dictionary page scan.
devamitrāf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
devāṃśam. a portion id est partial incarnation of a god View this entry on the original dictionary page scan.
devamunim. heavenly or divine muni- View this entry on the original dictionary page scan.
devamunim. Name of a son of iraṃ-mada- and author of View this entry on the original dictionary page scan.
devanm. brother-in-law (equals devṛ-) View this entry on the original dictionary page scan.
devanan. lamentation, wailing, grief, sorrow View this entry on the original dictionary page scan.
devanam. a die, dice for gambling View this entry on the original dictionary page scan.
devanāf. sport, pastime View this entry on the original dictionary page scan.
devanāf. service View this entry on the original dictionary page scan.
devanan. (d/ev-) shining, splendour View this entry on the original dictionary page scan.
devanan. gaming, a game at dice etc. View this entry on the original dictionary page scan.
devanan. play, sport, pastime View this entry on the original dictionary page scan.
devanan. pleasure-ground, garden View this entry on the original dictionary page scan.
devanan. a lotus View this entry on the original dictionary page scan.
devanan. praise View this entry on the original dictionary page scan.
devanan. desire, emulation View this entry on the original dictionary page scan.
devanan. affair, business, profession View this entry on the original dictionary page scan.
devanan. going, motion View this entry on the original dictionary page scan.
devanābham. Name of a man View this entry on the original dictionary page scan.
devanadīf. "divine river", Name of several sacred rivers View this entry on the original dictionary page scan.
devanāgarīf. "divine city writing", Name of the character in which Sanskrit is usually written (prob. from its having originated in some city) View this entry on the original dictionary page scan.
devanakṣatran. Name of the first 14 nakṣatra-s in the southern quarter (pp. to yama--) View this entry on the original dictionary page scan.
devanakṣatram. Name of a king (varia lectio for va-kṣatra-). View this entry on the original dictionary page scan.
devanalam. "god's reed", Arundo Bengalensis (see -nāla-). View this entry on the original dictionary page scan.
devanālam. equals -nala- View this entry on the original dictionary page scan.
devanāmam. plural Name of particular formulas View this entry on the original dictionary page scan.
devanāmanm. Name of a king and a varṣa- in kuśa-dvīpi- View this entry on the original dictionary page scan.
devānāmpriyamfn. "beloved of the gods", simple, foolish Va1rtt. 3 View this entry on the original dictionary page scan.
devanandāf. "gods' joy", Name of a celestial woman View this entry on the original dictionary page scan.
devānandam. "delight of the gods", Name of a man View this entry on the original dictionary page scan.
devānandam. of several authors (also -sūri-) View this entry on the original dictionary page scan.
devānandāf. Name of the 15th night of the karma-māsa- (See sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
devānandāf. Name of a divine female View this entry on the original dictionary page scan.
devanandinm. "rejoicing the gods", Name of one of indra-'s doorkeepers View this entry on the original dictionary page scan.
devanandinm. of a grammarian View this entry on the original dictionary page scan.
devanātham. "lord of the gods", Name of śiva-, View this entry on the original dictionary page scan.
devanātham. of several authors (also -ṭhakkura-, -tarka-pañcānana-,and -pāṭhaka-). View this entry on the original dictionary page scan.
devanāyakam. Name of a man View this entry on the original dictionary page scan.
devanāyakapañcāśatf. Name of work View this entry on the original dictionary page scan.
devanāyakastutif. Name of work View this entry on the original dictionary page scan.
devāndhasn. "divine food", ambrosia View this entry on the original dictionary page scan.
devāṅgam. Name of an emanation from sadā-śiva-'s body (inventor of weaving) View this entry on the original dictionary page scan.
devāṅgacaritran. Name of work View this entry on the original dictionary page scan.
devāṅganāf. a divine female View this entry on the original dictionary page scan.
devanibandham. Name of work View this entry on the original dictionary page scan.
devanidmfn. hating the gods, a god-hater View this entry on the original dictionary page scan.
devānīkan. an army of celestials View this entry on the original dictionary page scan.
devānīkam. Name of a king (son of kṣemadhanvan-) View this entry on the original dictionary page scan.
devānīkam. of a son of the 11th manu- View this entry on the original dictionary page scan.
devānīkam. of a mountain View this entry on the original dictionary page scan.
devanikāyam. host or assembly of gods View this entry on the original dictionary page scan.
devanikāyam. heaven, paradise View this entry on the original dictionary page scan.
devanindāf. heresy, atheism View this entry on the original dictionary page scan.
devanindakamfn. idem or 'mfn. hating the gods, a god-hater ' View this entry on the original dictionary page scan.
devanindakamfn. atheist or atheism View this entry on the original dictionary page scan.
devanirmālyan. a garland remaining from a sacrifice View this entry on the original dictionary page scan.
devanirmitamfn. "god-made", created, natural View this entry on the original dictionary page scan.
devanirmitāf. Cocculus Cordifolius View this entry on the original dictionary page scan.
devaniśrayaṇī f. "ladder towards the gods", Name of a particular penance View this entry on the original dictionary page scan.
devaniśreṇīf. "ladder towards the gods", Name of a particular penance View this entry on the original dictionary page scan.
devanītham. a formula consisting of 17 pāda-s View this entry on the original dictionary page scan.
devāñjanan. divine ointment View this entry on the original dictionary page scan.
devāṅkīpūjāf. Name of work View this entry on the original dictionary page scan.
devānnan. idem or 'n. "divine food", ambrosia ' View this entry on the original dictionary page scan.
devānnan. food offered (first) to the gods View this entry on the original dictionary page scan.
devaṇṇabhaṭṭam. Name of an author View this entry on the original dictionary page scan.
devāntam. Name of a son of hṛdika- View this entry on the original dictionary page scan.
devāntakam. Name of a rakṣas-
devāntakam. of a daitya- View this entry on the original dictionary page scan.
devāntakavadham. "destruction of deva-datta-", Name of 71st chapter of View this entry on the original dictionary page scan.
devānucaram. a follower or attendant of a god View this entry on the original dictionary page scan.
devānukramam. "series or order of the gods."Name of work View this entry on the original dictionary page scan.
devānuyāyinm. idem or 'm. a follower or attendant of a god ' View this entry on the original dictionary page scan.
devapadan. a word containing a god's name View this entry on the original dictionary page scan.
devapadan. equals -pāda- View this entry on the original dictionary page scan.
devapādam. plural "the feet of a god or king", the royal presence or person,"His Majesty" View this entry on the original dictionary page scan.
devapādamūlan. idem or 'm. plural "the feet of a god or king", the royal presence or person,"His Majesty" ' View this entry on the original dictionary page scan.
devapālam. "god-defender", Name of several princes View this entry on the original dictionary page scan.
devapālam. of a mountain View this entry on the original dictionary page scan.
devapālam. of an author (son of hari-pāla-) View this entry on the original dictionary page scan.
devapālitam. "god-protected", Name of a man View this entry on the original dictionary page scan.
devapallīpaṭṭanan. Name of a town View this entry on the original dictionary page scan.
devapānamfn. serving the gods for a beverage View this entry on the original dictionary page scan.
devapañcarātram. Name of a pañcāha- View this entry on the original dictionary page scan.
devapaṇḍitam. Name of an author View this entry on the original dictionary page scan.
devapāṇim. "god-handed", Name of a class of asura-s, View this entry on the original dictionary page scan.
devapāṇi Name (also title or epithet) of the author of a commentator or commentary on , , Scholiast or Commentator View this entry on the original dictionary page scan.
devapariṣadf. an assembly of deities View this entry on the original dictionary page scan.
devaparṇan. "divine leaf", Name of a medicine plant (equals sura--) View this entry on the original dictionary page scan.
devapaśum. any animal consecrated to a deity View this entry on the original dictionary page scan.
devapatham. "god's path", heaven View this entry on the original dictionary page scan.
devapatham. the Milky Way View this entry on the original dictionary page scan.
devapatham. Name of place of pilgrimage (see ) (also devapathatīrtha -tīrtha- n. ) View this entry on the original dictionary page scan.
devapathatīrthan. devapatha
devapathīyamfn. being on the celestial path View this entry on the original dictionary page scan.
devapathīyamfn. relating to or coming from deva-patha- (above) View this entry on the original dictionary page scan.
devapatim. "lord of gods", Name of indra- View this entry on the original dictionary page scan.
devapatim. plural the most excellent of gods
devapatimantrinm. " indra-'s counsellor", Name of bṛhas-pati-, the planet Jupiter View this entry on the original dictionary page scan.
devapatnīf. (v/a-.) having a god as husband, the wife of a god View this entry on the original dictionary page scan.
devapatnīf. sweet potato (equals madhv-āluka-) View this entry on the original dictionary page scan.
devapātran. cup or drink of the gods View this entry on the original dictionary page scan.
devapātrinmfn. partaking of the divine cup View this entry on the original dictionary page scan.
devapattanan. Name of a town View this entry on the original dictionary page scan.
devāpim. "friend of the gods", Name of a ṛṣi- who was son of ṛṣṭi-ṣeṇa- (according to a later legend he is a son of king pratipa-, resigns his kingdom, retires to the woods and is supposed to be still alive ) View this entry on the original dictionary page scan.
devāpiName of indrota- View this entry on the original dictionary page scan.
devapīyumfn. reviling or despising the gods View this entry on the original dictionary page scan.
devaprabham. "having divine splendour", Name of a gandharva- View this entry on the original dictionary page scan.
devaprabhāf. of the daughter of a siddha- View this entry on the original dictionary page scan.
devaprakāśinīf. Name of work View this entry on the original dictionary page scan.
devaprasādam. "having the divine favour", Name of a man View this entry on the original dictionary page scan.
devapraśnam. "consulting the gods", fortune-telling (see daiva--). View this entry on the original dictionary page scan.
devaprastham. Name of the city of senā-bindu- View this entry on the original dictionary page scan.
devaprasūta(v/a--) mfn. god-produced (water) View this entry on the original dictionary page scan.
devapratikṛtif. ( , where wrongly prakṛ-) () image of a deity, idol. View this entry on the original dictionary page scan.
devapratimāf. () image of a deity, idol. View this entry on the original dictionary page scan.
devapratiṣṭhāf. Name of work View this entry on the original dictionary page scan.
devapratiṣṭhāprayogam. Name of work View this entry on the original dictionary page scan.
devapratiṣṭhātattvan. Name of work View this entry on the original dictionary page scan.
devaprayāgam. "divine place of sacrifice", Name of a sacred bathing-place View this entry on the original dictionary page scan.
devapriyamfn. "dear to the gods" View this entry on the original dictionary page scan.
devapriyamfn. stupid, silly (see devānām--) View this entry on the original dictionary page scan.
devapriyam. Name of śiva- View this entry on the original dictionary page scan.
devapriyam. of two plants (equals pīta-bhṛṅgarāja-and bakapuṣpa-) View this entry on the original dictionary page scan.
devapsaras(v/a--) mfn. serving the gods as a feast or enjoyment View this entry on the original dictionary page scan.
devapūjāf. worship of the gods (especially the daily worship in the domestic sanctuary) View this entry on the original dictionary page scan.
devapūjāf. Name of work (also devapūjāvidhi -vidhi- m. ) View this entry on the original dictionary page scan.
devapūjakam. worshipper of the gods View this entry on the original dictionary page scan.
devapūjāvidhim. devapūjā
devapūjitamfn. worshipped by the gods View this entry on the original dictionary page scan.
devapūjyam. "to be honoured by the gods", Name of bṛhas-pati-, i e. the planet Jupiter View this entry on the original dictionary page scan.
devapurf. (Nominal verb -pūr-) equals -purā- View this entry on the original dictionary page scan.
devapurf. equals -pura- n. View this entry on the original dictionary page scan.
devapuran. indra-'s residence View this entry on the original dictionary page scan.
devapurāf. divine fortress View this entry on the original dictionary page scan.
devapurīmāhātmyan. Name of work View this entry on the original dictionary page scan.
devapurohitam. domestic priest of the gods View this entry on the original dictionary page scan.
devapurohitam. Name of bṛhas-pati- id est the planet Jupiter View this entry on the original dictionary page scan.
devapūrvamfn. "preceded by the word deva- ", with giri- equals deva-giri- View this entry on the original dictionary page scan.
devapūrvakamind. beginning with the gods View this entry on the original dictionary page scan.
devapuṣpan. "divine flower", cloves View this entry on the original dictionary page scan.
devaputram. the son of a god (also traka- ) View this entry on the original dictionary page scan.
devaputram. Name of śiva- View this entry on the original dictionary page scan.
devaputramfn. having gods as children (said of heaven and earth) View this entry on the original dictionary page scan.
devaputramāram. Name of one of the four māra-s View this entry on the original dictionary page scan.
devaputrīf. Trigonella Corniculata View this entry on the original dictionary page scan.
devaputrikāf. Trigonella Corniculata View this entry on the original dictionary page scan.
devaram. equals devṛ- etc. View this entry on the original dictionary page scan.
devaram. husband, lover View this entry on the original dictionary page scan.
devārādhanan. View this entry on the original dictionary page scan.
devārādhanāf. worship of the gods View this entry on the original dictionary page scan.
devaraghnīf. killing one's brother-in-law View this entry on the original dictionary page scan.
devarahasyan. divine mystery (see -guhya-) View this entry on the original dictionary page scan.
devarājm. "king of the gods", Name of indra- View this entry on the original dictionary page scan.
devarājm. of nahuṣa- View this entry on the original dictionary page scan.
devarājam. divine ruler View this entry on the original dictionary page scan.
devarājam. king of the gods, Name of indra- etc. View this entry on the original dictionary page scan.
