Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Grammar Search
"asi" has 2 results
asi: feminine vocative singular stem: asi
asi: second person singular present present class 2 parasmaipadaas
Amarakosha Search
27 results
arhitaḥ3.1.102MasculineSingularnamasyitam, namasim, apacāyitam, arcitam, apacitam
bandhanam3.4.14NeuterSingularprasitiḥ, cāraḥ
bhakṣitaḥMasculineSingularglastam, annam, khāditam, liptam, bhuktam, grastam, abhyavahṛtam, gilitam, carvitam, aśitam, jagdham, psātam, pratyasitam
bhūtiḥ1.1.59-60Ubhaya-lingaSingularbhasma, kṣāraḥ, rakṣā, bhasitamash
buddham3.1.110MasculineSingularmanitam, viditam, pratipannam, avasitam, avagatam, budhitam
churikā2.8.93FeminineSingularśastrī, asiputrī, asidhenukā
dhānyam2.9.24MasculineSingularṛddham, ‍āvasitam
gṛham2.2.4-5NeuterSingularagāram, vastyam, sadma, geham, ālayaḥ, gṛhāḥ, bhavanam, niśāntam, veśma, nilayaḥ, mandiram, sadanam, niketanam, udavasitam, nikāyyaḥ
khaḍgaḥ2.8.90MasculineSingularkṛpāṇaḥ, asi, riṣṭiḥ, kaukṣethakaḥ, maṇḍalāgraḥ, nistriṃśaḥ, karavālaḥ, candrahāsaḥ
kṛṣṇaḥMasculineSingularśyāmaḥ, kālaḥ, śyāmalaḥ, mecakaḥ, nīlaḥ, asitaḥblack or dark blue
kuśam3.3.224NeuterSingularsāhasikaḥ, kaṭhoraḥ, avasṛṇaḥ
madaḥ3.3.98MasculineSingularsthānam, lakṣma, aṅghri, vastu, vyavasitiḥ, trāṇam
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketanaḥ, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
praphullaḥMasculineSingularvikacaḥ, sphuṭaḥ, phullaḥ, utphullaḥ, vikasitaḥ, saṃphullaḥ, vyākośaḥ
śākyamuniḥ1.1.14-15MasculineSingularsarvārthasiddhaḥ, śauddhodaniḥ, gautamaḥ, arkabandhuḥ, māyādevīsutaḥ, śākyasiṃhaḥbuddha
stanitam1.3.8NeuterSingularmeghanirghoṣaḥ, rasitam, garjitamthe rattling of thunder
tatparaḥ3.1.7MasculineSingularprasitaḥ, āsaktaḥ
vihasitamNeuterSingulara laugh
prasiddhaḥ3.3.111MasculineSingularśailaḥ, pāṣāṇaḥ
Monier-Williams Search
1234 results for asi
asim. (2. as-), a sword, scimitar, knife (used for killing animals) etc. View this entry on the original dictionary page scan.
asif. Name of a river (near Benares) (confer, compare asī-) ; [ Latin ensi-s.] View this entry on the original dictionary page scan.
asim. (also) a shark, alligator, View this entry on the original dictionary page scan.
asibaddhamfn. girt with a dagger or sword, View this entry on the original dictionary page scan.
asicaryāf. exercise or practice of arms View this entry on the original dictionary page scan.
asidaṃṣṭra m. "having swords for fangs", the marine monster makara- (painted on the banner of kāmadeva-) View this entry on the original dictionary page scan.
asidaṃṣṭrakam. "having swords for fangs", the marine monster makara- (painted on the banner of kāmadeva-) View this entry on the original dictionary page scan.
asiddhamfn. imperfect, incomplete : unaccomplished, uneffected View this entry on the original dictionary page scan.
asiddhamfn. unproved View this entry on the original dictionary page scan.
asiddhamfn. (regarded as) not existing or (as) not having taken effect (as a rule or operation taught in grammar) View this entry on the original dictionary page scan.
asiddhamfn. not possessed of magic power. View this entry on the original dictionary page scan.
asiddhāntam. not an incontestable dogma View this entry on the original dictionary page scan.
asiddhārthamfn. who has not effected his aim View this entry on the original dictionary page scan.
asiddhif. imperfect accomplishment, failure
asiddhif. (in logic) want of proof, conclusion not warranted by the premises View this entry on the original dictionary page scan.
asiddhif. (in sāṃkhya- philosophy) incompleteness (eight forms of it are enumerated) View this entry on the original dictionary page scan.
asiddhidamfn. not giving success View this entry on the original dictionary page scan.
asidharam. Name of a man View this entry on the original dictionary page scan.
asidhārāf. the blade of a sword etc. View this entry on the original dictionary page scan.
asidhārāpatham. equals asi-path/a- q.v , View this entry on the original dictionary page scan.
asidhārāvratan. an exceedingly difficult task View this entry on the original dictionary page scan.
asidhāva m. a sword- or tool-cleaner, armourer View this entry on the original dictionary page scan.
asidhāvakam. a sword- or tool-cleaner, armourer View this entry on the original dictionary page scan.
asidhenuf. a (small) knife View this entry on the original dictionary page scan.
asidhenukāf. idem or 'f. a (small) knife '
asigaṇḍam. equals kṣudropadhāna- (for kṣurop-?) View this entry on the original dictionary page scan.
asihatyan. fighting with swords (or knives), (gaRa anuśatikādi- q.v) View this entry on the original dictionary page scan.
asihetim. a swordsman or soldier armed with a sword View this entry on the original dictionary page scan.
asijalan. blood dripping from a sword, View this entry on the original dictionary page scan.
asijihvam. "sword-tongued", Name (also title or epithet) of an asura-, View this entry on the original dictionary page scan.
asikan. the part of the face between the underlip and the chin View this entry on the original dictionary page scan.
asikam. plural Name of a people (varia lectio aśika-). View this entry on the original dictionary page scan.
asiknīVed. f. of 2. /asita- q.v View this entry on the original dictionary page scan.
asiknīf. "the dark one", the night View this entry on the original dictionary page scan.
asiknīf. a girl attending in the women's apartments View this entry on the original dictionary page scan.
asiknīf. Name of a wife of dakṣa- View this entry on the original dictionary page scan.
asiknīf. Name of the river Akesines (afterwards called candra-bhāgā-) in the Panjab (asikn/ī-) View this entry on the original dictionary page scan.
asiknikāf. (equals asiknī- q.v) a girl attending in the women's apartments View this entry on the original dictionary page scan.
asilatāf. the blade of a sword View this entry on the original dictionary page scan.
asilomanm. Name of a dānava- View this entry on the original dictionary page scan.
asimārgam. plural the various ways of handling a sword, View this entry on the original dictionary page scan.
asimatmfn. furnished with knives or daggers View this entry on the original dictionary page scan.
asimedam. the fetid Mimosa (Vachellia Farnesiana) (see ahi-māra-,etc.) View this entry on the original dictionary page scan.
asinvamf(-)n. insatiable View this entry on the original dictionary page scan.
asinvatmfn. idem or 'mf(-)n. insatiable ' View this entry on the original dictionary page scan.
asipāṇimfn. having a sword in one's hand View this entry on the original dictionary page scan.
asipatham. the course of the sword or knife that kills View this entry on the original dictionary page scan.
asipattran. the blade of a sword View this entry on the original dictionary page scan.
asipattram. "having sword-shaped leaves", the sugar-cane (Scirpus Kysoor Roxb.) View this entry on the original dictionary page scan.
asipattram. "paved with swords", Name of a hell View this entry on the original dictionary page scan.
asipattrakam. the sugar-cane View this entry on the original dictionary page scan.
asipattravanan. Name of a hell etc. View this entry on the original dictionary page scan.
asipattravratan. equals asidhārā-vrata- q.v View this entry on the original dictionary page scan.
asipattravṛkṣam. a kind of tree in the lower world [Comm.] View this entry on the original dictionary page scan.
asiplavam. a kind of porpoise, View this entry on the original dictionary page scan.
asipucchakam. the Gangetic porpoise (Delphinus Gangeticus). View this entry on the original dictionary page scan.
asiputrīf. "daughter of a sword", a (small) knife View this entry on the original dictionary page scan.
asiputrikā f. "daughter of a sword", a (small) knife View this entry on the original dictionary page scan.
asiram. (2. as-),"an arrow", a beam, ray View this entry on the original dictionary page scan.
asiśimbīf. Name of a vegetable View this entry on the original dictionary page scan.
asiṣṭhamfn. (superl.) most skilful in shooting (arrows, etc.) View this entry on the original dictionary page scan.
asisūnāf. (= sūnā-), View this entry on the original dictionary page scan.
asitamfn. unbound View this entry on the original dictionary page scan.
asitamf(ā-;Ved. /asiknī-)n. (sita-,"white", appears to have been formed from this word, which is probably original, and not a compound of a-and sita-; see asura-and sura-), dark-coloured, black etc. View this entry on the original dictionary page scan.
asitam. the planet Saturn View this entry on the original dictionary page scan.
asitam. a poisonous animal (said to be a kind of mouse) View this entry on the original dictionary page scan.
asitam. Name of the lord of darkness and magic View this entry on the original dictionary page scan.
asitam. of a descendant of kaśyapa- (composer of ), named also devala- ([ ]) or asita- devala- ([ ]) View this entry on the original dictionary page scan.
asitam. Name of a man (with the patron. vārṣagaṇa-) View this entry on the original dictionary page scan.
asitam. of a son of bharata- View this entry on the original dictionary page scan.
asitam. of a ṛṣi- View this entry on the original dictionary page scan.
asitam. of a mountain View this entry on the original dictionary page scan.
asitam. a black snake View this entry on the original dictionary page scan.
asitam. a mantra- (saving from snakes) View this entry on the original dictionary page scan.
asif. a girl attending in the women's apartments (whose hair is not whitened by age) View this entry on the original dictionary page scan.
asitam. the indigo plant View this entry on the original dictionary page scan.
asitam. Name of an apsaras- View this entry on the original dictionary page scan.
asita2 m. (also) the dark half of a lunar month, View this entry on the original dictionary page scan.
asitaa particular intoxicating drink, View this entry on the original dictionary page scan.
asitābhraśekharam. Name of a buddha- View this entry on the original dictionary page scan.
asitabhrūmfn. having black eyelids. View this entry on the original dictionary page scan.
asitadrumam. the tree Xanthochymus Pictorius View this entry on the original dictionary page scan.
asitagatim. "having a black course", fire (- dyuti-,"shining like fire"), View this entry on the original dictionary page scan.
asitagrīvamfn. (/asita--) having a black neck () View this entry on the original dictionary page scan.
asitagrīvam. a peacock View this entry on the original dictionary page scan.
asitajānumfn. having black knees View this entry on the original dictionary page scan.
asitajñumf(Nominal verb -jñ/ūs-)n. idem or 'mfn. having black knees ' View this entry on the original dictionary page scan.
asitakeśāntamfn. having black locks View this entry on the original dictionary page scan.
asitākṣamf(ī-)n. equals asita-nayana- q.v View this entry on the original dictionary page scan.
asitālam. Name (also title or epithet) of a plant (from which the shafts of arrows are made), View this entry on the original dictionary page scan.
asitālum. Name of a plant View this entry on the original dictionary page scan.
asitāmburuham. the black lotus View this entry on the original dictionary page scan.
asitamṛgam. Name of a ṛṣi- of the View this entry on the original dictionary page scan.
asitamṛgam. plural his descendants View this entry on the original dictionary page scan.
asitamuṣkakam. the plant Schrebera Swietenioides View this entry on the original dictionary page scan.
asitānanam. a black-faced monkey, View this entry on the original dictionary page scan.
asitanayanamfn. black-eyed. View this entry on the original dictionary page scan.
asitāṅgam. a form of śiva- (especially mentioned in tantra-s) View this entry on the original dictionary page scan.
asitapucchakam. "having a black tail", Name of an animal (see kāla-pucchaka-.) View this entry on the original dictionary page scan.
asitaratnan. a sapphire, View this entry on the original dictionary page scan.
asitārcism. fire View this entry on the original dictionary page scan.
asitaskandham. a kind of amulet, View this entry on the original dictionary page scan.
asitāśmanm. the lapis lazuli View this entry on the original dictionary page scan.
asitavarṇa(/asita--) mfn. dark-coloured View this entry on the original dictionary page scan.
asitavartmanm. "having a black path (of smoke)", agni- View this entry on the original dictionary page scan.
asitekṣaṇamfn. blackeyed, View this entry on the original dictionary page scan.
asitodan. (id est saras-) Name of a mythical lake View this entry on the original dictionary page scan.
asitopalam. equals asitāśman- q.v View this entry on the original dictionary page scan.
asitotpalam. the blue lotus View this entry on the original dictionary page scan.
asiyaṣṭif. equals -latā- q.v View this entry on the original dictionary page scan.
asiyaṣṭif. (Prakritasi-laTThi) View this entry on the original dictionary page scan.
abhīṣṭasiddhif. the gaining a desired object.
abhyasitavyamfn. to be practised commentator or commentary on View this entry on the original dictionary page scan.
abhyupagamasiddhāntam. an admitted axiom View this entry on the original dictionary page scan.
abrahmavarcasinm. not an excellent theologian, View this entry on the original dictionary page scan.
adhikaraṇasiddhāntam. a syllogism or conclusion which involves others, etc. View this entry on the original dictionary page scan.
adhyavasitamfn. ascertained, determined, apprehended. View this entry on the original dictionary page scan.
adhyavasitif. exertion, effort. View this entry on the original dictionary page scan.
advaitabrahmasiddhif. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ajayasiṃham. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
alasibhūto become tired View this entry on the original dictionary page scan.
amarasiṃham. "god-lion", Name of a renowned lexicographer (probably of the sixth century A.D.;he was a Buddhist, and is said to have adorned the court of vikramāditya-, being included among the nine gems). View this entry on the original dictionary page scan.
āmbhasikamfn. living in water, aquatic View this entry on the original dictionary page scan.
āmbhasikam. a fish commentator or commentary on View this entry on the original dictionary page scan.
amoghasiddhim. Name of the fifth dhyānibuddha-. View this entry on the original dictionary page scan.
anadhyavasitamfn. irresolute, View this entry on the original dictionary page scan.
anavasitamfn. not set, not terminated View this entry on the original dictionary page scan.
anavasif. Name of a species of the triṣṭubh- metre (consisting of four lines with eleven feet in each). View this entry on the original dictionary page scan.
āndhasikamfn. (fr. 2. andhas-), cooking View this entry on the original dictionary page scan.
āndhasikam. a cook View this entry on the original dictionary page scan.
aniyasitamfn. relaxed, View this entry on the original dictionary page scan.
anubhavasiddhamfn. established by experience or perception. View this entry on the original dictionary page scan.
anuktasiddhif. (in dramatic language) a veiled or indirect compliment, View this entry on the original dictionary page scan.
anurasitan. echo View this entry on the original dictionary page scan.
anuttamāmbhasikan. indifference to and abstinence from sensual enjoyment (as involving injury to external objects). View this entry on the original dictionary page scan.
anuvasitamfn. dressed up, wrapped. View this entry on the original dictionary page scan.
anvavasitamfn. seized by View this entry on the original dictionary page scan.
apahasitan. silly or causeless laughter View this entry on the original dictionary page scan.
apahasitan. (also) smiling in tears, View this entry on the original dictionary page scan.
apasiddhāntam. an assertion or statement opposed to orthodox teaching or to settled dogma View this entry on the original dictionary page scan.
apasidh(Imper. 2. sg. -s/edha-,or -s/edha-,3. sg. -sedhatu-,3. plural -sedhantu-; pr. p. -s/edhat-) to ward off, remove, drive away View this entry on the original dictionary page scan.
aprasiddhamfn. not settled, unestablished View this entry on the original dictionary page scan.
aprasiddhamfn. unknown, uncelebrated View this entry on the original dictionary page scan.
aprasiddhamfn. unusual, uncommon, of no real existence, not current, not generally known. View this entry on the original dictionary page scan.
aprasiddhapadan. an obsolete word. View this entry on the original dictionary page scan.
ārambhasiddhif. Name of work View this entry on the original dictionary page scan.
araṇyadvādasif. the twelfth day of the month mārgaśīrṣa- View this entry on the original dictionary page scan.
araṇyadvādasif. with or without -vrata- n. Name of a ceremony performed on this day View this entry on the original dictionary page scan.
arasikamfn. devoid of taste, unfeeling, dull. View this entry on the original dictionary page scan.
ārasitan. roaring, screaming View this entry on the original dictionary page scan.
arjunasiṃham. Name of a prince View this entry on the original dictionary page scan.
arśasinmfn. equals arśasa- View this entry on the original dictionary page scan.
arthasiddhamfn. clear in itself. self-evident View this entry on the original dictionary page scan.
arthasiddham. Name of the tenth day of the karma-māsa-, View this entry on the original dictionary page scan.
arthasiddham. Name of śākyamuni- in one of his previous births (as a bodhisattva-).
arthasiddhakam. the plant Vitex Negundo View this entry on the original dictionary page scan.
arthasiddhif. acquisition of wealth View this entry on the original dictionary page scan.
arthasiddhif. success View this entry on the original dictionary page scan.
arthasiddhif. Name of a particular magical faculty View this entry on the original dictionary page scan.
arthasiddhim. Name of a son of puṣya- View this entry on the original dictionary page scan.
āryasiddhāntam. Name of work of āryabhaṭa-. View this entry on the original dictionary page scan.