devarājam. Name of a king View this entry on the original dictionary page scan.
devarājam. of a ṛṣi- View this entry on the original dictionary page scan.
devarājam. of a buddha- View this entry on the original dictionary page scan.
devarājam. the father of śārṅgadhara-, and several authors View this entry on the original dictionary page scan.
devarājamahiṣīstotran. Name of work View this entry on the original dictionary page scan.
devarājanm. a prince of a Brahmanical family View this entry on the original dictionary page scan.
devarājaprabandham. Name of work View this entry on the original dictionary page scan.
devarājasamadyutimfn. equal in glory to the king of the gods View this entry on the original dictionary page scan.
devarājayajvanm. Name of a Scholiast or Commentator on naighaṇṭuka- and also of his grandfather View this entry on the original dictionary page scan.
devarājyan. sovereignty over the gods View this entry on the original dictionary page scan.
devarakṣitam. "god-protected", Name of a son of devaka-
devarakṣitam. of a prince of the kosala-s View this entry on the original dictionary page scan.
devarakṣitam. of a Brahman View this entry on the original dictionary page scan.
devarakṣitāf. of a daughter of devaka- and one of the wives of vasu-deva- View this entry on the original dictionary page scan.
devaraktadaṃśīf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
devarāma(-bhaṭṭa-) m. Name of several authors View this entry on the original dictionary page scan.
devāraṇyan. divine grove View this entry on the original dictionary page scan.
devarāṣṭran. "the empire of the gods", Name of an empire in the Deccan. View this entry on the original dictionary page scan.
devaratamfn. delighting in the gods, pious View this entry on the original dictionary page scan.
devarātam. "god-given", Name of śunaḥ-śepa- after being received into the family of viśvā-mitra- etc. (plural his descendants ) View this entry on the original dictionary page scan.
devarātam. Name of a king who was the son of su-ketu- and descendant of nimi- View this entry on the original dictionary page scan.
devarātam. of a king who was son of karambhi- View this entry on the original dictionary page scan.
devarātam. of another king View this entry on the original dictionary page scan.
devarātam. of parikṣit- View this entry on the original dictionary page scan.
devarātam. of the father of yājñavalkya- (see daiva-rāti-) View this entry on the original dictionary page scan.
devarātam. a sort of crane View this entry on the original dictionary page scan.
devaratham. the car or vehicle of a god View this entry on the original dictionary page scan.
devaratham. a car for carrying the images of the gods in a procession (see daiva--) View this entry on the original dictionary page scan.
devaratham. Name of a man View this entry on the original dictionary page scan.
devarathāhnyan. a day's journey for the sun's chariot View this entry on the original dictionary page scan.
devaratif. "gods' delight", Name of an apsaras- View this entry on the original dictionary page scan.
devaravatīf. having a brother-in-law
devarāyam. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
devārcakam. worshipper of the gods View this entry on the original dictionary page scan.
devārcanan. worship of gods, idolatry, (also devārcanā - f. ) View this entry on the original dictionary page scan.
devārcanāf. devārcana
devārcanakramapaddhatif. Name of work View this entry on the original dictionary page scan.
devaretasamfn. sprung from divine seed View this entry on the original dictionary page scan.
devārhamfn. worthy of the gods, divine View this entry on the original dictionary page scan.
devārham. a kind of medicine plant View this entry on the original dictionary page scan.
devārham. Name of a prince View this entry on the original dictionary page scan.
devārhāf. Sida Rhomboidea View this entry on the original dictionary page scan.
devārhaṇam. Name of a prince View this entry on the original dictionary page scan.
devārim. "foe of the gods", an asura- View this entry on the original dictionary page scan.
devāribalasūdanam. "destroyer of the army of the asura-", Name of viṣṇu- View this entry on the original dictionary page scan.
devāripam. "protector of the asura-"(?), the sea on View this entry on the original dictionary page scan.
devārpaṇan. an offering to the gods (see mad-arp-). View this entry on the original dictionary page scan.
devaṛṣabham. "a bull among the gods", Name of a son of dharma- and bhānu- View this entry on the original dictionary page scan.
devaṛṣim. "a ṛṣi- among the gods", Name of nārada-, 16, 1 (see varṣi-). View this entry on the original dictionary page scan.
devarṣim. (deva-+ ṛṣi-) a ṛṣi-, a saint of the celestial class, as nārada-, atri- etc. ( sapta saptarṣayaḥ-for sapta devarṣ-) etc. (see brahmarṣi-and rājarṣi-) View this entry on the original dictionary page scan.
devarṣim. Name of śiva- View this entry on the original dictionary page scan.
devarṣicaritan. the deeds of divine sages View this entry on the original dictionary page scan.
devarṣipitṛvallabham. sesamum View this entry on the original dictionary page scan.
devarṣitvan. state or rank of a divine sages View this entry on the original dictionary page scan.
devarṣivaryam. chief of sages View this entry on the original dictionary page scan.
devarūpāf. "of divine form", Name of an apsaras- View this entry on the original dictionary page scan.
devarūpinmfn. having a divine form, god-like View this entry on the original dictionary page scan.
devāryam. Name of the last arhat- of the present ava-sarpiṇī- View this entry on the original dictionary page scan.
devaśābaratantran. Name of work View this entry on the original dictionary page scan.
devaśabdam. the Name of a god View this entry on the original dictionary page scan.
devaśabdam. divine sound id est thunder View this entry on the original dictionary page scan.
devasabhan. Name of a town View this entry on the original dictionary page scan.
devasabhāf. a hall serving as a meeting-place for the gods View this entry on the original dictionary page scan.
devasabhāf. a gambling-house View this entry on the original dictionary page scan.
devasabhyam. keeper of a gambling-house View this entry on the original dictionary page scan.
devasabhyam. a gambler View this entry on the original dictionary page scan.
devasabhyam. frequenter of clubs or assemblies View this entry on the original dictionary page scan.
devasabhyam. deity's attendant View this entry on the original dictionary page scan.
devasadmfn. living among the gods View this entry on the original dictionary page scan.
devasadanamfn. serving as a seat for the gods View this entry on the original dictionary page scan.
devasadmann. a god's seat View this entry on the original dictionary page scan.
devasāgaragaṇim. Name of an author (1630) View this entry on the original dictionary page scan.
devasaham. Name of a mountain View this entry on the original dictionary page scan.
devasahāf. Name of plants (equals saha-devī-or (?) bhikṣā-sūtra-) View this entry on the original dictionary page scan.
devasakham. friend or companion of the gods View this entry on the original dictionary page scan.
devasakhim. "id.", Name of a mountain (Bombay edition) iv, 43, 17. View this entry on the original dictionary page scan.
devasākṣyan. testimony of the gods View this entry on the original dictionary page scan.
devasākṣyan. locative case before the gods as witnesses View this entry on the original dictionary page scan.
devaśaktim. "having divine strength", Name of a king View this entry on the original dictionary page scan.
devasaṃdhamfn. connected with the gods, divine View this entry on the original dictionary page scan.
devasaṃgītayoninm. (?) Name of nārada- View this entry on the original dictionary page scan.
devasaṃhitāf. the saṃhitā- of the gods View this entry on the original dictionary page scan.
devasaṃnidhim. presence of the gods View this entry on the original dictionary page scan.
devasaṃsadf. assembly of the gods View this entry on the original dictionary page scan.
devasaṃyuktamfn. connected with the gods, View this entry on the original dictionary page scan.
devasarasan. "pool of the gods", Name of a place View this entry on the original dictionary page scan.
devaśarmanm. "having the gods as refuge", Name of an old sage View this entry on the original dictionary page scan.
devaśarmanm. of an arhat- (author of the vijñāna-kāya-śāstra-) View this entry on the original dictionary page scan.
devaśarmanm. of a minister of jayāpīḍa- (king of kaśmīra-) View this entry on the original dictionary page scan.
devasarṣapam. "divine mustard", a kind of mustard View this entry on the original dictionary page scan.
devaśasind. deity after deity View this entry on the original dictionary page scan.
devaśatabhāṣyan. Name of work View this entry on the original dictionary page scan.
devasātkṛto offer to the gods View this entry on the original dictionary page scan.
devaśatrum. foe of the gods, an asura- or rakṣas- View this entry on the original dictionary page scan.
devaśatrumfn. having the gods as foes View this entry on the original dictionary page scan.
devasattran. a long festival in honour of the gods View this entry on the original dictionary page scan.
devasattvamfn. having the nature of a god View this entry on the original dictionary page scan.
devasatyan. divine truth, established order of the gods View this entry on the original dictionary page scan.
devasavam. a kind of sacrifice View this entry on the original dictionary page scan.
devasāvarṇim. Name of the 13th manu- View this entry on the original dictionary page scan.
devasāyujyan. union with or reception among the gods, deification View this entry on the original dictionary page scan.
devaśekharam. "divine diadem", Artemisia Indica View this entry on the original dictionary page scan.
devasenam. Name of a king of śrāvastī- View this entry on the original dictionary page scan.
devasenam. of a king of pauṇḍra-vardhana- View this entry on the original dictionary page scan.
devasenam. of a cowherd View this entry on the original dictionary page scan.
devasenam. of a arhat- View this entry on the original dictionary page scan.
devasef. a host of celestials etc. (plural the hosts of deva- or īśāna- ; devasenāpati -pati-[ ] m. and devasenāpriya -priya-[ ] m.Name of skanda-) View this entry on the original dictionary page scan.
devasenam. Name of a daughter of prajā-pati- or niece (daughter ) of indra- and wife of skanda- View this entry on the original dictionary page scan.
devasenam. a particle of mūla-prakṛti- View this entry on the original dictionary page scan.
devasenam. Name of commentator or commentary on View this entry on the original dictionary page scan.
devasenāpatim. devasenā
devasenāpriyam. devasenā
devaśeṣan. the remnants of a god's sacrifice View this entry on the original dictionary page scan.
devasiddhim. Name of a man View this entry on the original dictionary page scan.
devaśilpan. work of divine art View this entry on the original dictionary page scan.
devaśilpinm. "the artist of the gods", Name of tvaṣṭṛ- View this entry on the original dictionary page scan.
devasiṃham. "god-lion", Name of śiva- View this entry on the original dictionary page scan.
devasiṃham. of an author View this entry on the original dictionary page scan.
devaśiṣṭa(v/a--) mfn. taught or directed by the gods View this entry on the original dictionary page scan.
devaśiśum. equals -garbha- View this entry on the original dictionary page scan.
devasmitāf. "having a divine smile", Name of the daughter of a merchant View this entry on the original dictionary page scan.
devasomam. Name of a man View this entry on the original dictionary page scan.
devasomakam. Name of a man View this entry on the original dictionary page scan.
devaśravasm. (v/a--) "having divine renown", Name of a bhārata- View this entry on the original dictionary page scan.
devaśravasm. of a son of yama- and author of View this entry on the original dictionary page scan.
devaśravasm. of a son of viśvā-mitra- View this entry on the original dictionary page scan.
devaśravasm. of a son of śūra- and brother of vasu-deva- View this entry on the original dictionary page scan.
devaśreṇīf. Sanseviera Zeylanica View this entry on the original dictionary page scan.
devaśreṣṭham. "best of the gods", Name of a son of the 12th manu- View this entry on the original dictionary page scan.
devaśrīmfn. approaching the gods, worshipping View this entry on the original dictionary page scan.
devaśrīm. Name of a ṛṣi- View this entry on the original dictionary page scan.
devaśrīgarbham. Name of a bodhi-sattva- View this entry on the original dictionary page scan.
devasṛṣṭamfn. (v/a--) discharged or caused or created by a god View this entry on the original dictionary page scan.
devasṛṣṭāf. a kind of intoxicating drink View this entry on the original dictionary page scan.
devaśrūmfn. known to the gods View this entry on the original dictionary page scan.
devaśrūm. barber of the gods View this entry on the original dictionary page scan.
devaśrutmfn. audible to or heard by the gods View this entry on the original dictionary page scan.
devaśrutam. "having divine knowledge", = lord, god(īśvara-) View this entry on the original dictionary page scan.
devaśrutam. Name of nārada- View this entry on the original dictionary page scan.
devaśrutam. (with jaina-s) , Name of 6th arhat- of future ut-sarpiṇī- View this entry on the original dictionary page scan.
devaśrutan. a sacred treatise or manual View this entry on the original dictionary page scan.
devastavam. Name of a prince View this entry on the original dictionary page scan.
devasthalim. Name of an author View this entry on the original dictionary page scan.
devasthānam. Name of an ancient ṛṣi- View this entry on the original dictionary page scan.
devasthānan. of 2 sāman-s (varuṇasya-and bṛhad-deva--) View this entry on the original dictionary page scan.
devastrīf. the wife of a deity View this entry on the original dictionary page scan.
devastutmfn. praising the gods View this entry on the original dictionary page scan.
devasūm. (with or scilicet deva-) Name of 8 deities (viz. agni- gṛha-pati-, soma- vanas-pati-, savitṛ- satya-prasava-, rudra- paśu-pati-, bṛhas-pati- vācas-pati-, indra- jyeṣṭha-, mitra- satya-, and varuṇa- dharma-pati-) View this entry on the original dictionary page scan.
devasūdam. Name of a village View this entry on the original dictionary page scan.
devasūkakṣetran. Name of a region of the northern pañcāla-s
devasumanasn. "divine flower", a species of flower View this entry on the original dictionary page scan.
devasumatif. favour of the gods View this entry on the original dictionary page scan.
devasundam. Name of a lake View this entry on the original dictionary page scan.
devaśunīf. "divine dog", Name of saramā- View this entry on the original dictionary page scan.