āryasiṃham. Name of a Buddhist patriarch. View this entry on the original dictionary page scan.
asāhasikamf(ī-)n. not acting boldly or inconsiderately View this entry on the original dictionary page scan.
aśāstrasiddhamfn. not enjoined or established by the śāstra-s. View this entry on the original dictionary page scan.
asyasiind. sword against sword View this entry on the original dictionary page scan.
atasi /atka-. See sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
atasim. ( at-), a wandering mendicant View this entry on the original dictionary page scan.
atihasitan. excessive laughter. View this entry on the original dictionary page scan.
atihasitan. (in rhetoric) excessive or foolish laughter, View this entry on the original dictionary page scan.
atiprasiddhamfn. very notorious. View this entry on the original dictionary page scan.
atiśreyasim. a man superior to the most excellent woman. View this entry on the original dictionary page scan.
aṭṭahasitan. loud laughter, a horse-laugh. View this entry on the original dictionary page scan.
aujasikamfn. energetic, vigorous View this entry on the original dictionary page scan.
aupacchandasikamfn. (fr. upa-cchandas-), conformable to the veda-, Vedic View this entry on the original dictionary page scan.
aupacchandasikan. Name of a metre (consisting of four lines of alternately eleven and twelve syllabic instantsSee grammar 969).
aurasim. a descendant of uras- (?). View this entry on the original dictionary page scan.
aurasikamfn. like a breast gaRa aṅguly-ādi- View this entry on the original dictionary page scan.
aurdhvasrotasikam. (fr. ūrdhva-srotas-), a śaiva- (q.v) View this entry on the original dictionary page scan.
auṣasikamfn. walking out at daybreak View this entry on the original dictionary page scan.
auṣasikamfn. early, matutinal etc. View this entry on the original dictionary page scan.
avanāṭanasikamfn. flat-nosed View this entry on the original dictionary page scan.
avasic(parasmE-pada -siñcat-; ind.p. -sicya-) to sprinkle, pour upon (accusative or locative case) ; to pour out : Causal (Potential -secayet-) to sprinkle, bedew View this entry on the original dictionary page scan.
avasidh(imperfect tense avāsedhat- varia lectio apās-) to keep back or off from (ablative) View this entry on the original dictionary page scan.
avasiktamfn. sprinkled View this entry on the original dictionary page scan.
avasiñcitamfn. idem or 'mfn. sprinkled ' View this entry on the original dictionary page scan.
avasitamfn. one who has put up at any place, who dwells, rests, resides View this entry on the original dictionary page scan.
avasitamfn. brought to his abode (as agni-) View this entry on the original dictionary page scan.
avasitamfn. ended, terminated, finished, completed View this entry on the original dictionary page scan.
avasitamfn. one who has given up anything (ablative ;or in compound ) View this entry on the original dictionary page scan.
avasitamfn. determined, fixed View this entry on the original dictionary page scan.
avasitamfn. ascertained View this entry on the original dictionary page scan.
avasitamfn. known, understood View this entry on the original dictionary page scan.
avasitamfn. one who is determined to (locative case) View this entry on the original dictionary page scan.
avasitamfn. being at end of the line of a verse (See ava-s/āna-) View this entry on the original dictionary page scan.
avasitamfn. stored (as grain etc.) View this entry on the original dictionary page scan.
avasitamfn. gone View this entry on the original dictionary page scan.
avasitan. "a dwelling-place" See navāvasit/a-. View this entry on the original dictionary page scan.
āvasita equals avasita- (q.v) View this entry on the original dictionary page scan.
avasitakāryamfn. one who has finished what had to be done, satisfied, View this entry on the original dictionary page scan.
avasitamaṇḍanamfn. entirely adorned or dressed, View this entry on the original dictionary page scan.
avasitārthamfn. (= ta-- kārya-), View this entry on the original dictionary page scan.
avasitif. conclusion, end, View this entry on the original dictionary page scan.
avyavasitamfn. idem or 'mfn. inactive, negligent, remiss ' View this entry on the original dictionary page scan.
ayutasiddhamfn. (in philosophy) proved to be not separated (by the intervention of space), proved to be essentially united (as organic bodies, etc.) View this entry on the original dictionary page scan.
ayutasiddhif. establishing by proof that certain objects or ideas are essentially united and logically inseparable. View this entry on the original dictionary page scan.
bādhasiddhāntagranthakroḍam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthānugamam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthaprakāśam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthavivecanan. Name of work View this entry on the original dictionary page scan.
bālamallavenasiddhāntam. Name of work View this entry on the original dictionary page scan.
bālasiṃham. Name of a man View this entry on the original dictionary page scan.
bāṇasiddhif. the hitting of a mark by an arrow View this entry on the original dictionary page scan.
bhāgavatasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhairavasiṃham. Name of a son of narasiṃha- and patron of ruci-pati- View this entry on the original dictionary page scan.
bhaktasiktha m. equals -pulāka- View this entry on the original dictionary page scan.
bhaktasikthakam. equals -pulāka- View this entry on the original dictionary page scan.
bhaktirasāmṛtasindhum. Name of work View this entry on the original dictionary page scan.
bhasitamfn. reduced to ashes View this entry on the original dictionary page scan.
bhasitan. ashes View this entry on the original dictionary page scan.
bhāvasiṃham. Name of a king (also -deva-; see -vilāsa-) View this entry on the original dictionary page scan.
bhāvasiṃhaprakriyāf. Name of an elementary grammar. View this entry on the original dictionary page scan.
bhavasindhu() m. equals -jala-. View this entry on the original dictionary page scan.
bhīmasiṃham. () Name of poets. View this entry on the original dictionary page scan.
bhīmasiṃhapaṇḍitam. () Name of poets. View this entry on the original dictionary page scan.
bhramaṇavilasitan. Name of a metre (see bhramara-v-). View this entry on the original dictionary page scan.
bhramaravilasitamfn. hovered round by bees View this entry on the original dictionary page scan.
bhramaravilasitan. the hovering or sporting of bees View this entry on the original dictionary page scan.
bhramaravilasitan. Name of a metre View this entry on the original dictionary page scan.
bhṛgvaṅgirasif. the matrimonial union between the descendants of bhṛgu- and those of aṅgiras- View this entry on the original dictionary page scan.
bhūpasiṃham. Name of a man View this entry on the original dictionary page scan.
bisanasif. a kind of crane (see -kaṇṭhikā-). View this entry on the original dictionary page scan.
bodhaikasiddhif. Name of work View this entry on the original dictionary page scan.
bodhasiddhif. Name of work View this entry on the original dictionary page scan.
borasiddhif. Name of a place View this entry on the original dictionary page scan.
brahmasiddhāntam. Name of various astronomy works. (also brahmasiddhāntapaddhati -paddhati- f.) View this entry on the original dictionary page scan.
brāhmasiddhāntam. Name of work View this entry on the original dictionary page scan.
brahmasiddhāntapaddhatif. brahmasiddhānta
brahmasiddhim. Name of a muni- View this entry on the original dictionary page scan.
brahmasiddhim. of a vedānta- work View this entry on the original dictionary page scan.
brahmasiddhivyākhyāratnan. Name of a commentator or commentary on it. View this entry on the original dictionary page scan.
brahmasphuṭasiddhāntam. Name of an astronomy work by brahma-gupta- (also called brahma-siddhānta-): View this entry on the original dictionary page scan.
brahmatulyasiddhāntam. Name of work View this entry on the original dictionary page scan.
brahmāvabodhavivekasindhum. brahmāvabodha
brahmavarcasinmfn. eminent in sacred knowledge, holy (Comparative degree s/i-tara-) View this entry on the original dictionary page scan.
brahmayaśasinmfn. renowned for sanctity View this entry on the original dictionary page scan.
bṛhadvasiṣṭham. the larger vasiṣṭha-. View this entry on the original dictionary page scan.
buddhasiṃham. Name of a man View this entry on the original dictionary page scan.
caitasikamfn. relating to the mind (cetas-,as duties) View this entry on the original dictionary page scan.
camasif. equals -, a kind of cake View this entry on the original dictionary page scan.
camasinmfn. entitled to receive a camasa- (filled with soma-) View this entry on the original dictionary page scan.
camasinm. Name of a man gaRa 1. naḍādi-. View this entry on the original dictionary page scan.
canasitamfn. (Passive voice parasmE-pada fr. sya-) "satisfied, gracious"(only the vocative case is used in the address to a Brahman, added after his N. ) () View this entry on the original dictionary page scan.
canasitavatmfn. (speech or address) containing the word canasita-, View this entry on the original dictionary page scan.
canasitottaramfn. followed by canasita- (a N.) View this entry on the original dictionary page scan.
caṇḍasiṃham. Name of a prince View this entry on the original dictionary page scan.
candrajasiṃham. Name of a man. View this entry on the original dictionary page scan.
candrasiṃham. Name of a king (son of darpa-nārāyaṇa-) View this entry on the original dictionary page scan.
candrasiṃham. of a hero of kālikā- View this entry on the original dictionary page scan.
cāritrasiṃhagaṇim. Name of an author. View this entry on the original dictionary page scan.
caturvyavasitayamakan. a kind of yamaka- (in which the four quarters of a stanza are homophonous), View this entry on the original dictionary page scan.
catuṣpādasiddhif. complete knowledge of the 4 parts of medical science
chandasif. equals ndo-grantha-. View this entry on the original dictionary page scan.
chattrasinhan. Name of a tīrtha- View this entry on the original dictionary page scan.
cīnasicayam. a China or silken cloth View this entry on the original dictionary page scan.
cittacetasikam. thought View this entry on the original dictionary page scan.
dāmasiṃham. Name of a prince. View this entry on the original dictionary page scan.
ḍambarasiṃham. (with para-- mara-) Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
daṇḍālasif. equals ḍakālasaka- View this entry on the original dictionary page scan.
daśonasim. Name of View this entry on the original dictionary page scan.
daśonasim. a snake View this entry on the original dictionary page scan.
daurgasiṃhamf(ī-)n. belonging to or composed by durga-siṃha- View this entry on the original dictionary page scan.
dehasiddhisādhanan. Name of work View this entry on the original dictionary page scan.
devasiddhim. Name of a man View this entry on the original dictionary page scan.
devasiṃham. "god-lion", Name of śiva- View this entry on the original dictionary page scan.
devasiṃham. of an author View this entry on the original dictionary page scan.
devayaśasinmfn. of divine gods View this entry on the original dictionary page scan.
dharmasiṃham. "lion of virtue", Name of a man View this entry on the original dictionary page scan.
dharmasindhum. "ocean of law"Name of several works. View this entry on the original dictionary page scan.
dharmasindhusāram. "essence of the ocean of law", Name of work View this entry on the original dictionary page scan.
dharṇasimfn. idem or 'mfn. strong, powerful, able ' (a synonym of bala- ) View this entry on the original dictionary page scan.
dharṇasimfn. full of spirit (as soma-) View this entry on the original dictionary page scan.
dharṇasin. support View this entry on the original dictionary page scan.
dhṛtasiṃha varia lectio for ti-s-. View this entry on the original dictionary page scan.
dhruvasiddhim. "through whom cure is sure", Name of a physician View this entry on the original dictionary page scan.
dhvasiramfn. sprinkled, spattered, covered, (see dhūsara-). View this entry on the original dictionary page scan.
dīpasikhopaniṣadf. Name of an View this entry on the original dictionary page scan.
dravyasiddhif. acquirement of wealth View this entry on the original dictionary page scan.
dravyasiddhif. success by wealth View this entry on the original dictionary page scan.
dravyātmakāryasiddhif. effecting one's object by means of wealth View this entry on the original dictionary page scan.
droṇasiṃham. Name of a prince of the vallabhī- dynasty View this entry on the original dictionary page scan.
dugdhasindhum. idem or 'm. the sea of milk ' View this entry on the original dictionary page scan.
duravasitamfn. difficult to be ascertained, unfathomed View this entry on the original dictionary page scan.
durgasiṃha(for -s- ) m. Name of a grammarian and of an astronomer View this entry on the original dictionary page scan.
durgasiṃhīf. durga-siṃha-'s commentary on the kātantra-. View this entry on the original dictionary page scan.
durvilasitan. a wayward or rude or naughty trick, ill-mannered act View this entry on the original dictionary page scan.
durvyavasitan. an evil intention View this entry on the original dictionary page scan.
dvādaśasiddhāntam. Name of work on the vedānta-. View this entry on the original dictionary page scan.
dvaitanirṇayasiddhāntasaṃgraham. dvaitanirṇaya
dvaitasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
dvaitasiddhif. Name of work View this entry on the original dictionary page scan.
gadasiṃham. Name of an author View this entry on the original dictionary page scan.
gaganasiṃham. Name (also title or epithet) of a kacchapa-ghāta- king, View this entry on the original dictionary page scan.
gaganasindhuf. the heavenly gaṅgā- View this entry on the original dictionary page scan.
gajasiṃham. Name of an author of Prakrit verses View this entry on the original dictionary page scan.
gajasiṃham. of a prince View this entry on the original dictionary page scan.
gajasiṃhacaritran. Name of work View this entry on the original dictionary page scan.
gajaturaṃgavilasitan. Name of a metre (see ṛṣabha-gaja-v-.) View this entry on the original dictionary page scan.
gajavilasif. Name of a metre View this entry on the original dictionary page scan.
gayasiṃham. for gaja-s- (Name of a prince) View this entry on the original dictionary page scan.
gayasiṃharājacaritran. equals gajasiṃha-c-. View this entry on the original dictionary page scan.
ghanasikthaa kind of gruel View this entry on the original dictionary page scan.
ghasim. food kāṇva-) ii, 24'> (see ghās/i-.) View this entry on the original dictionary page scan.
govindasiṃham. Name of a prince View this entry on the original dictionary page scan.
govindasiṃham. Name of one of the ten chief guru-s of the Sikhs View this entry on the original dictionary page scan.
grāmasiṃham. "village-lion" equals mṛga- View this entry on the original dictionary page scan.
grasiṣṇumfn. accustomed to swallow or absorb View this entry on the original dictionary page scan.
grasiṣṭhamfn. (superl.) swallowing most View this entry on the original dictionary page scan.
gūḍhasiramfn. having the arteries hidden, View this entry on the original dictionary page scan.
gūḍhasiratāf. one of a buddha-'s marks, . View this entry on the original dictionary page scan.
haradattasiṃham. Name of a modern author View this entry on the original dictionary page scan.
harasiddhipradāf. Name of a particular family-deity View this entry on the original dictionary page scan.
harasiṃham. Name of a king View this entry on the original dictionary page scan.
haribhaktirasāmṛtasindhum. Name of work View this entry on the original dictionary page scan.
hariharabrahmamānasikasnānavidhim. Name of work View this entry on the original dictionary page scan.
harikṛṣṇasiddhāntam. Name of an author View this entry on the original dictionary page scan.
hasif. laughter, derision, jesting View this entry on the original dictionary page scan.
hasiram. a kind of mouse (see haṃsira-) View this entry on the original dictionary page scan.
hasitamfn. laughing, jesting, smiling View this entry on the original dictionary page scan.
hasitamfn. one who has laughed (m."he laughed"equals jahāsa-) View this entry on the original dictionary page scan.
hasitamfn. mocked, ridiculed, surpassed, excelled, View this entry on the original dictionary page scan.
hasitamfn. blown, expanded View this entry on the original dictionary page scan.
hasitan. laughing, laughter (also impersonal or used impersonally = "it has been laughed") etc. View this entry on the original dictionary page scan.
hasitan. the bow of kāma- (god of love) View this entry on the original dictionary page scan.
hasitṛmfn. one who laughs, a laugher, smiler View this entry on the original dictionary page scan.
hastasiddhif. earnings gained by manual labour, salary View this entry on the original dictionary page scan.
hastiyaśasihastivarcasinmfn. (?)having an elephant's magnificence and splendour View this entry on the original dictionary page scan.
hāyanasindhum. Name of work View this entry on the original dictionary page scan.
hemantasiṃham. Name of a king of karṇapūra- View this entry on the original dictionary page scan.
hemasiṃham. a throne of golden View this entry on the original dictionary page scan.
himasikharinm. "snow-mountain", the himālaya- View this entry on the original dictionary page scan.
holasiṃham. Name of a man View this entry on the original dictionary page scan.
horilasiṃham. Name of a man (perhaps equals prec.) View this entry on the original dictionary page scan.
hoturantevasinm. the pupil of a hotṛ- priest View this entry on the original dictionary page scan.
hrasimanm. shortness, smallness gaRa pṛthvādi-. View this entry on the original dictionary page scan.
hrasiṣṭhamfn. (superl. fr: hrasva-) shortest or smallest, very short or small View this entry on the original dictionary page scan.
hrasitamfn. shortened, curtailed, diminished View this entry on the original dictionary page scan.
hrasitamfn. sounded View this entry on the original dictionary page scan.
indrasiṃham. Name of a poetry or poetic View this entry on the original dictionary page scan.
iyasitamfn. shrunk View this entry on the original dictionary page scan.
iyasitan. shrinking View this entry on the original dictionary page scan.
jagatprasiddhamfn. known throughout the world View this entry on the original dictionary page scan.
jalamasim. "water-ink", a dark cloud View this entry on the original dictionary page scan.
jalasiktamfn. water-sprinkled View this entry on the original dictionary page scan.
janakasiṃham. Name of a man View this entry on the original dictionary page scan.
jayasiṃham. Name of a Kashmir king View this entry on the original dictionary page scan.
jayasiṃham. of a man, View this entry on the original dictionary page scan.
jayasiṃham. of a son of rāma-siṃha- (1600 A.D.) View this entry on the original dictionary page scan.
jayasiṃham. of several other men View this entry on the original dictionary page scan.
jayasiṃhadevam. king jaya-siṃha- View this entry on the original dictionary page scan.
jinasiṃham. Name of the founder of the 3rd subdivision of the kharatara-gaccha- of the Jain community View this entry on the original dictionary page scan.
jinasiṃham. of a Jain sūri- (A. D. 1 559-1618). View this entry on the original dictionary page scan.
jīvasiddhim. Name of a man View this entry on the original dictionary page scan.
jñānasiddhim. Name of a man View this entry on the original dictionary page scan.
jñātasiddhāntamfn. completely versed in any science View this entry on the original dictionary page scan.
kālanirṇayasiddhāntam. Name of work View this entry on the original dictionary page scan.
kalasi varia lectio for kalaśi- above. View this entry on the original dictionary page scan.
kālasiṃham. Name of a Prakrit poetry or poetic View this entry on the original dictionary page scan.
kalpasiddhāntam. Name of a jaina- work. View this entry on the original dictionary page scan.
kāmarasikamfn. libidinous View this entry on the original dictionary page scan.
kandarpasiddhāntam. Name of a commentator. View this entry on the original dictionary page scan.
karmasiddhif. accomplishment of an act, success View this entry on the original dictionary page scan.
kārttikasiddhāntam. Name of a scholiast on the mugdha-bodha-. View this entry on the original dictionary page scan.
kārukasiddhāntinm. plural Name of a śaiva- sect commentator or commentary on View this entry on the original dictionary page scan.
kāryārthasiddhif. the accomplishment of any object or purpose View this entry on the original dictionary page scan.
kāryasiddhif. accomplishment of a work, fulfilment of an object, success View this entry on the original dictionary page scan.
kasipum. food (equals kaśipu-) View this entry on the original dictionary page scan.
kavitārkikasiṃham. "lion of poets and philosophers", Name of veṅkaṭa-nātha-. View this entry on the original dictionary page scan.
kāvyarasikamfn. having a taste for poetical compositions, View this entry on the original dictionary page scan.
keralasiddhāntam. Name of work View this entry on the original dictionary page scan.
khasindhum. (see -camasa-) Name of the moon View this entry on the original dictionary page scan.