devaśūram. "divine hero", Name of a man View this entry on the original dictionary page scan.
devāsuram. plural the gods and the asura-s etc. View this entry on the original dictionary page scan.
devāsuramfn. (with yuddha-, raṇa-etc. the war) of she gods and asura-s View this entry on the original dictionary page scan.
devāsuragaṇāgraṇīm. Name of śiva- View this entry on the original dictionary page scan.
devāsuragaṇāṇādhyakṣam. Name of śiva- View this entry on the original dictionary page scan.
devāsuragaṇāṇāśrayam. Name of śiva- View this entry on the original dictionary page scan.
devāsuragurum. Name of śiva- View this entry on the original dictionary page scan.
devāsuramahāmātram. Name of śiva- View this entry on the original dictionary page scan.
devāsuramahāśrayam. Name of śiva- View this entry on the original dictionary page scan.
devāsuramaheśvaram. Name of śiva- View this entry on the original dictionary page scan.
devāsuranamaskṛtam. Name of śiva- View this entry on the original dictionary page scan.
devāsurapatim. Name of śiva- View this entry on the original dictionary page scan.
devāsuravarapradam. Name of śiva- View this entry on the original dictionary page scan.
devāsuravinirmātṛm. Name of śiva- View this entry on the original dictionary page scan.
devāsureśvaram. Name of śiva- View this entry on the original dictionary page scan.
devasūrim. Name of a man View this entry on the original dictionary page scan.
devasuṣim. a divine tube or vital air (5 in number, viz. prāṇa-, vy-āna-, apāna-, sam-āna-, ud-āna-) View this entry on the original dictionary page scan.
devasvan. divine property View this entry on the original dictionary page scan.
devāśvam. divine horse View this entry on the original dictionary page scan.
devāśvam. indra-'s horse uccaiḥ-śravas- View this entry on the original dictionary page scan.
devasvāminm. "lord of the gods", Name of several Brahmans View this entry on the original dictionary page scan.
devasvāminm. of an astronomer View this entry on the original dictionary page scan.
devasvāminm. of a Scholiast or Commentator on etc. View this entry on the original dictionary page scan.
devasvapaharaṇan. plunder of divine property, sacrilege View this entry on the original dictionary page scan.
devasyatvakamfn. containing the words devasyatvā- (as an adhyāya- or anuvāka-) gaRa goṣad-ādi-. View this entry on the original dictionary page scan.
devatāSee dev/atā-. View this entry on the original dictionary page scan.
devāṭam. Name of a sacred bathing. place (see patny-āṭa-). View this entry on the original dictionary page scan.
devatāf. godhead, divinity (abstr. & concr.) etc. View this entry on the original dictionary page scan.
devatāf. image of a deity, idol (in fine compositi or 'at the end of a compound' -ka- ) View this entry on the original dictionary page scan.
devatāf. Name of the organs of sense (see deva-) View this entry on the original dictionary page scan.
devatāind. with divinity id est with a god (gods) or among the gods View this entry on the original dictionary page scan.
devaṭam. ( dev-? ) artist, artisan. View this entry on the original dictionary page scan.
devatābādha(or b-). m. molestation of the gods View this entry on the original dictionary page scan.
devatābhyarcanan. (bh-) worship of an idol or a deity View this entry on the original dictionary page scan.
devatābhyarcanaparamfn. devoted to it View this entry on the original dictionary page scan.
devatāḍam. Lipeocercis Serrata (also devatāḍaka ḍaka- m.or devatāḍī ḍī-. f.) View this entry on the original dictionary page scan.
devatāḍam. Luffa Foetida or a similar plant View this entry on the original dictionary page scan.
devatāḍam. fire View this entry on the original dictionary page scan.
devatāḍam. Name of rāhu- View this entry on the original dictionary page scan.
devatāḍakam. devatāḍa
devatādarśanan. manifestation of a deity View this entry on the original dictionary page scan.
devatādhipa(dh-) m. "deity-chief", Name of indra- View this entry on the original dictionary page scan.
devatādhyāya(t/adh-) n. (scilicet brāhmaṇa-) Name of a of the View this entry on the original dictionary page scan.
devatāḍīf. devatāḍa
devatādvaṃdvan. a compound whose members are two or more names of deities View this entry on the original dictionary page scan.
devatāgāra(g-) n. "gods' house", temple, chapel View this entry on the original dictionary page scan.
devatāgṛhan. idem or '(g-) n. "gods' house", temple, chapel ' View this entry on the original dictionary page scan.
devatājitm. "gods-conqueror", Name of a son of su-mati- and grandson of bharata- View this entry on the original dictionary page scan.
devatālakam. Lipeocercis Serrata (see -tāḍ-). View this entry on the original dictionary page scan.
devatālaya(l-) m. () View this entry on the original dictionary page scan.
devatalpam. couch of the gods View this entry on the original dictionary page scan.
devatamam. deva
devatāmandiran. equals -gṛha- View this entry on the original dictionary page scan.
devatāmaṇim. "divine jewel", Name of a medicine plant View this entry on the original dictionary page scan.
devatāmayamf(ī-)n. containing all deities View this entry on the original dictionary page scan.
devatāmithunan. the cohabitation of deities View this entry on the original dictionary page scan.
devatāmūrtiprakaraṇan. Name of work on sculpture. View this entry on the original dictionary page scan.
devatānigamam. address of a deity, View this entry on the original dictionary page scan.
devatānukrama(n-) m. View this entry on the original dictionary page scan.
devatānukramaṇīf. index of the Vedic deities. View this entry on the original dictionary page scan.
devatāpāramyan. Name of work View this entry on the original dictionary page scan.
devatāpraṇidhānan. devotion to a deity View this entry on the original dictionary page scan.
devatāpratimāf. "god-image", an idol View this entry on the original dictionary page scan.
devatāpratiṣṭhāvidhim. Name of work View this entry on the original dictionary page scan.
devatāpūjanan. worship of a deities (see deva-pūjā-) View this entry on the original dictionary page scan.
devataram. (with cyāvasāyana- kāśyapa-) Name (also title or epithet) of a teacher, View this entry on the original dictionary page scan.
devataram. Name of a man (gaRa śubhrādi-). View this entry on the original dictionary page scan.
devatārādhana(r-) n. homage to the gods View this entry on the original dictionary page scan.
devatarasm. Name of teachers View this entry on the original dictionary page scan.
devataratha m. Name of teachers View this entry on the original dictionary page scan.
devatārcana(r-) n. worship of the gods View this entry on the original dictionary page scan.
devatārcanakramam. Name of several works. View this entry on the original dictionary page scan.
devatārcanavidhim. Name of several works. View this entry on the original dictionary page scan.
devatarpaṇan. "refreshing of the gods", offerings of water, part of the sandhyā- ceremony View this entry on the original dictionary page scan.
devatarum. divine tree, the old or sacred tree of a village (see caitya-and dyu-t-) View this entry on the original dictionary page scan.
devatarum. Name of the 5 trees of svarga- (mandāra-, pārijātaka-, saṃtāna-, kalpa-vṛkṣa-, hari-candana-). View this entry on the original dictionary page scan.
devatāsahāyinmfn. accompanied (only) by the gods id est alone View this entry on the original dictionary page scan.
devatāśeṣam. equals deva-ś- (q.v) View this entry on the original dictionary page scan.
devatāsnānan. ablution of an idol View this entry on the original dictionary page scan.
devatāśraya(ś-) mfn. relating to a gods View this entry on the original dictionary page scan.
devatāsthāpanavidhim. Name of work View this entry on the original dictionary page scan.
devatāsvarūpavicāram. Name of work View this entry on the original dictionary page scan.
devatātf. divine service View this entry on the original dictionary page scan.
devatātf. divinity, the gods collectively View this entry on the original dictionary page scan.
devatātasind. on the part of a deity View this entry on the original dictionary page scan.
devatātif. (v/a--) divine service View this entry on the original dictionary page scan.
devatātif. divinity, the gods collectively View this entry on the original dictionary page scan.
devatātmā(t-) f. mother of the gods (see devātmā-). View this entry on the original dictionary page scan.
devatātmanmfn. (t-) having a divine soul View this entry on the original dictionary page scan.
devatātmanm. Name of śiva- View this entry on the original dictionary page scan.
devatātvan. state of divinity View this entry on the original dictionary page scan.
devatātvanirṇayam. Name of work View this entry on the original dictionary page scan.
devatāvādavicāram. Name of work View this entry on the original dictionary page scan.
devatāvāripūjāf. Name of work View this entry on the original dictionary page scan.
devatāveśmann. () equals -gṛha-. View this entry on the original dictionary page scan.
devatāyatana(y-) n. equals -gṛha- View this entry on the original dictionary page scan.
devatejyāf. sacrifice to a deity View this entry on the original dictionary page scan.
devātidevam. a god surpassing all other gods View this entry on the original dictionary page scan.
devātidevam. Name of śiva- View this entry on the original dictionary page scan.
devātidevam. of viṣṇu- View this entry on the original dictionary page scan.
devātidevam. of śākya-muni- View this entry on the original dictionary page scan.
devatīrthan. "divine tīrtha-", Name of a bathing-place View this entry on the original dictionary page scan.
devatīrthan. right moment for (worshipping) the gods View this entry on the original dictionary page scan.
devatīrthan. the part of the hands sacred to the gods (id est the tips of the fingers) View this entry on the original dictionary page scan.
devatīrthamayamf(ī-)n. full of divine tīrtha-s View this entry on the original dictionary page scan.
devatīrthasvāminm. the ascetic Name of viśveśvara-datta-mitra- View this entry on the original dictionary page scan.
devātitha wrong reading for daiv-. View this entry on the original dictionary page scan.
devātithim. "guest of the gods", Name of a kāṇva- and author of View this entry on the original dictionary page scan.
devātithim. of a prince who was son of a-krodhana- (or krodhana- ) and karambhā- View this entry on the original dictionary page scan.
devātmāf. the mother of the gods (see devatātmā-). View this entry on the original dictionary page scan.
devātmanm. the divine soul View this entry on the original dictionary page scan.
devātmanm. Ficus Religiosa View this entry on the original dictionary page scan.
devātmanmfn. being of divine nature, containing a deity, sacred View this entry on the original dictionary page scan.
devātmaśaktif. the power of the soul View this entry on the original dictionary page scan.
devatopadeśanan. designation of the d worshipped in any rite View this entry on the original dictionary page scan.
devatrāind. among or to the gods View this entry on the original dictionary page scan.
devatrātam. "god-protected", Name of a Scholiast or Commentator on View this entry on the original dictionary page scan.
devatta(v/a--,for dev/a-datta-) mfn. god-given View this entry on the original dictionary page scan.
devaṭṭīf. a sort of gull (equals gaṅgācillī-) View this entry on the original dictionary page scan.
devatumulan. "divine noise", thunder View this entry on the original dictionary page scan.
devatvan. godhead, divinity (see --) View this entry on the original dictionary page scan.
devatyamfn. (in fine compositi or 'at the end of a compound') having as one's deity, sacred to a deity (see eka--, kiṃ--, bahu--, soma--; daivatya-) View this entry on the original dictionary page scan.
devatyāf. a species of animal (?) View this entry on the original dictionary page scan.
devaukasn. "divine abode", mount meru- View this entry on the original dictionary page scan.
devavacanāf. "having divine speech", Name of a gandharvā- View this entry on the original dictionary page scan.
devavadham. a weapon of the gods View this entry on the original dictionary page scan.
devavāhanamfn. (horse) carrying the gods View this entry on the original dictionary page scan.
devavaktran. "the mouth of the gods", Name of agni- as the devouring flame View this entry on the original dictionary page scan.
devavallabham. Rottlera Tinctoria View this entry on the original dictionary page scan.
devavandamfn. praising the gods View this entry on the original dictionary page scan.
devavāṇīf. a divine voice View this entry on the original dictionary page scan.
devavaram. a superior or supreme deity View this entry on the original dictionary page scan.
devavaran. a divine boon or blessing View this entry on the original dictionary page scan.
devavardhakim. "divine architect", Name of viśva-karman- View this entry on the original dictionary page scan.
devavardhanam. Name of a son of devaka- View this entry on the original dictionary page scan.
devavarmann. armour of the gods View this entry on the original dictionary page scan.
devavarmanm. "having divine armour", Name of a prince View this entry on the original dictionary page scan.
devavarmanm. of the author of the tomara-vaṃśa- (1350) View this entry on the original dictionary page scan.
devavarṇinīf. Name of a daughter of bharad-vāja- View this entry on the original dictionary page scan.
devavarṣam. Name of a prince View this entry on the original dictionary page scan.
devavarṣan. (?) of a varṣa- in the dvīpa- śālmala- called after him View this entry on the original dictionary page scan.
devavartmann. "divine path", the atmosphere View this entry on the original dictionary page scan.
devavaryam. best or chief of the gods (śiva-) View this entry on the original dictionary page scan.
devāvāsam. idem or 'm. "habitation of the gods", temple ' View this entry on the original dictionary page scan.
devāvāsam. Ficus Religiosa View this entry on the original dictionary page scan.
devāvasatham. "habitation of the gods", temple View this entry on the original dictionary page scan.
devavatmfn. (v/a--) guarded or surrounded by gods (also v/ā-v-) View this entry on the original dictionary page scan.
devavatm. Name of a man (the grandfather of su-dās- ) View this entry on the original dictionary page scan.
devavatm. of a son of a-krūra- View this entry on the original dictionary page scan.
devavatm. of devaka- who was a son of āhuka- View this entry on the original dictionary page scan.
devavatm. of the 12th manu- (see -vāyu-) View this entry on the original dictionary page scan.