khasindhuSee 3. kh/a-, p.334. View this entry on the original dictionary page scan.
khemasiṃha see kṣetra-- s-, kṣema-- s- (above). View this entry on the original dictionary page scan.
khetasiṃhasee kṣetra-- s-, kṣema-- s- (above). View this entry on the original dictionary page scan.
kṛṣṇapuruṣottamasiddhāntopaniṣadf. Name of an View this entry on the original dictionary page scan.
kṛṣṇasiṃham. Name of the author of the work trepanakriyākathā- View this entry on the original dictionary page scan.
kṣārasindhum. idem or 'm. the salt ocean ' View this entry on the original dictionary page scan.
kṣemasiṃha(or khema-- s-), m. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
kṣetrasiṃha(or kheta-- s-), m. Name (also title or epithet) of various kings, View this entry on the original dictionary page scan.
kṣīrasindhum. equals -dhi- View this entry on the original dictionary page scan.
kumārasiṃham. Name of an astronomer. View this entry on the original dictionary page scan.
kumbhīnasim. Name of a demon View this entry on the original dictionary page scan.
kuṇḍamaṇḍapasiddhif. Name of work by viṭṭhala-dīkṣita-. View this entry on the original dictionary page scan.
kuṇḍasiddhif. Name of work View this entry on the original dictionary page scan.
labdhasiddhimfn. one who has attained perfection View this entry on the original dictionary page scan.
laghuvaiyākaraṇabhūṣaṇasiddhāntamañjūṣāf. Name of work View this entry on the original dictionary page scan.
laghuvasiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
laghuvāsiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
laghvāryabhaṭasiddhāntam. Name of an astronomy work (equals mahā-siddhānta-). View this entry on the original dictionary page scan.
lakṣmaṇasiṃham. Name of an author View this entry on the original dictionary page scan.
lakṣmīnarasiṃham. Name of a king View this entry on the original dictionary page scan.
lakṣmīnarasiṃham. of various authors View this entry on the original dictionary page scan.
lakṣmīśvarasiṃha(ś-) m. Name of a king View this entry on the original dictionary page scan.
lakṣyasiddhif. the attainment of an object View this entry on the original dictionary page scan.
lālasiṃham. Name of an astronomer (see lalla-). View this entry on the original dictionary page scan.
lasif. spittle, saliva View this entry on the original dictionary page scan.
lasitamfn. played, sported etc. View this entry on the original dictionary page scan.
lavaṇasindhum. the salt-sea, sea, ocean commentator or commentary View this entry on the original dictionary page scan.
lohasiṃhānikā(?) f. rust of iron
lokācāryasiddhāntam. Name of work View this entry on the original dictionary page scan.
lokaprasiddhamfn. celebrated in the world, generally established, universally known View this entry on the original dictionary page scan.
lokaprasiddhif. universal establishment or reception (of any custom etc.), general prevalence ( lokaprasiddhyā dhyā- ind.according to prevalent usage) View this entry on the original dictionary page scan.
lokaprasiddhyāind. lokaprasiddhi
lokasiddhamfn. world-established, current among the people, usual, common
lokasiddhamfn. universally admitted, generally received View this entry on the original dictionary page scan.
madanasiṃham. Name of various authors View this entry on the original dictionary page scan.
mādhavasiṃham. Name of a king and poet View this entry on the original dictionary page scan.
madhvasiddhāntam. Name of work (and madhvasiddhāntabhañjana ta-bhañjana- n. madhvasiddhāntasāra ta-sāra-,m.) View this entry on the original dictionary page scan.
madhvasiddhāntabhañjanan. madhvasiddhānta
mādhvasiddhāntasāram. Name of work View this entry on the original dictionary page scan.
madhvasiddhāntasāram. madhvasiddhānta
madhyasiddhāntakaumudīf. "the middle-sized "Name of an abridgment of the by varada-rāja-. = View this entry on the original dictionary page scan.
mahāmānasif. (with jaina-s) Name of one of the 16 vidyā-devī-s View this entry on the original dictionary page scan.
mahāpaiṭhīnasim. Name of a preceptor View this entry on the original dictionary page scan.
mahārudrasiṃham. Name of an author View this entry on the original dictionary page scan.
mahāryasiddhāntam. Name of work View this entry on the original dictionary page scan.
mahāsāhasikamfn. extremely daring or foolhardy, one who goes to work very rashly View this entry on the original dictionary page scan.
mahāsāhasikam. a robber View this entry on the original dictionary page scan.
mahāsāhasikam. an assaulter, violator View this entry on the original dictionary page scan.
mahāsāhasikatāf. great boldness or daring View this entry on the original dictionary page scan.
mahāsāhasikatāf. great energy View this entry on the original dictionary page scan.
mahāsāhasikatayāind. in a very decided manner View this entry on the original dictionary page scan.
mahāsāhasinmfn. equals -rāhasika- mfn. (q.v) View this entry on the original dictionary page scan.
mahāvākyasiddhāntam. Name of work View this entry on the original dictionary page scan.
mahendrasiṃham. Name of a king View this entry on the original dictionary page scan.
maheśvarasiddhāntam. equals paśu-pati-śāstra- q.v View this entry on the original dictionary page scan.
maheśvarasiṃham. Name of a king of mithilā- (patron of ratna-pāṇi-) View this entry on the original dictionary page scan.
mahimasiṃhagaṇim. Name of two authors View this entry on the original dictionary page scan.
mālasif. (in music) a particular rāgiṇī- View this entry on the original dictionary page scan.
malayasiṃham. Name of two princes View this entry on the original dictionary page scan.
manasi locative case of manas-, in compound View this entry on the original dictionary page scan.
manasijam. "heart-born", love or the god of love View this entry on the original dictionary page scan.
manasijam. the moon View this entry on the original dictionary page scan.
manasijabṛsīf. the moon View this entry on the original dictionary page scan.
manasijatarum. love conceived as a tree View this entry on the original dictionary page scan.
mānasikamfn. (fr. manas-or mānasa-) committed (only) in thought (as a sin) View this entry on the original dictionary page scan.
mānasikamfn. conceived (only) in the mind, imaginary View this entry on the original dictionary page scan.
mānasikam. Name of viṣṇu- View this entry on the original dictionary page scan.
manasikāram. taking to heart View this entry on the original dictionary page scan.
manasimandamfn. slow or inert in love View this entry on the original dictionary page scan.
manasimandarujf. pain of love View this entry on the original dictionary page scan.
mānasiṃham. Name of a king and various authors View this entry on the original dictionary page scan.
mānasiṃhakīrtimuktāvalif. Name of work View this entry on the original dictionary page scan.
manasinmfn. having a mind or soul, having intellect View this entry on the original dictionary page scan.
manasiśayam. "lying in the heart" equals -ja- View this entry on the original dictionary page scan.
manoharasiṃham. Name of a king View this entry on the original dictionary page scan.
manorathasiddham. wrong reading for -siddhi- View this entry on the original dictionary page scan.
manorathasiddhif. the fulfilment of a wishes View this entry on the original dictionary page scan.
manorathasiddhim. (also dhika-) Name of a man View this entry on the original dictionary page scan.
mantrasiddhamfn. accomplished by a spell View this entry on the original dictionary page scan.
mantrasiddhamfn. thoroughly versed in spells View this entry on the original dictionary page scan.
mantrasiddhif. the effect of a spell View this entry on the original dictionary page scan.
mantrasiddhif. the carrying out a resolution or advice View this entry on the original dictionary page scan.
manuṣyayaśasinmfn. possessing human glory View this entry on the original dictionary page scan.
mārasiṃham. Name of a prince View this entry on the original dictionary page scan.
masiand masī-, incorrectly for maṣi- and maṣī- q.v (masī-bhū-,to become black ; see maṣī-bhāvuka-) View this entry on the original dictionary page scan.
masikam. a serpent's hole View this entry on the original dictionary page scan.
masif. Nyctanthes Arbor Tristis (see prec.; varia lectio malikā-). View this entry on the original dictionary page scan.
masinamfn. well ground, finely pounded View this entry on the original dictionary page scan.
masinamfn. kinship through the right of presenting the piṇḍa- to a common progenitor (equals sa-piṇḍaka-) View this entry on the original dictionary page scan.
māyārasikamfn. See -vasika-. View this entry on the original dictionary page scan.
māyāvasikamfn. equals para-pratāraka- (prob. w.r for -rasika-"fond of illusion or deceit") . View this entry on the original dictionary page scan.
mitākṣarasiddhāntasaṃgraham. Name of work connected with the mitākṣarā- View this entry on the original dictionary page scan.
mithyādhyavasiti(mithyādh-) f. a particular figure of speech (in which the impossibility of a thing is expressed by making it depend upon some impossible contingency) View this entry on the original dictionary page scan.
mokṣalakṣmīsāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
mokṣasāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
mokṣasiddhif. Name of work View this entry on the original dictionary page scan.
mṛgasiṃhakam. a species of small lion View this entry on the original dictionary page scan.
muhūrtasiddhif. Name of work View this entry on the original dictionary page scan.
muhūrtasindhum. Name of work View this entry on the original dictionary page scan.
mūlapuliśasiddhāntam. the original siddhānta- of puliśa- commentator or commentary View this entry on the original dictionary page scan.
murasidābāda= $ Murshidabad, Name of a city View this entry on the original dictionary page scan.
mūrdhāvasiktam. Name of a particular mixed caste (the son of a Brahman and a kṣatriyā-) (varia lectio mūrdhābhi ṣikta-)
mūrdhāvasiktam. a consecrated king View this entry on the original dictionary page scan.
mūrdhāvasiktam. an officer in the army (or"expert in the dhanur-veda-", or"one who carries arms, or know, the power of precious stones, mantra-s, and medicinal herbs") View this entry on the original dictionary page scan.
naiṣkarmyasiddhif. Name of work , a refutation of the mīmāṃsā- system. View this entry on the original dictionary page scan.
nāmasiddhāntam. View this entry on the original dictionary page scan.
namasitamfn. (prob. wrong reading for syita-See next) reverenced, worshipped View this entry on the original dictionary page scan.
nānāmantraughasiddhimatmfn. having plenty of various magic. formulas View this entry on the original dictionary page scan.
narasiṃham. "man-lion", great warrior View this entry on the original dictionary page scan.
narasiṃham. Name of viṣṇu- in his 4th ava-tāra- (when he was half man half lion) View this entry on the original dictionary page scan.
narasiṃham. Name of the father of king bhairava- View this entry on the original dictionary page scan.
narasiṃham. of several princes and authors (also -kavi-, -kavi-rāja-, -ṭhakkura-, -dīkṣita-, -deva-, -paṇḍita-, -bhaṭṭa-, -miśra-, -muni-, -yati-, -yatīndra-, -rāja-, -vājapeyin-(or gnicid-vāj-), -śāstrin-, -sarasvatī-, -sūri-, -sena-, n/arasiṃhācārya-) View this entry on the original dictionary page scan.
nārasiṃhamf(ī-)n. (fr. nara-siṃha-) relating or belonging to the man-lion (viṣṇu- in his 4th avatāra-) etc. View this entry on the original dictionary page scan.
nārasiṃham. the 16th kalpa- or period of the world (see sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
nārasiṃham. equals narasiṃha-, viṣṇu- as man-lion View this entry on the original dictionary page scan.
nārasiṃham. Name of a man View this entry on the original dictionary page scan.
nārasiṃhan. Name of a town View this entry on the original dictionary page scan.
narasiṃhabhāratīvilāsam. Name of work View this entry on the original dictionary page scan.
narasiṃhabhaṭṭīyan. Name of work View this entry on the original dictionary page scan.
narasiṃhabhujaṃgam. Name of work View this entry on the original dictionary page scan.
narasiṃhabhūpālacaritran. Name of work View this entry on the original dictionary page scan.
narasiṃhacūrṇan. Name of a particular aphrodisiac View this entry on the original dictionary page scan.
nārasiṃhacūrṇan. a particular aphrodisiac (see nara-siṃha-c-). View this entry on the original dictionary page scan.
narasiṃhadvādaśīf. Name of the 12th day in the light half of the month phālguna- ( narasiṃhadvādaśīvrata śī-vrata- n.a ceremony then performed, Name of work) View this entry on the original dictionary page scan.
narasiṃhadvādaśīvratan. narasiṃhadvādaśī
narasiṃhakalpam. Name of work View this entry on the original dictionary page scan.
narasiṃhanakhastotran. Name of stotra- View this entry on the original dictionary page scan.
narasiṃhapañcaratnan. Name of stotra- View this entry on the original dictionary page scan.
narasiṃhapārijātam. Name of work View this entry on the original dictionary page scan.
narasiṃhapurāṇan. Name of work View this entry on the original dictionary page scan.
nārasiṃhapurāṇan. Name of a View this entry on the original dictionary page scan.
narasiṃharājīyan. Name of work View this entry on the original dictionary page scan.
narasiṃharṣabhakṣetramāhātmyan. Name of work View this entry on the original dictionary page scan.
narasiṃhasahasranāmann. plural Name of work View this entry on the original dictionary page scan.
narasiṃhaśāstriprakāśikāf. Name of work View this entry on the original dictionary page scan.
nārasiṃhaṣaṭcakryupaniṣadf. Name of an View this entry on the original dictionary page scan.
narasiṃhastutif. Name of work View this entry on the original dictionary page scan.
nārasiṃhatantran. Name of a tantra-. View this entry on the original dictionary page scan.
narasiṃhavarmanm. Name of a man View this entry on the original dictionary page scan.
narasiṃhayantran. Name of a mystic. diagram View this entry on the original dictionary page scan.
nārasiṃhīyan. Name of work on rhetoric View this entry on the original dictionary page scan.
nārasiṃhopaniṣadf. View this entry on the original dictionary page scan.
nārasiṃhopapurāṇan. Name of an and an upapurāṇa- View this entry on the original dictionary page scan.
nasi idem or 'f. idem or 'm. (in fine compositi or 'at the end of a compound') the nose (see apī-n-, urū--, kumbhīn-etc.)' ' (?) View this entry on the original dictionary page scan.
nasiSee kumbhī-n-. View this entry on the original dictionary page scan.
nāthasiṃham. Name of an author View this entry on the original dictionary page scan.
nātiprasiddhamfn. not too well known View this entry on the original dictionary page scan.
navajvarebhasiṃham. Name of particular medicaments View this entry on the original dictionary page scan.
navāvasitan. (prob.) idem or 'n. a new dwelling ' View this entry on the original dictionary page scan.
nayasiddhif. political success View this entry on the original dictionary page scan.
nidāghasindhum. a river in hot weather, one nearly dry View this entry on the original dictionary page scan.
niḥśvasvasitamfn. breathed or breathing out, sighing View this entry on the original dictionary page scan.
niḥśvasvasitan. expiration View this entry on the original dictionary page scan.
niḥśvasvasitan. a sigh View this entry on the original dictionary page scan.
nīlasindhukam. Vitex Negundo View this entry on the original dictionary page scan.
niravavasitamfn. expelled, rejected View this entry on the original dictionary page scan.
nirhrasitamfn. shortened View this entry on the original dictionary page scan.
nirṇayasiddhāntam. Name of work View this entry on the original dictionary page scan.
nirṇayasindhum. Name of work View this entry on the original dictionary page scan.
nirvārāṇasimfn. one who has left vārāṇasī- Va1rtt. 3 View this entry on the original dictionary page scan.
nisargasiddhamfn. effected by nature, natural View this entry on the original dictionary page scan.
niśvasita(n/i--) n. breath, expiration or inspiration View this entry on the original dictionary page scan.
nityasiddhamfn. "ever perfect", a jaina- predicate of the soul View this entry on the original dictionary page scan.
nivasitamfn. clothed in (instrumental case) View this entry on the original dictionary page scan.
nivasitamfn. dwelled, lived (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
nyāyasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntadīpam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamālāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarībhūṣāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīdipikāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīprakāśam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīsāram. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamuktāvalīf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntapañcānanam. Name of a viśva-nātha- View this entry on the original dictionary page scan.
nyāyasiddhāntatattvan. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntavāgīśam. Name of a gadā-dhara- View this entry on the original dictionary page scan.
nyāyasiddhāntvāmṛtan. Name of work View this entry on the original dictionary page scan.
pādalepasiddhif. its effect View this entry on the original dictionary page scan.
padāmnāyasiddhif. Name of work View this entry on the original dictionary page scan.
paitāmahasiddhāntam. Name of work View this entry on the original dictionary page scan.
paiṭhīnasim. patronymic of an ancient teacher (a muni- and author of a system of laws) View this entry on the original dictionary page scan.
paiṭhīnasismṛtif. Name of work View this entry on the original dictionary page scan.
panasif. a kind of disease, pustules on the ears and neck (see pinasa-, pīnasa-).
pānasindhu -saindhava- View this entry on the original dictionary page scan.
pañcasiddhāntam. Name of the bhāsvatī-karaṇa- (q.v) View this entry on the original dictionary page scan.
pañcasiddhāntikāf. Name of an astronomy work by varāha-mihira- (founded on the 5 older astronomy works., and called by himself karaṇa-). View this entry on the original dictionary page scan.
pañcasiddhauṣadhīf. the 5 medicine plants View this entry on the original dictionary page scan.
pañcasiddhauṣadhikamfn. consisting of 5 kinds of medicine plants View this entry on the original dictionary page scan.
paṇyasiddhif. prosperity in trade, View this entry on the original dictionary page scan.
pāpānuvasitamfn. addicted to sin, sinful View this entry on the original dictionary page scan.
parāmarśasiddhāntagranthakroḍam. Name of work
parāmarśasiddhāntagranthālokam. Name of work
parāmarśasiddhāntagranthaprakāśam. Name of work
parāmarśasiddhāntagranthaṭīkāf. Name of work
parāmarśasiddhāntagranthavivecanan. Name of work
parāmarśasiddhāntarahasyan. Name of work
parāśarasiddhāntam. Name of work View this entry on the original dictionary page scan.
pārasikamf(ī-)n. idem or 'f. See below.' (varia lectio sīka-) View this entry on the original dictionary page scan.
pārasikam. plural the Persian View this entry on the original dictionary page scan.
parihasitamfn. laughed at, ridiculed View this entry on the original dictionary page scan.
pariśiṣṭasiddhāntaratnākaram. Name of work View this entry on the original dictionary page scan.
parṇasim. (only ) a house upon or by the water View this entry on the original dictionary page scan.
parṇasim. a lotus View this entry on the original dictionary page scan.
parṇasim. a vegetable View this entry on the original dictionary page scan.
parṇasim. adorning, decoration. View this entry on the original dictionary page scan.
paryavasitamfn. (pary-/ava--) living farther off (= not quite near) View this entry on the original dictionary page scan.