devavatind. like (in, with etc.) a god View this entry on the original dictionary page scan.
devāvat equals dev/a-v-. View this entry on the original dictionary page scan.
devavātamfn. (v/a--) agreeable to the gods View this entry on the original dictionary page scan.
devavātam. Name of a man View this entry on the original dictionary page scan.
devāvatāram. "id.", Name of a place View this entry on the original dictionary page scan.
devavataraṇan. "descent of the gods", Name of a poem. View this entry on the original dictionary page scan.
devavatīf. (vatī-) Name of a daughter of the gandharva- grāma-ṇī- View this entry on the original dictionary page scan.
devavāyum. Name of the 12th manu- (see 1. -vat-). View this entry on the original dictionary page scan.
devavedhūf. the wife of a god View this entry on the original dictionary page scan.
devaveśmann. "house of the gods", temple, chapel View this entry on the original dictionary page scan.
devavī(or -v-) mfn. (superl. -tama-) gratifying the gods View this entry on the original dictionary page scan.
devāvī equals deva-v/ī-. View this entry on the original dictionary page scan.
devavibhāgam. "quarter of the gods", the northern hemisphere View this entry on the original dictionary page scan.
devavidmfn. knowing the gods View this entry on the original dictionary page scan.
devavidyāf. divine science (equals nirukta- ) View this entry on the original dictionary page scan.
devavijayagaṇim. Name of a teacher View this entry on the original dictionary page scan.
devavimalagaṇim. Name of a poet View this entry on the original dictionary page scan.
devaviś() or
devaviśā() f. the gods collectively. View this entry on the original dictionary page scan.
devavītif. (v/a-v-) a feast or enjoyment for the gods View this entry on the original dictionary page scan.
devavītif. Name of a daughter of meru- and wife of a son of agnīdhra- View this entry on the original dictionary page scan.
devavratan. any religious observation or vow etc. View this entry on the original dictionary page scan.
devavratan. the favourite food of the gods View this entry on the original dictionary page scan.
devavratan. Name of several sāman-s View this entry on the original dictionary page scan.
devavratamfn. devoted to the gods, religious View this entry on the original dictionary page scan.
devavratam. Name of bhīṣma- View this entry on the original dictionary page scan.
devavratam. of skanda- View this entry on the original dictionary page scan.
devavratinmfn. obeying or serving the gods View this entry on the original dictionary page scan.
devāvṛdhmfn. (for va-v-) gladdening the gods View this entry on the original dictionary page scan.
devāvṛdhm. Name of a mountain (Nominal verb -vṛt-; varia lectio -vṛdha-). View this entry on the original dictionary page scan.
devāvṛdham. Name of a prince who was father of babhru- (see daivā-v-) (varia lectio -vṛddha-) View this entry on the original dictionary page scan.
devāvṛdham. of a mountain (See -vṛdh-). View this entry on the original dictionary page scan.
devavṛkṣam. "divine tree", a tree of paradise (see -taru-) View this entry on the original dictionary page scan.
devavṛkṣam. Alstonia Scholaris View this entry on the original dictionary page scan.
devavṛkṣam. bdellium (equals guggulu-) View this entry on the original dictionary page scan.
devavṛttif. deva-'s (id est puruṣottama-- deva-datta-'s) commentator or commentary on View this entry on the original dictionary page scan.
devavyacas(v/a--) mfn. affording space for the gods, receiving them View this entry on the original dictionary page scan.
devayāmfn. going to the gods, longing for them View this entry on the original dictionary page scan.
devayaNom. P., only p., y/at-, loving or serving the gods, religious (see /a--) ; divine or shining (?) View this entry on the original dictionary page scan.
devāyaNom. P., only p. y/at- equals vay/at-, Maitr. and View this entry on the original dictionary page scan.
devayajmfn. sacrificing to the gods (agni-) View this entry on the original dictionary page scan.
devayajanamf(ī-)n. idem or 'mfn. sacrificing to the gods (agni-) ' View this entry on the original dictionary page scan.
devayajanamf(ī-)n. serving for an oblation, View this entry on the original dictionary page scan.
devayajanan. place of offering View this entry on the original dictionary page scan.
devayajanatvan. View this entry on the original dictionary page scan.
devayajanavatmfn. having a place of offering View this entry on the original dictionary page scan.
devayajimfn. equals -yaj- View this entry on the original dictionary page scan.
devayajim. a worshipper of the gods, a muni- View this entry on the original dictionary page scan.
devayājinmfn. sacrificing to the gods View this entry on the original dictionary page scan.
devayājinm. Name of one of the attendants of skanda- View this entry on the original dictionary page scan.
devayājinm. of a dānava- (varia lectio -yātrin-). View this entry on the original dictionary page scan.
devayajñam. sacrifice to the gods (especially the homa- or burnt sacrifice, one of the 5 great oblations) ? View this entry on the original dictionary page scan.
devayajñam. Name of a man (see daiva-yajñi-). View this entry on the original dictionary page scan.
devayājñikam. Name of an author (equals yājñika-deva-) View this entry on the original dictionary page scan.
devayajyan. worship of the gods, a sacrifice etc. (instrumental case also jy/ā- ) View this entry on the original dictionary page scan.
devayajyāf. worship of the gods, a sacrifice etc. (instrumental case also jy/ā- ) View this entry on the original dictionary page scan.
devayānamf(ī-)n. equals -- View this entry on the original dictionary page scan.
devayānamf(ī-)n. leading to the gods, serving them as a way (adhvan-, pathin-etc.) View this entry on the original dictionary page scan.
devayānan. way leading to the gods View this entry on the original dictionary page scan.
devayānan. the vehicle of a god View this entry on the original dictionary page scan.
devayānan. of a wife of skanda- View this entry on the original dictionary page scan.
devayānīf. Name of a daughter of uśanas- or śukrācārya- (wife of yayāti- and mother of yadu- and turvasu-) View this entry on the original dictionary page scan.
devayānīyamfn. leading to the gods on View this entry on the original dictionary page scan.
devayaśasn. divine glory View this entry on the original dictionary page scan.
devayaśasan. divine glory, View this entry on the original dictionary page scan.
devayaśasinmfn. of divine gods View this entry on the original dictionary page scan.
devayaṣṭisee veda-- y-, parasmE-pada 1017 View this entry on the original dictionary page scan.
devāyatanan. "the dwelling of a god", a temple View this entry on the original dictionary page scan.
devayātrāf. an idol procession, View this entry on the original dictionary page scan.
devayātrinSee -yājin-. View this entry on the original dictionary page scan.
devayātum. "a heavenly yātu-" (v.r. ta-; see daiva-yātava-). View this entry on the original dictionary page scan.
devayāvanmf(varī-)n. going to the gods View this entry on the original dictionary page scan.
devayonimf. place or origin of a god, a divine birth-place View this entry on the original dictionary page scan.
devayonimf. the sacred wood used for kindling fire View this entry on the original dictionary page scan.
devayonimfn. of divine origin View this entry on the original dictionary page scan.
devayonim. a demi-god or demon View this entry on the original dictionary page scan.
devayoṣāf. she wife of a god View this entry on the original dictionary page scan.
devayumfn. devoted to the gods, pious View this entry on the original dictionary page scan.
devāyuf. (only accusative sg. f. y/uvam-) equals vay/u- View this entry on the original dictionary page scan.
devāyūf. (only accusative sg. f. y/uvam-) equals vay/u- View this entry on the original dictionary page scan.
devāyudhan. "weapon of the gods", Name of indra- View this entry on the original dictionary page scan.
devāyudhan. the rainbow View this entry on the original dictionary page scan.
devayugan. "the age of the gods", the first age of the world (equals kṛta-) View this entry on the original dictionary page scan.
devayugan. any age or period of the gods comprising the 4 ages of mankind View this entry on the original dictionary page scan.
devayukta(v/a--) mfn. (horses) yoked by the gods, 67, 8. View this entry on the original dictionary page scan.
devāyuṣan. the life-time of a god View this entry on the original dictionary page scan.
deveddhamfn. kindled by the gods (agni-) (opp. manv-iddha-). View this entry on the original dictionary page scan.
devejmfn. (Nominal verb -) sacrificing to the gods View this entry on the original dictionary page scan.
devejyam. "teacher of the gods", Name of bṛhas-pati- id est the planet Jupiter View this entry on the original dictionary page scan.
devendram. "chief of the gods", Name of indra- or śiva- View this entry on the original dictionary page scan.
devendram. of several authors View this entry on the original dictionary page scan.
devendrabuddhim. Name of a learned Buddhist View this entry on the original dictionary page scan.
devendrakīrtidevam. Name of a man View this entry on the original dictionary page scan.
devendrasamayam. Name of a work View this entry on the original dictionary page scan.
devendrāśramam. Name of an author View this entry on the original dictionary page scan.
devendrasūrim. Name of a jaina- writer (1240) View this entry on the original dictionary page scan.
devendravarmanm. Name (also title or epithet) of various kings, View this entry on the original dictionary page scan.
deveśam. "chief of the gods", Name of brahmā- or viṣṇu- or śiva- or indra- View this entry on the original dictionary page scan.
deveśam. king, prince View this entry on the original dictionary page scan.
deveśatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
deveśayamfn. resting on a god (viṣṇu-) View this entry on the original dictionary page scan.
deveśīf. Name of durgā- or of devakī- View this entry on the original dictionary page scan.
deveṣitamfn. sent or impelled by the gods View this entry on the original dictionary page scan.
deveṣṭamfn. wished by or acceptable to the gods View this entry on the original dictionary page scan.
deveṣṭam. a sort of drug (alsof(ā-).) View this entry on the original dictionary page scan.
deveṣṭam. the resin of Shorea Robusta View this entry on the original dictionary page scan.
deveṣṭam. bdellium View this entry on the original dictionary page scan.
deveṣṭāf. the wild lime tree (See also m.) View this entry on the original dictionary page scan.
deveṣum. divine arrow View this entry on the original dictionary page scan.
deveśvaram. "sovereign of the gods", Name of śiva- View this entry on the original dictionary page scan.
deveśvaram. of a pupil of śaṃkarācārya- View this entry on the original dictionary page scan.
deveśvaram. of another author View this entry on the original dictionary page scan.
deveśvarapaṇḍitam. Name of a poet View this entry on the original dictionary page scan.
def. See sub voce, i.e. the word in the Sanskrit order ([ confer, compare Latin di1vus,deus; Lit.de14vas; Old Pruss.deiwas.]) View this entry on the original dictionary page scan.
devi See dev/ī-. View this entry on the original dictionary page scan.
deSee dev/ī-. View this entry on the original dictionary page scan.
deviin compound for -. View this entry on the original dictionary page scan.
def. (see dev/a-) a female deity, goddess etc. (exempli gratia, 'for example' uṣas- ; sarasvatī-, ; sāvitrī-, the wife of brahmā- ; durgā-, the wife of śiva- etc.;the 4 goddesses of Buddhists are rocanī-, māmakī-, pāṇḍurā- and tārā- ) View this entry on the original dictionary page scan.
def. Name of nymph beloved by the Sun View this entry on the original dictionary page scan.
def. of an apsaras- View this entry on the original dictionary page scan.
def. (with jaina-s) the mother of 18th arhat- of present ava-sarpiṇī- View this entry on the original dictionary page scan.
def. queen, princess lady (the consecrated wife or daughter of a king, but also any woman of high rank) etc. View this entry on the original dictionary page scan.
def. a kind of bird (equals śyāmā-) View this entry on the original dictionary page scan.
def. a particular supernatural power (equals kuṇḍalinī-) View this entry on the original dictionary page scan.
def. worship, reverence View this entry on the original dictionary page scan.
def. Name of plants (colocynth, a species of cyperus, Medicago Esculenta etc.) View this entry on the original dictionary page scan.
def. (also) = gāyatrī-, View this entry on the original dictionary page scan.
de= nāgī-, View this entry on the original dictionary page scan.
devībhāgavatapurāṇan. Name of work View this entry on the original dictionary page scan.
devībhāgavatasthitif. Name of work View this entry on the original dictionary page scan.
devībhāvam. the dignity of a queen View this entry on the original dictionary page scan.
devībhavanan. equals -dhāman- View this entry on the original dictionary page scan.
devībhedagirim. Name of a mountain View this entry on the original dictionary page scan.
devībhujaṃgam. or n. Name of a stotra-. View this entry on the original dictionary page scan.
devidāsam. Name of several men View this entry on the original dictionary page scan.
devidāsam. of a Scholiast or Commentator on View this entry on the original dictionary page scan.
devīdāsam. Name of several authors (also -cakra-vartin-and -paṇḍita-) View this entry on the original dictionary page scan.
devīdattam. Name of the father of rāma-sevaka- and grandfather of kṛṣṇa-mitra- View this entry on the original dictionary page scan.
devīdhāmann. temple of durgā- View this entry on the original dictionary page scan.
devīgarbhagṛhan. durgā-'s sanctuary View this entry on the original dictionary page scan.
devīgṛhan. durgā-'s shrine View this entry on the original dictionary page scan.
devīgṛhan. apartment of a queen View this entry on the original dictionary page scan.
devīhṛdayan. Name of stotra-
devikāf. Name of a class of goddesses of an inferior order (plural the oblations made to them, viz. to anu-matī-, rākā-, sinīvālī-, kuhū-, and to dhātṛ- ; see -havis- ) View this entry on the original dictionary page scan.
devikāf. of the wife of yudhiṣṭhira- and mother of yaudheya- View this entry on the original dictionary page scan.
devikāf. of a river (see dāvika-) View this entry on the original dictionary page scan.
devikāf. of a country View this entry on the original dictionary page scan.
devikāf. the thorn-apple View this entry on the original dictionary page scan.
devikamf(ī-)n. appertaining to or derived from a deity View this entry on the original dictionary page scan.
devikam. fam. N. for deva-datta- View this entry on the original dictionary page scan.
devikāf. See devaka-. View this entry on the original dictionary page scan.
devīka in fine compositi or 'at the end of a compound' equals devī- View this entry on the original dictionary page scan.
devīkaSee sa--. View this entry on the original dictionary page scan.
devīkālottaran. Name of work View this entry on the original dictionary page scan.
devīkalpam. Name of work View this entry on the original dictionary page scan.
devīkavacan. Name of work View this entry on the original dictionary page scan.
devīkoṭan. " durgā-'s stronghold", Name of a town (prob. Devicotta on the Coromandel coast, south-east of Chidambaram) View this entry on the original dictionary page scan.
devīkrīḍāf. durgā-'s play ground View this entry on the original dictionary page scan.
devīkṛtif. "the queen's creation", Name of a grove View this entry on the original dictionary page scan.
devilam. idem or 'm. fam. N. for deva-datta- ' View this entry on the original dictionary page scan.
devilamfn. righteous, virtuous (equals dhārmika-) View this entry on the original dictionary page scan.
devilamfn. appertaining to a deity, divine View this entry on the original dictionary page scan.
devīmahādevan. Name of an ullāpya- (kind of play). View this entry on the original dictionary page scan.
devīmāhātmyan. Name of chapter of View this entry on the original dictionary page scan.
devīmāhātmyamantravibhāgakramam. Name of work View this entry on the original dictionary page scan.
devīmāhātmyapāṭhavidhim. Name of work View this entry on the original dictionary page scan.
devīmahimanm. Name of a stotra-. View this entry on the original dictionary page scan.
devīmānanirṇayam. Name of work View this entry on the original dictionary page scan.
devīmānasapūjanan. Name of work View this entry on the original dictionary page scan.
devīmānasapūjāvidhim. Name of work View this entry on the original dictionary page scan.
devīmatan. Name of a tantra-. View this entry on the original dictionary page scan.
devīṃdhiyakamfn. containing the words devīṃ dhiyā- (as an adhyāya- or anuvāka-) gaRa goṣad-ādi-. View this entry on the original dictionary page scan.
devinmfn. gambling, a gambler (see akṣa--, durdyūta--, sādhu--). View this entry on the original dictionary page scan.
devīnāmāvalīf. Name of work View this entry on the original dictionary page scan.
devīnavaratnan. Name of a stotra-. View this entry on the original dictionary page scan.
devīnityapūjāvidhim. Name of work View this entry on the original dictionary page scan.
devīpādadvayan. "the two feet of durgā-", Name of a bathing-place View this entry on the original dictionary page scan.
devīpañcaratnan. Name of work View this entry on the original dictionary page scan.
devīpañcaśatīf. Name of work View this entry on the original dictionary page scan.
devīparapūjāvidhim. Name of work View this entry on the original dictionary page scan.
devīparicaryāf. Name of work View this entry on the original dictionary page scan.
devīpūjanabhāskaram. Name of work View this entry on the original dictionary page scan.
devīpūjāpaddhatif. Name of work View this entry on the original dictionary page scan.
devīpūjāprakaraṇan. Name of work View this entry on the original dictionary page scan.
devīpūjāvidhim. Name of work View this entry on the original dictionary page scan.
devīpurāṇan. Name of an upa-purāṇa- View this entry on the original dictionary page scan.
devīpurāṇīyamfn. belonging to it View this entry on the original dictionary page scan.
devīrahasyan. Name of work View this entry on the original dictionary page scan.
devīrāpaka() (gaRa goṣad-ādi-) mfn. containing the words devīr āpas- (see --dhiyaka-). View this entry on the original dictionary page scan.
devīrāpasaka(gaRa goṣad-ādi-) mfn. containing the words devīr āpas- (see --dhiyaka-). View this entry on the original dictionary page scan.
devīsahasranāmann. Name of work View this entry on the original dictionary page scan.
devīsahāyam. Name of author View this entry on the original dictionary page scan.
devīśatakan. Name of work View this entry on the original dictionary page scan.
devīśatanāmastotran. Name of work View this entry on the original dictionary page scan.
devīsiṃhadevam. Name of author View this entry on the original dictionary page scan.
devīstotran. Name of stotra- View this entry on the original dictionary page scan.
devīstutif. Name of stotra- View this entry on the original dictionary page scan.
devīsūktan. Name of stotra- View this entry on the original dictionary page scan.
devīsvarūpastutif. Name of stotra- View this entry on the original dictionary page scan.
devitamaSee deva-. View this entry on the original dictionary page scan.
devitamāf. deva
devītantran. Name of a tantra-. View this entry on the original dictionary page scan.
devitavyamfn. to be gambled (impersonal or used impersonally) View this entry on the original dictionary page scan.
devitavyan. gambling View this entry on the original dictionary page scan.
devitṛm. gambler View this entry on the original dictionary page scan.
devitvā ind.p. having gambled (See 2. div-.) View this entry on the original dictionary page scan.
devītvan. the state or rank of a goddess or queen View this entry on the original dictionary page scan.
deviyam. fam. N. for deva-datta- View this entry on the original dictionary page scan.
devīyāmalatantran. Name of work View this entry on the original dictionary page scan.
devodyānan. "grove of the gods", sacred grove View this entry on the original dictionary page scan.
devopāsakam. worshipper of the gods View this entry on the original dictionary page scan.
devṛm. a husband's brother (especially his younger brother) (prob. as the player, because he has less to do than his elder brother) ; the husband of a woman previously married [ confer, compare Armorican or the language of Brittany taigr; Greek ; Latin levir; Anglo-Saxon tacur; German zeihhur; Lithuanian de4veris; Slavonic or Slavonian de8veri.] View this entry on the original dictionary page scan.
devṛghnīSee /a-devṛ-ghnī-. View this entry on the original dictionary page scan.
devṛkāma(v/ṛ--) mfn. loving one's brother-in-law. View this entry on the original dictionary page scan.
devyin compound for devī- before vowels. View this entry on the original dictionary page scan.
devyan. divine power, godhead View this entry on the original dictionary page scan.
devyāgamanatantran. Name of work View this entry on the original dictionary page scan.
devyaparādhakṣamāpaṇastotran. Name of work View this entry on the original dictionary page scan.
devyāryāśatakan. Name of work View this entry on the original dictionary page scan.
devyaṣṭakan. Name of work View this entry on the original dictionary page scan.
devyaṣṭottaran. Name of work View this entry on the original dictionary page scan.
devyātharvaṇasīrṣopaniṣadf. Name of work View this entry on the original dictionary page scan.
devyāvaraṇapūjāf. Name of work View this entry on the original dictionary page scan.
devyāyatanan. equals -dhāman- View this entry on the original dictionary page scan.
devyupaniṣadf. Name of work View this entry on the original dictionary page scan.
deyamfn. (1. -) to be given or presented or granted or shown View this entry on the original dictionary page scan.
deyamfn. fit or proper for a gift etc. View this entry on the original dictionary page scan.
deyamfn. to be or being given in matrimony (see brahma--) View this entry on the original dictionary page scan.
deyamfn. to be delivered or handed over View this entry on the original dictionary page scan.
deyamfn. to be ceded (road) View this entry on the original dictionary page scan.
deyamfn. to be returned View this entry on the original dictionary page scan.
deyamfn. to be paid (as a debt, wages, taxes etc.) View this entry on the original dictionary page scan.
deyamfn. to be laid or set to (as fire) View this entry on the original dictionary page scan.
deyan. giving, gift (see a--, bala--, magha--, rādho--, vasu--, vaira--) View this entry on the original dictionary page scan.
deyan. tax, tribute View this entry on the original dictionary page scan.
deyan. water (?) View this entry on the original dictionary page scan.
deyadharmam. "the duty of giving", charity View this entry on the original dictionary page scan.
dhaḍievam. Name of a man View this entry on the original dictionary page scan.
ḍhakkadeśīyamfn. spoken in the district of ḍhakka- View this entry on the original dictionary page scan.
dhāmakeśinmfn. "ray-haired"(the sun) View this entry on the original dictionary page scan.
dhanadadevam. Name of a poetry or poetic View this entry on the original dictionary page scan.
dhanadeśvaram. "wealth giving lord", Name of kubera- View this entry on the original dictionary page scan.
dhanadeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
dhanadevam. Name of a minister and author View this entry on the original dictionary page scan.
dhanadevam. of another man View this entry on the original dictionary page scan.
dhanakelim. "sporting with wealth", Name of kubera- View this entry on the original dictionary page scan.
dhanaṃjayasenam. Name of a poet View this entry on the original dictionary page scan.
dhananetṛm. "bringer of wealth", prince, king View this entry on the original dictionary page scan.
dhanecchāf. desire for wealth View this entry on the original dictionary page scan.
dhaneśm. "wealth-lord", a rich man View this entry on the original dictionary page scan.
dhaneśam. idem or 'm. "wealth-lord", a rich man ' View this entry on the original dictionary page scan.
dhaneśam. Name of kubera- ( dhaneśatva -tva-,n., ) View this entry on the original dictionary page scan.
dhaneśam. Name of vopadeva-'s teacher View this entry on the original dictionary page scan.
dhaneśatvan. dhaneśa
dhaneśvaram. "treasure-lord", Name of kubera- View this entry on the original dictionary page scan.
dhaneśvaram. Name of a Brahman View this entry on the original dictionary page scan.
dhaneśvaram. of vopadeva-'s teacher (see prec.) etc. View this entry on the original dictionary page scan.
dhaneśvarīf. a rich woman or the wife of kubera- View this entry on the original dictionary page scan.
dhaneyam. Name of a son of raudrāśva- View this entry on the original dictionary page scan.
dhāneya n. coriander View this entry on the original dictionary page scan.
dhaneyakan. coriander seed (equals dhanyāka-) View this entry on the original dictionary page scan.
dhāneyakan. coriander View this entry on the original dictionary page scan.
dhanuḥśreṇīf. equals dhanu-ś- or = mahendra-vāruṇī-. View this entry on the original dictionary page scan.
dhanuketakīf. a kind of flower View this entry on the original dictionary page scan.
dhanurvedam. the science of archery, an archery treatise (regarded as an upa-veda- connected with the yajur-veda-, and derived from viśvāmitra- or bhṛgu-) etc. View this entry on the original dictionary page scan.
dhanurvedam. Name of work by śārṅga-datta- View this entry on the original dictionary page scan.
dhānurvedam. equals dhanur-veda- View this entry on the original dictionary page scan.
dhanurvedacintāmaṇim. Name of work View this entry on the original dictionary page scan.
dhanurvedaparamfn. devoted to archery View this entry on the original dictionary page scan.
dhanurvedaparāyaṇamfn. devoted to archery View this entry on the original dictionary page scan.
dhanurvedaprakaraṇan. Name of work View this entry on the original dictionary page scan.
dhanurvedasāram. Name of work View this entry on the original dictionary page scan.
dhanurvedinmfn. versed in archery View this entry on the original dictionary page scan.
dhanurvedinm. Name of śiva- View this entry on the original dictionary page scan.
dhanuśreṇīf. Sanseviera Zeylanica View this entry on the original dictionary page scan.
dhānyadhenuf. a heap of rice (like a cow) to be presented to a Brahman (see -gava-). View this entry on the original dictionary page scan.
dhānyakṣetran. a corn-field, rice-field View this entry on the original dictionary page scan.
dhānyaśreṣṭhan. "the best of corn", a kind of rice View this entry on the original dictionary page scan.
dhānyeyan. coriander View this entry on the original dictionary page scan.
dharādharendram. "mountain-king", Name of himālaya- View this entry on the original dictionary page scan.
dharasenam. Name of 2 princes of the vallabhī- dynasty View this entry on the original dictionary page scan.
dhārāvartenaind. (ena-) fluently, quickly View this entry on the original dictionary page scan.
dhāreśvaram. the lord of dhārā- id est King bhoja- View this entry on the original dictionary page scan.
dharimameyamfn. measurable by weight View this entry on the original dictionary page scan.
dharmābhiṣekakriyāf. any ablution prescribed as a religious duty View this entry on the original dictionary page scan.
dharmadeśakam. teacher of the law (varia lectio d-). View this entry on the original dictionary page scan.
dharmādeśakaSee ma-d-. View this entry on the original dictionary page scan.
dharmadeśanāf. instruction in the law (Bombay edition; varia lectio pad-) View this entry on the original dictionary page scan.
dharmadeśanāf. with Buddhists= sermon View this entry on the original dictionary page scan.
dharmadevam. the god of justice View this entry on the original dictionary page scan.
dharmādharmasenāhananan. Name of chapter of the View this entry on the original dictionary page scan.
dharmadhenuf. equals -dogdhrī- View this entry on the original dictionary page scan.
dharmadṛḍhābhedyasunilambbam. Name of a king of the garuḍa-s View this entry on the original dictionary page scan.
dharmadveṣinm. Terminalia Bellerica (see -ghna-). View this entry on the original dictionary page scan.
dharmagaveṣam. "virtue seeking", Name of a man View this entry on the original dictionary page scan.
dharmakañcukapraveśinmfn. putting it on , View this entry on the original dictionary page scan.
dharmaketum. "having justice for a banner", Name of a son of su-ketu- and father of satya-ketu- View this entry on the original dictionary page scan.
dharmaketum. a buddha- View this entry on the original dictionary page scan.
dharmaketum. a jaina- saint View this entry on the original dictionary page scan.