paryavasitamfn. (with lokāntaram-) departed to View this entry on the original dictionary page scan.
paryavasitamfn. finished, concluded, ended etc. View this entry on the original dictionary page scan.
paryavasitamfn. amounting to (locative case) View this entry on the original dictionary page scan.
paryavasitamfn. resolved, settled, definitive View this entry on the original dictionary page scan.
paryavasitamatimfn. thoroughly acquainted or familiar with (locative case) View this entry on the original dictionary page scan.
paryudasitavyamfn. to be excluded or denied View this entry on the original dictionary page scan.
paṭhitasiddhamfn. effective on being (merely) recited View this entry on the original dictionary page scan.
paṭhitasiddhasārasvatastotran. Name of work View this entry on the original dictionary page scan.
pattrasif. the vein or fibre of a leaf. equals -bhaṅga- View this entry on the original dictionary page scan.
pauliśasiddhāntam. Name of astronomy work View this entry on the original dictionary page scan.
pāyasikamf(ī-)n. fond of boiled milk etc. Va1rtt. 17 View this entry on the original dictionary page scan.
payasiṣṭha mfn. superl. of payas-vin- View this entry on the original dictionary page scan.
phalasiddhif. realising an object, success, a prosperous issue on View this entry on the original dictionary page scan.
pīnasin() mfn. -having a cold View this entry on the original dictionary page scan.
pīnasita() mfn. -having a cold View this entry on the original dictionary page scan.
prabhākarasiddhim. Name of a scholar View this entry on the original dictionary page scan.
prābhasika(with kṣetra-) n. equals pra-bhāsa-kṣ- View this entry on the original dictionary page scan.
prabodhasiddhif. Name of work View this entry on the original dictionary page scan.
pracalasiṃham. Name of a poet View this entry on the original dictionary page scan.
pradīpasiṃham. Name of an author View this entry on the original dictionary page scan.
prahasitamfn. laughing, cheerful View this entry on the original dictionary page scan.
prahasitam. Name of a buddha- View this entry on the original dictionary page scan.
prahasitam. of a prince of the kiṃ-nara-s View this entry on the original dictionary page scan.
prahasitan. bursting into laughter View this entry on the original dictionary page scan.
prahasitan. displaying bright gaudy colours View this entry on the original dictionary page scan.
prahasitānanamfn. () with laughing face. View this entry on the original dictionary page scan.
prahasitanetram. "laughing-eyed", Name of a buddha- View this entry on the original dictionary page scan.
prahasitavadanamfn. () with laughing face. View this entry on the original dictionary page scan.
pramāṇasiddhim. Name of a man View this entry on the original dictionary page scan.
prasi(only A1. perfect tense siṣye-,with pass. meaning) , to bind-render harmless View this entry on the original dictionary page scan.
prasicP. -siñcati-, to pour out, shed, emit etc.,; to sprinkle, water ; to fill (a vessel) : Passive voice -sicyate-, to be poured out or flow forth ; to be watered id est refreshed : Causal -secayati-, to pour into (locative case) View this entry on the original dictionary page scan.
prasiddhamfn. (pr/a--) brought about, accomplished (a-pras-) View this entry on the original dictionary page scan.
prasiddhamfn. arranged, adorned (as hair) View this entry on the original dictionary page scan.
prasiddhamfn. well known, notorious, celebrated etc. View this entry on the original dictionary page scan.
prasiddhāf. (in music) a particular measure View this entry on the original dictionary page scan.
prasiddhakam. Name of a prince descended from janaka- (son of maru- and father of kṛtti-ratha-) View this entry on the original dictionary page scan.
prasiddhakṣatriyaprāyamfn. consisting for the most part of renowned kṣatriya-s View this entry on the original dictionary page scan.
prasiddhatāf. () celebrity, notoriety. View this entry on the original dictionary page scan.
prasiddhatvan. () celebrity, notoriety. View this entry on the original dictionary page scan.
prasiddhif. accomplishment, success, attainment View this entry on the original dictionary page scan.
prasiddhif. proof, argument View this entry on the original dictionary page scan.
prasiddhif. general opinion, publicity, celebrity, renown, fame, rumour View this entry on the original dictionary page scan.
prasiddhihatamfn. having no value, very trivial View this entry on the original dictionary page scan.
prasiddhimatmfn. universally known, famous View this entry on the original dictionary page scan.
prasiddhividyāviruddhamfn. contrary to common sense and science, View this entry on the original dictionary page scan.
prasiddhiviruddhatāf. the state of being opposed to general opinion, (equals khyāti-v-) View this entry on the original dictionary page scan.
prasidhP. A1. -sedhati-, te-, to drive on View this entry on the original dictionary page scan.
prasidhP. -sidhyati-, (rarely A1. te-), to be accomplished or effected, succeed etc. ; to result from (ablative) ; to be explained or made clear on View this entry on the original dictionary page scan.
prasiktamfn. poured out View this entry on the original dictionary page scan.
prasiktamfn. (in fine compositi or 'at the end of a compound') sprinkled with View this entry on the original dictionary page scan.
prasitamfn. (for 2.See below) bound, fastened View this entry on the original dictionary page scan.
prasitamfn. diligent, attentive, attached or devoted to, engrossed by, engaged in, occupied with (locative case or instrumental case; see ) View this entry on the original dictionary page scan.
prasitamfn. lasting, continuous View this entry on the original dictionary page scan.
prasitamfn. (2. si-; see pra-si-above) darting along View this entry on the original dictionary page scan.
prasitan. pus, matter View this entry on the original dictionary page scan.
prasitif. (pr/a--) (for 2.See below) a net for catching birds ( ) View this entry on the original dictionary page scan.
prasitif. a ligament, binding, fetter View this entry on the original dictionary page scan.
prasitif. (pr/a--) (for 1.See above) onward rush, onset, attack, assault View this entry on the original dictionary page scan.
prasitif. a throw, cast, shot, missile View this entry on the original dictionary page scan.
prasitif. stretch, reach, extension, sphere View this entry on the original dictionary page scan.
prasitif. succession, duration View this entry on the original dictionary page scan.
prasitif. dominion, power, authority, influence View this entry on the original dictionary page scan.
prasivP. -sīvyati-, to sew up View this entry on the original dictionary page scan.
praśvasitavyan. (impers.) recovery of breath id est recreation should be procured for (genitive case) or by (instrumental case) or through or by means of (instrumental case) View this entry on the original dictionary page scan.
pratāpasiṃham. Name of author View this entry on the original dictionary page scan.
pratāpasiṃharājam. Name of author View this entry on the original dictionary page scan.
prathamavayasinmfn. young View this entry on the original dictionary page scan.
prātidaivasikamf(ī-)n. (fr. -divasam-) happening or occurring daily View this entry on the original dictionary page scan.
pratirasitan. echo, resonance, View this entry on the original dictionary page scan.
pratitantrasiddhāntam. a doctrine adopted in various systems (but not in all) View this entry on the original dictionary page scan.
pratyakṣasiddhamfn. determined by evidence of the senses View this entry on the original dictionary page scan.
pratyavasitamfn. relapsed into the old (bad) way of life (Scholiast or Commentator"one who has given up the life of a religious mendicant") View this entry on the original dictionary page scan.
pratyavasitamfn. consumed, eaten (see ) View this entry on the original dictionary page scan.
pravrajyāvasitam. a religious mendicant who has renounced his order View this entry on the original dictionary page scan.
pulastyasiddhāntam. Name of work View this entry on the original dictionary page scan.
purāṇasiṃham. Name of viṣṇu- as man-lion View this entry on the original dictionary page scan.
puruṣārthasiddhyupāyam. Name of work View this entry on the original dictionary page scan.
puruṣasiṃham. "man-lion", an eminent man or hero View this entry on the original dictionary page scan.
puruṣasiṃham. (with jaina-s) Name of the 5th of the black vāsudeva-s View this entry on the original dictionary page scan.
pūrvasiddhamfn. previously settled or determined or proved View this entry on the original dictionary page scan.
pūrvasiddhāntam. Name of work View this entry on the original dictionary page scan.
pūrvasiddhāntapakṣatāf. Name of work View this entry on the original dictionary page scan.
pūrvavayasinmfn. being in the first period of life, young View this entry on the original dictionary page scan.
puṣpasif. "white like flower", a kind of sugar View this entry on the original dictionary page scan.
rābhasikamfn. (fr. rabhas-) impetuous, vehement (= āyaḥśūlika- q.v) View this entry on the original dictionary page scan.
rābhasikatāf. vehemency, impetuosity View this entry on the original dictionary page scan.
rāghavasiṃham. " rāghava-s-lion", Name of rāma--candra View this entry on the original dictionary page scan.
raghurājasiṃham. Name of an author View this entry on the original dictionary page scan.
rahasiind. rahas
rājasikamfn. equals rājasa- View this entry on the original dictionary page scan.
rājasiṃham. "king-lion", an illustrious king View this entry on the original dictionary page scan.
rājasiṃham. Name of various kings View this entry on the original dictionary page scan.
rājasiṃhapāṇḍya(), m. Name (also title or epithet) of a king. View this entry on the original dictionary page scan.
rājasiṃhasudhāsaṃgraham. Name of a medical work (written by mahādeva-, at the request of king rāja-siṃha-, and also called -sudhā-sindhu-). View this entry on the original dictionary page scan.
rājavarcasinmfn. being in royal service View this entry on the original dictionary page scan.