dharmākṣepam. objection to the commonly accepted property or nature of anything View this entry on the original dictionary page scan.
dharmakṣetran. "law-field" equals kuru-kṣetra-, q.v
dharmakṣetram. a man of piety and virtue View this entry on the original dictionary page scan.
dharmakṣetram. Name of a man View this entry on the original dictionary page scan.
dharmamegham. a particular samādhi- ( dharmameghadhyāna -dhyāna-; n.a particular state of mind connected with it ) View this entry on the original dictionary page scan.
dharmameghāf. Name of one of the 10 bhūmi-s View this entry on the original dictionary page scan.
dharmameghadhyānan. dharmamegha
dharmamerum. Name of commentator or commentary on View this entry on the original dictionary page scan.
dharmanetram. "law-eyed", Name of a grandson of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
dharmanetram. of a son of taṃsu- and father of duṣmanta- View this entry on the original dictionary page scan.
dharmanetram. of a son of haihaya- View this entry on the original dictionary page scan.
dharmanetram. of a son of su-vrata- (varia lectio -sūtra-). View this entry on the original dictionary page scan.
dharmaniveśam. religious devotion View this entry on the original dictionary page scan.
dharmāpetamfn. departing from virtue, wicked, unrighteous View this entry on the original dictionary page scan.
dharmāpetan. immorality, vice View this entry on the original dictionary page scan.
dharmapramāṇaparicchedam. Name of work View this entry on the original dictionary page scan.
dharmaprekṣamfn. having an eye for what is right
dharmasatyavrateyum. plural dharmeyu-, satyeyu- and vrateyu- View this entry on the original dictionary page scan.
dharmasenam. Name of a king View this entry on the original dictionary page scan.
dharmasenam. of an author View this entry on the original dictionary page scan.
dharmaśeravaṇan. the hearing of a sermon View this entry on the original dictionary page scan.
dharmasetum. barrier of law or justice View this entry on the original dictionary page scan.
dharmasetum. Name of śiva- View this entry on the original dictionary page scan.
dharmasetum. of a son of āryaka-
dharmasevanan. fulfilment of duties View this entry on the original dictionary page scan.
dharmaśreṣṭhinm. Name of a Buddhist arhat-. View this entry on the original dictionary page scan.
dharmavivecanan. judicial investigation View this entry on the original dictionary page scan.
dharmavivekam. "discussion on the law", Name of works. View this entry on the original dictionary page scan.
dharmavivekavākyan. Name of a short poem ascribed to halāyudha-. View this entry on the original dictionary page scan.
dharmayogeśvaram. Name of a poetry or poetic View this entry on the original dictionary page scan.
dharmeṇaind. dharma
dharmendram. "lord of justice", Name of yama- View this entry on the original dictionary page scan.
dharmepsumfn. wishing to gain religious merit View this entry on the original dictionary page scan.
dharmeśam. equals mendra-, View this entry on the original dictionary page scan.
dharmesthitamfn. dharma
dharmeśvaram. idem or 'm. equals mendra-, ' ( dharmeśvaratīrtha -tīrtha- n. ; dharmeśvaraliṅga -liṅga- n. ) View this entry on the original dictionary page scan.
dharmeśvaram. Name of a deva-putra- View this entry on the original dictionary page scan.
dharmeśvaram. of several men View this entry on the original dictionary page scan.
dharmeśvaram. of several authors (also ra-daivājña-and gni-hotrin-) View this entry on the original dictionary page scan.
dharmeśvaraliṅgan. dharmeśvara
dharmeśvaratīrthan. dharmeśvara
dharmeyum. Name of a son of raudrāśva- View this entry on the original dictionary page scan.
dhārmiṇeyametr. fr. dharmiṇī- gaRa śubhrādi-. View this entry on the original dictionary page scan.
dharmitāvacchedam. Name of work
dharmitāvacchedakapratyāsattif. Name of work
dharmitāvacchedakapratyāsattinirūpaṇan. Name of work
dharmitāvacchedakarahasyan. Name of work
dharmitāvacchedakatāvādam. Name of work
dharmitāvacchedakatāvādārtham. Name of work
dharmitāvacchedakavādam. Name of work
dharmopadeśam. instruction in law or duty, religious or moral instruction View this entry on the original dictionary page scan.
dharmopadeśam. the laws collectively View this entry on the original dictionary page scan.
dharmopadeśam. the statement of modality (see ma-mātra-) View this entry on the original dictionary page scan.
dharmopadeśam. Name of a jaina- work View this entry on the original dictionary page scan.
dharmopadeśakam. teacher of the law, spiritual preceptor View this entry on the original dictionary page scan.
dharmopadeśanāf. varia lectio for ma-deśanā- q.v View this entry on the original dictionary page scan.
dharmopetamfn. endowed with virtues View this entry on the original dictionary page scan.
dharmyākṣepam. objection to the bearer of any characteristic or peculiarity View this entry on the original dictionary page scan.
dhārteyam. plural (prob. fr. dhṛta-), Name of a warlike tribe View this entry on the original dictionary page scan.
dhārteyam. sg. a prince of this tribe View this entry on the original dictionary page scan.
dhārtef. gaRa yaudheyādi-. View this entry on the original dictionary page scan.
dhātreyikāf. foster-sister (a sort of confidante) View this entry on the original dictionary page scan.
dhātreyikāf. wet-nurse View this entry on the original dictionary page scan.
dhātreyikāf. female slave View this entry on the original dictionary page scan.
dhātreyikāyīf. foster-sister View this entry on the original dictionary page scan.
dhātreyikāyīf. wet-nurse View this entry on the original dictionary page scan.
dhātuśekharan. "chief of minerals", green vitriol View this entry on the original dictionary page scan.
dhaureyamf(ī-)n. (fr. dhur-) fit to be harnessed or for a burden View this entry on the original dictionary page scan.
dhaureyamf(ī-)n. being foremost, at the head of (see puruṣa--) View this entry on the original dictionary page scan.
dhaureyam. beast of burden, draught-horse (also yaka- ) . View this entry on the original dictionary page scan.
dhaurteyam. plural Name of a warlike tribe View this entry on the original dictionary page scan.
dhaurteyam. sg. a prince of this tribe gaRa yaudheyādi-, iv, 1, 178 ( dhārteya-and ghārt-). View this entry on the original dictionary page scan.
dhautakauśeyan. bleached or purified silk (= pattrorṇa-) View this entry on the original dictionary page scan.
dhauteyan. rock-salt (see dhauta-śila-). View this entry on the original dictionary page scan.
dhavaletarataṇḍulam. Andropogon Bicolor View this entry on the original dictionary page scan.
dhāyinen. dual number two doors, folding doors (?), View this entry on the original dictionary page scan.
dhe cl.1 P. () dh/ayati- etc. (perfect tense dadhau-,3. plural dh/ur- ; Aorist -adhāt- ; adhāsīt-or adadhat- ; preceding dheyāt-, ; future dhāsyati- , dhātā- grammar; dative case infinitive mood dh/ātave- ; ind.p. dhītv/ā-and -dh/īya- ; -dhāya- grammar) to suck, drink, suck or drink in, take to one's self, absorb, appropriate etc. etc.: Passive voice dhīyate- grammar : Causal dhāp/ayāte- (confer, compare Va1rtt. 1 ) to give suck, nourish ; ti- (confer, compare anu-- dhe-) ; Aorist adīdhapat- grammar : Desiderative dhitsati- : Intensive dedhīyate-, dādheti-, and dādhāti- grammar ([ confer, compare Greek , ; Latin fe1-lare; Gothic dadd-jan; German ta1-an,ta1-jan.]) View this entry on the original dictionary page scan.
dhemātram. or n. a particular high number (), v.r. for dhamātra- (See dhamara-). View this entry on the original dictionary page scan.
dhenam. the ocean or a river View this entry on the original dictionary page scan.
dhef. a milch cow plural any beverage made of milk View this entry on the original dictionary page scan.
dhef. a mare (?), View this entry on the original dictionary page scan.
dhef. river View this entry on the original dictionary page scan.
dhef. speech, voice (?), (; see ) View this entry on the original dictionary page scan.
dhef. Name of the wife of bṛhaspati- View this entry on the original dictionary page scan.
dhef. a river View this entry on the original dictionary page scan.
dhenikāf. coriander (varia lectio nukā-). View this entry on the original dictionary page scan.
ḍheṅkam. Name of a bird View this entry on the original dictionary page scan.
ḍheṅkīf. a kind of dance. View this entry on the original dictionary page scan.
ḍheṅkikāf. (in music) a kind of measure View this entry on the original dictionary page scan.
ḍheṅkikātālam. idem or 'f. (in music) a kind of measure'
dhenumfn. milch, yielding or giving milk View this entry on the original dictionary page scan.
dhenuf. a milch cow or any cow etc. (in fine compositi or 'at the end of a compound' of names of animals also denoting the female of any species of khaḍga--, go--, vaḍava--) View this entry on the original dictionary page scan.
dhenuf. any offering or present to Brahmans instead or in the shape of a cow (mostly in fine compositi or 'at the end of a compound' [ see ghṛta--, jala--, tila--etc.] , where it also forms diminutives; see asi--, khaḍga--) View this entry on the original dictionary page scan.
dhenuf. metaph. = the earth View this entry on the original dictionary page scan.
dhenuf. plural any beverage made of milk View this entry on the original dictionary page scan.
dhenun. Name of a sāman- (also marutāṃ dh-and dhenu-payasī- dual number) View this entry on the original dictionary page scan.
dhenubhavyāf. about to become a milch cow View this entry on the original dictionary page scan.
dhenudakṣiṇamfn. (sacrifice) whereat a cow is given as a fee View this entry on the original dictionary page scan.
dhenudugdhan. cow's milk View this entry on the original dictionary page scan.
dhenudugdhan. a kind of gourd View this entry on the original dictionary page scan.
dhenugoduhan. cow and milker View this entry on the original dictionary page scan.
dhenukam. a kind of coitus (see dhain-) View this entry on the original dictionary page scan.
dhenukam. Name of an asura- slain by kṛṣṇa- or bala-bhadra- View this entry on the original dictionary page scan.
dhenukam. of a son of dur-dama- View this entry on the original dictionary page scan.
dhenukam. plural Name of a people View this entry on the original dictionary page scan.
dhenukāf. milch cow, cow View this entry on the original dictionary page scan.
dhenukāf. any female animal (also a woman) and etc. View this entry on the original dictionary page scan.
dhenukāf. equals dṛṣṭa-puṣpā- View this entry on the original dictionary page scan.
dhenukāf. equals dhenu- in fine compositi or 'at the end of a compound' to form diminutive View this entry on the original dictionary page scan.
dhenukāf. a vein which when cut bleeds only at intervals View this entry on the original dictionary page scan.
dhenukāf. coriander (varia lectio dhenikā-) View this entry on the original dictionary page scan.
dhenukāf. Name of the wife of kīrti-mat- (son of aṅgiras-) View this entry on the original dictionary page scan.
dhenukāf. of a river View this entry on the original dictionary page scan.
dhenukan. Name of a herd of milch cows View this entry on the original dictionary page scan.
dhenukan. Name of a place of pilgrimage View this entry on the original dictionary page scan.
dhenūkaSee bahu--. View this entry on the original dictionary page scan.
dhenukadhvaṃsinm. "slayer of dhenuka-", kṛṣṇa- View this entry on the original dictionary page scan.
dhenukādugdhan. cow's milk View this entry on the original dictionary page scan.
dhenukādugdhan. a kind of gourd View this entry on the original dictionary page scan.
dhenukaram. Daucus Carota View this entry on the original dictionary page scan.
dhenukārim. "enemy of dhenukāri-", kṛṣṇa- View this entry on the original dictionary page scan.
dhenukārim. a kind of small tree View this entry on the original dictionary page scan.
dhenukāśramam. Name of a hermitage View this entry on the original dictionary page scan.
dhenukasūdanam. equals -dhvaṃsin- View this entry on the original dictionary page scan.
dhenukavadham. the killing of dhenuka- View this entry on the original dictionary page scan.
dhenukavadham. Name of chapter of View this entry on the original dictionary page scan.
dhenumakṣikāf. horse-fly, gad-fly View this entry on the original dictionary page scan.
dhenumatmfn. containing or yielding a nourishing beverage View this entry on the original dictionary page scan.
dhenumatmfn. containing the word dhenu-
dhenumatīf. Name of the wife of deva-dyumna- View this entry on the original dictionary page scan.
dhenumbhavyāf. equals nu-bh- ( Va1rtt. 3) . View this entry on the original dictionary page scan.
dhenuṣṭarīf. (fr. starī-) a milch cow ceasing to give milk View this entry on the original dictionary page scan.
dhenuṣyāf. a cow whose milk has been pledged (see ) . View this entry on the original dictionary page scan.
dhenuṣyitamfn. one who has pledged the milk of his cows (?) gaRa tārakādi-. View this entry on the original dictionary page scan.
dhenutvan. the state of being a cow View this entry on the original dictionary page scan.
dhenvanaḍuhan. sg. or m.> dual number milch cow and bull (see ) View this entry on the original dictionary page scan.
dheṣṭhamfn. (superl.) giving the most, most liberal View this entry on the original dictionary page scan.
ḍhevvukāf. a coin, View this entry on the original dictionary page scan.
dheyamfn. (1. dkā-) to be held or taken etc. View this entry on the original dictionary page scan.
dheyamfn. to be created or what is created View this entry on the original dictionary page scan.
dheyamfn. to be applied or pat in practice View this entry on the original dictionary page scan.
dheyan. giving, imparting (in fine compositi or 'at the end of a compound' see nāma--, bhāga--, mitra--etc. Va1rtt. 2, 3) . View this entry on the original dictionary page scan.
dheyeśvaram. Name of an author View this entry on the original dictionary page scan.
dhīracetasmfn. strong-minded, self-possessed, courageous View this entry on the original dictionary page scan.
dhīrendram. Name of an author View this entry on the original dictionary page scan.
dhīreśamiśram. Name of a teacher View this entry on the original dictionary page scan.
dhīreśvaram. Name of the father of jyotir-īśvara- (author of ) View this entry on the original dictionary page scan.
dhrek cl.1 A1. dhrekate-, to sound (see drek-). View this entry on the original dictionary page scan.
dhṛṣṇuṣeṇamfn. (ṇ/u--) having a resistless weapon (indra- or the marut-s) View this entry on the original dictionary page scan.
dhṛṣṇuṣeṇamfn. leading a valiant army (drum) View this entry on the original dictionary page scan.
dhṛṣṭaketum. Name of a king of cedi- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a king of videhā- or mithilā- (son of su-dhṛti-) View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of satya-dhṛti- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of the son of sukumāra- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of his father View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of dhṛṣṭa-dyumna- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a king of the kaikaya-s View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of manu- View this entry on the original dictionary page scan.
dhṛtade f. Name of a daughter of devaka- View this entry on the original dictionary page scan.
dhṛtadef. Name of a daughter of devaka- View this entry on the original dictionary page scan.
dhṛtahetimfn. bearing weapons, armed View this entry on the original dictionary page scan.
dhṛtaikaveṇimfn. bearing a single braid of hair (as a sign of mourning) View this entry on the original dictionary page scan.
dhṛtakārmukeṣumfn. armed with bow and arrows View this entry on the original dictionary page scan.
dhṛtaketum. Name of a son of the 9th manu- View this entry on the original dictionary page scan.
dhṛtakleśam. undergoing hardships View this entry on the original dictionary page scan.
dhṛteṣudhimfn. carrying a quiver View this entry on the original dictionary page scan.
dhṛtiṣeṇam. Name (also title or epithet) of a jaina- teacher, View this entry on the original dictionary page scan.
dhṛtotsekamfn. possessing pride, haughty, arrogant View this entry on the original dictionary page scan.
dhruvadef. Name of a princess View this entry on the original dictionary page scan.
dhruvaketum. a kind of meteor View this entry on the original dictionary page scan.
dhruvakṣema(v/a--) mfn. firmly fixed, immovable View this entry on the original dictionary page scan.
dhruvakṣetran. Name of a place View this entry on the original dictionary page scan.
dhruvaseind. (dative case as infinitive mood) to stop or rest View this entry on the original dictionary page scan.
dhruvasenam. Name of 2 valabhī- princes View this entry on the original dictionary page scan.
dhūlikedāram. a mound, rampart of earth View this entry on the original dictionary page scan.
dhūliprakṣepam. the throwing of handful of dust View this entry on the original dictionary page scan.
dhūmaketanam. "smoke-marked", fire View this entry on the original dictionary page scan.
dhūmaketanam. meteor, a comet View this entry on the original dictionary page scan.
dhūmaketanam. ketu- or the personified descending node View this entry on the original dictionary page scan.
dhūmaketumfn. (m/a--) having smoke as banner or sign (agni- ;the sun ) View this entry on the original dictionary page scan.
dhūmaketum. fire View this entry on the original dictionary page scan.
dhūmaketum. a comet or falling star etc. View this entry on the original dictionary page scan.
dhūmaketum. the personified descending node View this entry on the original dictionary page scan.
dhūmaketum. Name of the sun View this entry on the original dictionary page scan.
dhūmaketum. of a yakṣa- wrong reading for dhūmra-k-. View this entry on the original dictionary page scan.
dhūmalekhāf. equals -rāji- View this entry on the original dictionary page scan.
dhūmalekhāf. Name of the daughter of a yakṣa- View this entry on the original dictionary page scan.
dhūmanetran. equals dhūpa-n- View this entry on the original dictionary page scan.
dhūmanetram. Name of a mountain View this entry on the original dictionary page scan.
dhūmrakeśam. "dark-haired", Name of a son of pṛthu- and arcis- View this entry on the original dictionary page scan.
dhūmrakeśam. of a son of kṛśāśva- and arcis- View this entry on the original dictionary page scan.
dhūmrakeśam. of a dānava- View this entry on the original dictionary page scan.
dhūmraketum. "grey-bannered", Name of a son of bharata- View this entry on the original dictionary page scan.
dhūmraketum. of a son of tṛṇabindu- View this entry on the original dictionary page scan.
dhunetimfn. having a roaring course View this entry on the original dictionary page scan.
dhūpanetran. a pipe for smoking (see dhūma--).
dhurānikṣepaṇa(?) , Name of a caitya- of the malla-s View this entry on the original dictionary page scan.
dhuryetaramfn. "other than the first", the charioteer (as opp. to the hero) View this entry on the original dictionary page scan.
dhūtapāpeśvaratīrthan. Name of tīrtha-s View this entry on the original dictionary page scan.
dhvajāgrakeyūram. "the ring on the top of a standard", Name of a particular samādhi- View this entry on the original dictionary page scan.
dhvajinyutsavasaṃketam. Name of a people View this entry on the original dictionary page scan.
dhvaniviveka m. Name of work View this entry on the original dictionary page scan.
dhvāntonmeṣam. equals nta-citta- View this entry on the original dictionary page scan.
dhvastapremanmfn. whose love has vanished View this entry on the original dictionary page scan.
dhyānacchedam. interruption of thought or meditation View this entry on the original dictionary page scan.
dhyeyamfn. to be meditated on, fit for meditation, to be pondered or imagined View this entry on the original dictionary page scan.
diddākṣemam. "promoting welfare of diddā-", Name of kṣema-gupta- View this entry on the original dictionary page scan.
dideviṣumfn. ( div- Desiderative) desirous of playing View this entry on the original dictionary page scan.
didṛkṣeṇya mfn. what one likes or wishes to see, worth seeing, attractive View this entry on the original dictionary page scan.
didṛkṣeyamfn. what one likes or wishes to see, worth seeing, attractive View this entry on the original dictionary page scan.
digbhedam. difference of direction View this entry on the original dictionary page scan.
digdeśam. a distant region or country View this entry on the original dictionary page scan.
digdeśam. in gaRa region, country View this entry on the original dictionary page scan.
digdevatāf. equals dik-pati- View this entry on the original dictionary page scan.
dikprekṣaṇan. looking round in all directions (from fear etc.) View this entry on the original dictionary page scan.
dīkṣāsetum. Name of work View this entry on the original dictionary page scan.
dīkṣāvivekam. Name of work View this entry on the original dictionary page scan.
dikṣitāvedanan. equals ta-vāda- View this entry on the original dictionary page scan.
dīnacetanamfn. "distressed in mind", dejected View this entry on the original dictionary page scan.
dinakaradevam. Name of a poet View this entry on the original dictionary page scan.
dinakesara(also written śara-) m. "day-hair", darkness View this entry on the original dictionary page scan.
dinakeśava m. "day-hair", darkness View this entry on the original dictionary page scan.
ḍiṇḍimeśvaratīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
dineśam. equals na-pati- View this entry on the original dictionary page scan.
dineśātmajam. "son of the Sun", the planet Saturn View this entry on the original dictionary page scan.
dineśvaram. equals na-tha- View this entry on the original dictionary page scan.
dīpastambhadevatāpūjāf. Name of work View this entry on the original dictionary page scan.
dīptaketum. "bright-bannered", Name of a king View this entry on the original dictionary page scan.
dīptaketum. of a son of manu- dakṣa-sāvarṇi-
dīptatejasmfn. radiant with glory View this entry on the original dictionary page scan.
dīptikeśvaratīrtha(keśv-?) n. Name of a tīrtha- View this entry on the original dictionary page scan.
dīptiketum. Name of a son of manu- dakṣa-sāvarṇi- (see dīpta--) View this entry on the original dictionary page scan.
dīrghadveṣinmfn. cherishing long hatred, implacable View this entry on the original dictionary page scan.
dīrghakeśamf(ī-)n. "long-haired" View this entry on the original dictionary page scan.
dīrghakeśam. a bear View this entry on the original dictionary page scan.
dīrghakeśam. plural Name of a people. View this entry on the original dictionary page scan.
dīrghāpekṣinmfn. very regardful or considerate (Bombay edition dīrghapr-). View this entry on the original dictionary page scan.
dīrghaprekṣinmfn. equals -darśana- View this entry on the original dictionary page scan.
dīrghaveṇum. plural Name of a people View this entry on the original dictionary page scan.
dīrghaviśvavedasakaivalyadīpikāf. Name of work View this entry on the original dictionary page scan.
dīrghervārum. a kind of cucumber (equals ḍaṅgari-) View this entry on the original dictionary page scan.
divaḥśyef. Name of particular sacrifices, View this entry on the original dictionary page scan.
divāsaṃketam. appointment (of lovers) by day View this entry on the original dictionary page scan.
divaseśvaram. "day-lord", the sun View this entry on the original dictionary page scan.
divodāseśvaraliṅgan. Name of a liṅga-
divyadeham. a divine body View this entry on the original dictionary page scan.
divyadef. Name of a goddess View this entry on the original dictionary page scan.
divyarasendrasāram. Name of work View this entry on the original dictionary page scan.
divyasraganulepinmfn. adorned with divine garlands and unguents View this entry on the original dictionary page scan.
divyatejasn. a kind of plant View this entry on the original dictionary page scan.
divyelakam. a kind of serpent (equals devyaka-?). View this entry on the original dictionary page scan.
doḥśekharan. "arm-top", shoulder View this entry on the original dictionary page scan.
dolāyātrāvivekam. Name of work View this entry on the original dictionary page scan.
doṣabhedam. a particular disease of the 3 humours View this entry on the original dictionary page scan.
doṣabhedīyamfn. relating to it View this entry on the original dictionary page scan.
doṣākleśīf. "fading in the evening", a kind of plant View this entry on the original dictionary page scan.
drākkendran. eccentricity, the distance of a planet from the point of its greatest velocity View this entry on the original dictionary page scan.
drākṣārāmeśvara(kṣār-) m. "lord of the vineyard", Name of śiva- View this entry on the original dictionary page scan.
drauṇeyan. a kind of salt View this entry on the original dictionary page scan.
draupadeyam. plural metron. of the 5 sons of draupadī- (viz. of prativindhya-, son of yudhi-ṣṭhira-;of suta-soma-, son of bhīma-;of śruta-kīrti- or śrutakarman-, son of arjuna-;of śatānīka-, son of nakula-;and of śruta-sena-, son of sahadeva-) View this entry on the original dictionary page scan.
dravasvedam. a hot bath View this entry on the original dictionary page scan.
dravetaramfn. "other than fluid", hard, solid, congealed View this entry on the original dictionary page scan.
draviḍadeśam. the country of the Dravidians View this entry on the original dictionary page scan.
draviḍadeśīyamfn. coming from or born in it View this entry on the original dictionary page scan.
drāviḍavedapārāyaṇapramāṇan. Name of work. View this entry on the original dictionary page scan.
draviḍopaniṣacchekharam. Name of work relating to draviḍopaniṣad- View this entry on the original dictionary page scan.
draviṇendrātmajam. kubera-'s son, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
draviṇeśvaram. equals ṇādhipati- View this entry on the original dictionary page scan.
draviṇeśvaram. possessor of wealth View this entry on the original dictionary page scan.
dravyadevatāf. the deity of a substance View this entry on the original dictionary page scan.
dravyaguṇavivekam. Name of work View this entry on the original dictionary page scan.
dravyasamuddeśam. Name of chapter of the vākyapādīya-. View this entry on the original dictionary page scan.
dṛḍhanemim. Name of a prince (son of śatya-dhṛti-) View this entry on the original dictionary page scan.
dṛḍhanetram. "strong-eyed", Name of a son of viśvā-mitra- View this entry on the original dictionary page scan.
dṛḍhasenam. "having a strong army", Name of a prince View this entry on the original dictionary page scan.
dṛḍhavedhanan. piercing strongly View this entry on the original dictionary page scan.
dṛḍhekṣurāf. Eleusine Indica View this entry on the original dictionary page scan.
dṛḍheṣudhim. "having a strong quiver", Name of a prince View this entry on the original dictionary page scan.
dṛḍheyum. Name of one of the 7 sages of the west View this entry on the original dictionary page scan.
drek cl.1 A1. drekate-, to sound ; to be in high spirits ; to grow or increase (see dhrek-). View this entry on the original dictionary page scan.
dref. Melia Sempervifrens View this entry on the original dictionary page scan.
drekkaor drekkāṇa- or dreṣkāṇa- equals dṛkāna- View this entry on the original dictionary page scan.
dreṣkāṇādhyāyam. Name of chapter of View this entry on the original dictionary page scan.
dreśyamfn. (prob. fr. dris.- equals dṛ-) visible View this entry on the original dictionary page scan.
dreśyamfn. see a--. View this entry on the original dictionary page scan.
dṛgdṛśyavivekam. Name of work View this entry on the original dictionary page scan.
dṛkkṣepam. the sine of the zenith-distance of the highest or central point of the ecliptic at a given time View this entry on the original dictionary page scan.
dṛmicaṇḍeśvaran. Name of a liṅga- (varia lectio kṛm-). View this entry on the original dictionary page scan.
droṇamegham. a kind of cloud (See above) View this entry on the original dictionary page scan.
droṇeyan. equals ṇī-lavaṇa- View this entry on the original dictionary page scan.
dṛśenyamfn. equals d/ṛśīka- View this entry on the original dictionary page scan.
dṛṣṭikṣepam. casting glances View this entry on the original dictionary page scan.
dṛṣṭisambhedam. "mixing glances", mutual glance View this entry on the original dictionary page scan.
dṛṣṭivikṣepam. equals -kṣepa- View this entry on the original dictionary page scan.
dṛśyetaramfn. "other than visible", invisible View this entry on the original dictionary page scan.
dṛśyetaratāf. View this entry on the original dictionary page scan.
drumābjaketum. "having the sign of a tree and a lotus", the moon, ibidem or 'in the same place or book or text' as the preceding v, 3. View this entry on the original dictionary page scan.
drumacchedaprāyaścittan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
drumasenam. Name of a king (identified with the asura- gaviṣṭha-) View this entry on the original dictionary page scan.
drumaśreṣṭham. "the best of trees", Name of the palm-tree (equals tāla-) View this entry on the original dictionary page scan.
drumeśvaram. "tree-king", the pārijāta- View this entry on the original dictionary page scan.
drumeśvaram. the palm-tree View this entry on the original dictionary page scan.
drumeśvaram. Name of the Moon View this entry on the original dictionary page scan.
drutamerum. (in music) a kind of measure. View this entry on the original dictionary page scan.
dugdhapef. a kind of Curcuma View this entry on the original dictionary page scan.
dugdhaphenam. the froth of milk, cream View this entry on the original dictionary page scan.
dugdhaphef. a kind of small shrub (equals gojā-parṇī-, payaḥ-phenī-,etc.) View this entry on the original dictionary page scan.
duḥkhabheṣajamf(ī-)n. healing woe (kṛṣṇa-) View this entry on the original dictionary page scan.
duḥkhacchedyamfn. to be cut or overcome with difficulty View this entry on the original dictionary page scan.
duḥkhavegam. a violent grief. View this entry on the original dictionary page scan.
duḥkhetamfn. affected with sorrow, Va1rtt. 6, View this entry on the original dictionary page scan.
duḥkhocchedyamfn. equals duḥkha-cch- (varia lectio) View this entry on the original dictionary page scan.
duḥkhopahatacetasmfn. having the heart stricken with sorrow View this entry on the original dictionary page scan.
duḥkhopetamfn. affected by pain, suffering distress View this entry on the original dictionary page scan.
duḥsaṃdheyamfn. idem or 'mfn. difficult to be united ' View this entry on the original dictionary page scan.
duḥśevamfn. envious, malignant View this entry on the original dictionary page scan.
duḥsevyamfn. difficult to be managed, intractable View this entry on the original dictionary page scan.
duḥstheyamfn. difficult to be stood View this entry on the original dictionary page scan.
duḥstheyan. difficult standing View this entry on the original dictionary page scan.
dulayate equals dur-ayate- See dur-i- under 2. dur-. View this entry on the original dictionary page scan.
dumelan. and particular high number View this entry on the original dictionary page scan.
dūrabhedam. the act of piercing from a distance View this entry on the original dictionary page scan.
durādeyamfn. difficult to be taken away or seized View this entry on the original dictionary page scan.
duradhyeyamfn. difficult to be studied or learnt View this entry on the original dictionary page scan.
duradhyeyatvan. View this entry on the original dictionary page scan.
durāneyamfn. difficult to be brought near
durantadevam. the god who removes difficulties (gaṇeśa-) View this entry on the original dictionary page scan.
duranuneyamfn. difficult to be won over View this entry on the original dictionary page scan.
duranuneyatāf. View this entry on the original dictionary page scan.
duranuṣṭheyamfn. difficult to perform View this entry on the original dictionary page scan.
duranveṣyamfn. difficult to be searched out or through View this entry on the original dictionary page scan.
dūrāpetamfn. not even distantly to be thought of, quite out of the question View this entry on the original dictionary page scan.
dūrāpetatvan. commentator or commentary View this entry on the original dictionary page scan.
durāsevamfn. difficult to be dealt with or associated with View this entry on the original dictionary page scan.
dūratareind. Comparative degree , some way from (ablative) View this entry on the original dictionary page scan.
dūratareṇaind. Comparative degree View this entry on the original dictionary page scan.
duratyetumfn. equals -atikrama- View this entry on the original dictionary page scan.
duravalepam. disagreeable arrogance View this entry on the original dictionary page scan.
dūravedham. the act of striking from afar View this entry on the original dictionary page scan.
dūravedhinmfn. piercing from afar (as a missile, weapon) View this entry on the original dictionary page scan.
duravekṣitan. an improper look, a forbidden glance View this entry on the original dictionary page scan.
durbalendriyamfn. having feeble (id est unrestrained) organs of sense View this entry on the original dictionary page scan.
durbheda mfn. equals -bhida- View this entry on the original dictionary page scan.
durbhedyamfn. equals -bhida- View this entry on the original dictionary page scan.
durdeśam. a bad or unwholesome place View this entry on the original dictionary page scan.
durdeśajamfn. coming from it (water) View this entry on the original dictionary page scan.
durdyūtadevinmfn. playing unfairly, cheating at play View this entry on the original dictionary page scan.
durdyūtavedinm. (prob. wrong reading for devin-) Name of śakuni- View this entry on the original dictionary page scan.
dūreind. ( ) in a distant place, far, far away (opp. /anti-) and c (opp. antike-) etc. View this entry on the original dictionary page scan.
dūreind. -kṛ- to discard View this entry on the original dictionary page scan.
dūreind. -bhū- to be far away or gone off View this entry on the original dictionary page scan.
dūreind. -gam- to be far away or gone off View this entry on the original dictionary page scan.
dūreind. re tiṣṭhatu-, let it be far id est let it be unmentioned, never mind View this entry on the original dictionary page scan.
dūre locative case of dūra- (q.v) in compound View this entry on the original dictionary page scan.
dūreamitra(r/e--) mfn. whose enemies are far away View this entry on the original dictionary page scan.
dūreantamfn. ending in the remote distance, boundless (heaven and earth) View this entry on the original dictionary page scan.
dūreartha(r/e--) mfn. whose aim is far off View this entry on the original dictionary page scan.
dūrebāndhavam. a distant kinsman View this entry on the original dictionary page scan.
dūrebhā(r/e--) mfn. shining to a distance View this entry on the original dictionary page scan.
dūrecaramfn. going or being far, distant View this entry on the original dictionary page scan.
dūredevatamfn. having far distant divinities, View this entry on the original dictionary page scan.
dūredṛśmfn. visible far and wide View this entry on the original dictionary page scan.
dūregavyūti(r/e--) mfn. whose domain is or reaches far View this entry on the original dictionary page scan.
dūrehetimfn. (r/e--) whose arrows fly to a distance View this entry on the original dictionary page scan.
dūrehetim. a particular form of agni- commentator or commentary View this entry on the original dictionary page scan.
dūrejanāntanilayamfn. living far away from men View this entry on the original dictionary page scan.
dūreṇaind. () far, from afar, by far etc. View this entry on the original dictionary page scan.
dūrepānīyagocaramfn. having remote watering places (said of animals) View this entry on the original dictionary page scan.
dūrepaśyāf. "far-seeing", Name of an apsaras- View this entry on the original dictionary page scan.
dūreritekṣaṇamfn. "who sends his glances far apart", squint-eyed View this entry on the original dictionary page scan.
dūreśravasmfn. far-renowned (see ra-śr-) View this entry on the original dictionary page scan.
dūreśravasm. Name of a man (See daureśravasa-). View this entry on the original dictionary page scan.
dūreśrutam. Name of a man (see daure--). View this entry on the original dictionary page scan.
dūreṣupātinmfn. shooting arrows to a distance View this entry on the original dictionary page scan.
dūretyamfn. being far off, distant Va1rtt. 1 View this entry on the original dictionary page scan.
durevamfn. ill-disposed, malignant View this entry on the original dictionary page scan.
durevam. evildoer, criminal View this entry on the original dictionary page scan.
dūrevadhamfn. far-striking View this entry on the original dictionary page scan.
dūreyamamfn. one from whom yama- is distant View this entry on the original dictionary page scan.
durgadeśam. an impassable region View this entry on the original dictionary page scan.
durgāsaṃdehabhedikāf. Name of work
durgasenam. Name of an author View this entry on the original dictionary page scan.
durjanamukhacapeṭikāf. Name of work View this entry on the original dictionary page scan.
durjanamukhamahācapeṭikāf. Name of work View this entry on the original dictionary page scan.
durjeyamfn. difficult to be conquered View this entry on the original dictionary page scan.
durjñeyamfn. difficult to be understood or found out View this entry on the original dictionary page scan.
durjñeyam. Name of śiva- View this entry on the original dictionary page scan.
durlekhyan. a false or forged document View this entry on the original dictionary page scan.
durmedhamfn. dull-witted, stupid, ignorant etc. View this entry on the original dictionary page scan.
durmedhasmfn. () dull-witted, stupid, ignorant etc. View this entry on the original dictionary page scan.
durmedhastvan. foolishness, stupidity View this entry on the original dictionary page scan.
durmedhāvinmfn. equals -medha- View this entry on the original dictionary page scan.
durmedhāvinmfn. equals -medha- View this entry on the original dictionary page scan.
durnarendram. a miserable sorcerer or conjurer View this entry on the original dictionary page scan.
durniṣedhamfn. difficult to be warded off View this entry on the original dictionary page scan.
durnivedyamfn. difficult to be related View this entry on the original dictionary page scan.
durnivedyatvan. View this entry on the original dictionary page scan.
durucchedamfn. difficult to be extirpated or destroyed View this entry on the original dictionary page scan.
durucchedyamfn. idem or 'mfn. difficult to be extirpated or destroyed ' View this entry on the original dictionary page scan.
durucchedyamfn. difficult to be cut through (knot) View this entry on the original dictionary page scan.
durupadeśam. bad instruction View this entry on the original dictionary page scan.
durvāseśvaran. Name of a liṅga- View this entry on the original dictionary page scan.
durvedamfn. (1. -vid-) having bad or little knowledge, ignorant View this entry on the original dictionary page scan.
durvedamfn. difficult to be known View this entry on the original dictionary page scan.
durvedamfn. (3. vid-) difficult to be found View this entry on the original dictionary page scan.
dūrveṣṭakāf. Durb grass used like bricks in erecting an altar View this entry on the original dictionary page scan.
durviceṣṭamfn. ill-behaved View this entry on the original dictionary page scan.
durvijñeyamfn. hardly conceivable, unintelligible, View this entry on the original dictionary page scan.
durvirecyamfn. difficult to be purged View this entry on the original dictionary page scan.
durvivecanamfn. difficult to be judged or decided on View this entry on the original dictionary page scan.
duśceṣṭāf. misconduct, error, K. View this entry on the original dictionary page scan.
duśceṣṭitan. idem or 'f. misconduct, error, K.' View this entry on the original dictionary page scan.
duśceṣṭitamfn. misbehaving, doing evil View this entry on the original dictionary page scan.
duṣkalevaran. "the bad or miserable body" View this entry on the original dictionary page scan.
duṣpeṣaṇamfn. difficult to be pounded or crushed commentator or commentary View this entry on the original dictionary page scan.
duṣpraveśamfn. difficult to be entered View this entry on the original dictionary page scan.
duṣpraveśamfn. difficult to be introduced View this entry on the original dictionary page scan.
duṣpraveśāf. a species of Opuntia View this entry on the original dictionary page scan.
duṣprekṣa mfn. difficult to be looked at, disagreeable to the sight View this entry on the original dictionary page scan.
duṣprekṣaṇīya mfn. difficult to be looked at, disagreeable to the sight View this entry on the original dictionary page scan.
duṣprekṣitamfn. badly looked at View this entry on the original dictionary page scan.
duṣprekṣyamfn. difficult to be looked at, disagreeable to the sight View this entry on the original dictionary page scan.
duṣṭacetasmfn. evil-minded, malevolent View this entry on the original dictionary page scan.
dūtasampreṣaṇan. the sending forth ambassadors View this entry on the original dictionary page scan.
dvādaśamāsadeyadānaratnākaram. Name of work View this entry on the original dictionary page scan.
dvaitavivekam. Name of work View this entry on the original dictionary page scan.
dvaṃdveind. dvaṃdva
dvaṃdvenaind. dvaṃdva
dvārakāpraveśam. "entrance into dvārakā-"Name of chapter 103, of View this entry on the original dictionary page scan.
dvārakeśam. "lord of dvārakā-", Name of kṛṣṇa- View this entry on the original dictionary page scan.
dvātriṃśailakṣaṇopetamfn. () "having 32 auspicious marks upon the body", illustrious, great. View this entry on the original dictionary page scan.
dvedhāind. (fr. dvaya-; see tre-dhā-) in two parts or ways, twice View this entry on the original dictionary page scan.
dvedhākāramind. changing into two View this entry on the original dictionary page scan.
dvedhākriyāf. breaking or splitting in two View this entry on the original dictionary page scan.
dvedhākṛtamfn. broken in two View this entry on the original dictionary page scan.
dvedhīind. in two, asunder View this entry on the original dictionary page scan.
dvedhīkṛtamfn. View this entry on the original dictionary page scan.
dveṣam. hatred, dislike, repugnance, enmity to (compound) etc. (ṣaṃ-kṛ-,to show enmity against(dative case) ) . View this entry on the original dictionary page scan.
dveṣaetc. See above. View this entry on the original dictionary page scan.
dveṣakalpam. a ceremony intended to cause injury to an enemy, View this entry on the original dictionary page scan.
dveṣaṇamfn. hating, disliking View this entry on the original dictionary page scan.
dveṣaṇamfn. foe, enemy View this entry on the original dictionary page scan.