ramalasiktāf. (?) Name of work View this entry on the original dictionary page scan.
rāmamānasikapūjāf. Name of work View this entry on the original dictionary page scan.
rāmānujasiddhāntapadavīf. Name of work
rāmānujasiddhāntasaṃgraham. Name of work
rāmānujasiddhāntavijayam. Name of work
rāmānujīyasiddhāntam. Name of work View this entry on the original dictionary page scan.
rāmasiddhāntasaṃgraham. Name of work on bhakti-. View this entry on the original dictionary page scan.
rāmasiṃham. Name of a king (son of jaya-siṃha-) View this entry on the original dictionary page scan.
rāmasiṃhadevam. Name of a king of mithilā- and of the patron of ratneśvara- View this entry on the original dictionary page scan.
rāmasiṃhavarmanm. Name of a king of jaya-pura- (who passes as the author of the dhātu-ratnamañjarī-) View this entry on the original dictionary page scan.
raṇarasikamfn. fond of fighting, desirous of fighting with (compound) View this entry on the original dictionary page scan.
raṇoddīpasiṃham. Name of a man View this entry on the original dictionary page scan.
rasāmṛtasindhum. rasāmṛta
rasasaṃgrahasiddhāntam. Name of work View this entry on the original dictionary page scan.
rasasiddhamfn. brought to perfection by means of quicksilver, skilled in alchemy View this entry on the original dictionary page scan.
rasasiddhamfn. conversant with the poetical rasa-s, accomplished in poetry View this entry on the original dictionary page scan.
rasasiddhāntasāgaram. Name of work View this entry on the original dictionary page scan.
rasasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
rasasiddhif. perfection attained by means of quicksilver, skill in alchemy View this entry on the original dictionary page scan.
rasasiddhiprakāśam. Name of a medical work View this entry on the original dictionary page scan.
rasasindhum. Name of work View this entry on the original dictionary page scan.
rasasindūran. a sort of factitious cinnabar (used as an escharotic) View this entry on the original dictionary page scan.
raseśvarasiddhāntam. Name of work (establishing the efficacy of mercury in alchemy) View this entry on the original dictionary page scan.
rasikamf(ā-)n. tasteful, elegant View this entry on the original dictionary page scan.
rasikamf(ā-)n. having a discriminating taste, aesthetic View this entry on the original dictionary page scan.
rasikamf(ā-)n. having a taste for or a sense of, fond of, devoted to, delighting in (locative case or compound) View this entry on the original dictionary page scan.
rasikamf(ā-)n. sentimental View this entry on the original dictionary page scan.
rasikamf(ā-)n. fanciful View this entry on the original dictionary page scan.
rasikamf(ā-)n. lustful View this entry on the original dictionary page scan.
rasikam. a man full of taste or feeling (see a-r-) View this entry on the original dictionary page scan.
rasikam. a libertine View this entry on the original dictionary page scan.
rasikam. Ardea Sibirica View this entry on the original dictionary page scan.
rasikam. a horse View this entry on the original dictionary page scan.
rasikam. an elephant View this entry on the original dictionary page scan.
rasikam. unboiled juice of sugar-cane View this entry on the original dictionary page scan.
rasif. See below. View this entry on the original dictionary page scan.
rasif. an emotional wife (see compound) View this entry on the original dictionary page scan.
rasif. the juice of sugar-cane, molasses View this entry on the original dictionary page scan.
rasif. curds with sugar and spice View this entry on the original dictionary page scan.
rasif. chyle View this entry on the original dictionary page scan.
rasif. the tongue View this entry on the original dictionary page scan.
rasif. a woman's girdle (see raśanā-). View this entry on the original dictionary page scan.
rasikābhāryam. one who has a wife liable to strong emotions or feelings View this entry on the original dictionary page scan.
rasikabhūṣaṇan. Name of work View this entry on the original dictionary page scan.
rasikacandrikāf. Name of work View this entry on the original dictionary page scan.
rasikajīvanan. Name of work View this entry on the original dictionary page scan.
rasikajīvanīf. Name of work View this entry on the original dictionary page scan.
rasikaprakāśam. Name of work View this entry on the original dictionary page scan.
rasikapriyāf. Name of work View this entry on the original dictionary page scan.
rasikaramaṇan. Name of work View this entry on the original dictionary page scan.
rasikarañjanan. Name of work View this entry on the original dictionary page scan.
rasikarañjinīf. Name of work View this entry on the original dictionary page scan.
rasikasaṃjīvinīf. Name of work View this entry on the original dictionary page scan.
rasikasarvasvan. Name of work View this entry on the original dictionary page scan.
rasikatāf. View this entry on the original dictionary page scan.
rasikatvan. sense of, taste or fondness for, devotion or addiction to (locative case) View this entry on the original dictionary page scan.
rasikeśvaram. "lord or husband of a passionate wife", Name of kṛṣṇa- View this entry on the original dictionary page scan.
rasinSee a-ras-. View this entry on the original dictionary page scan.
rasinmfn. juicy, liquid (as soma-) View this entry on the original dictionary page scan.
rasinmfn. impassioned View this entry on the original dictionary page scan.
rasinmfn. having good taste, aesthetic View this entry on the original dictionary page scan.
rasitamfn. (for 2.See) sounded, resounding, uttering inarticulate sounds View this entry on the original dictionary page scan.
rasitan. a roar, scream, cry, noise, sound, thunder View this entry on the original dictionary page scan.
rasitamfn. (for 1.See) tasted View this entry on the original dictionary page scan.
rasitamfn. covered or overlaid with gold, gilded, plated View this entry on the original dictionary page scan.
rasitamfn. having taste or flavour or sentiment View this entry on the original dictionary page scan.
rasitāśinmfn. consuming or destroying by mere noise View this entry on the original dictionary page scan.
rasitavatmfn. one who has tasted etc., View this entry on the original dictionary page scan.
rasitṛmfn. (for 2.See) one who roars or bellows View this entry on the original dictionary page scan.
rasitṛmfn. (for 1.See) equals rasayitṛ-, a taster View this entry on the original dictionary page scan.
ratnasiṃham. Name of various men View this entry on the original dictionary page scan.
rāyanarasiṃhapaṇḍitam. View this entry on the original dictionary page scan.
rayapraśnasūtrasiddhāntam. Name of work View this entry on the original dictionary page scan.
rāyasiṃhotsavam. Name of a medical work by rāyasiṃha- (also called vaidyaka-sāra-saṃgraha-). View this entry on the original dictionary page scan.
retovasiktamfn. "sprinkled with seed"(said of ascetics who live on the flesh of animals killed by other animals) View this entry on the original dictionary page scan.
rodasiprāmfn. (for -pr/ā-) filling heaven and earth View this entry on the original dictionary page scan.
romakasiddhāntam. Name of romakācārya-'s siddhānta- (one of the 5 chief astronomical siddhānta-s current in the age of varāha-mihira-) View this entry on the original dictionary page scan.
romakasiddhāntam. of a modern fiction View this entry on the original dictionary page scan.
romaśasiddhāntam. Name of an astronomy work. View this entry on the original dictionary page scan.
ṛṣabhagajavilasitan. Name of a metre. View this entry on the original dictionary page scan.
rudrasiṃham. Name of various men View this entry on the original dictionary page scan.
rūpasiddhim. Name of a man View this entry on the original dictionary page scan.
rūpasiddhim. of a grammatical work View this entry on the original dictionary page scan.
sabalasiṃham. Name of a king View this entry on the original dictionary page scan.
śabarasiṃham. Name of a king (mentioned in the kathārṇava-) View this entry on the original dictionary page scan.
śabdasaṃdarbhasindhum. (see śadārnavābhidhāna-) Name of a lexicon (compiled for Sir Jones by kāśīnātha- bhaṭṭācārya-). View this entry on the original dictionary page scan.
śabdasiddhāntamañjarīf. Name of a gram. work View this entry on the original dictionary page scan.
śabdasiddhif. "correct formation or use of words", Name of various works. View this entry on the original dictionary page scan.
śabdasiddhinibandham. Name of a modern school-book. View this entry on the original dictionary page scan.
śābdikanarasiṃham. Name of a grammarian View this entry on the original dictionary page scan.
ṣaḍdarśanasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
sādhyasiddhamfn. to be still accomplished and already accomplished View this entry on the original dictionary page scan.
sādhyasiddhif. accomplishment of what has to be done View this entry on the original dictionary page scan.
sādhyasiddhif. the establishing of what has to be proved View this entry on the original dictionary page scan.
sādhyasiddhif. the success of an undertaking, accomplishment fulfilment View this entry on the original dictionary page scan.
sādhyasiddhif. proof. conclusion View this entry on the original dictionary page scan.
sādhyasiddhipādam. the fourth stage or division of a suit at law, judgement, decision View this entry on the original dictionary page scan.
ṣāḍrasikamfn. (fr. ṣaḍ-rasa-) having six tastes or flavours View this entry on the original dictionary page scan.
sahajasiddhif. Name of work View this entry on the original dictionary page scan.
sāhasaikarasikamfn. one whose only feeling or passion is cruelty, brutal, ferocious View this entry on the original dictionary page scan.
sahasiddhamfn. innate ( sahasiddhatva -tva- n.) (quot) View this entry on the original dictionary page scan.
sahasiddhatvan. sahasiddha
sāhasikamf(ī-)n. bold, daring, impetuous, rash, reckless, inconsiderate etc. View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. using great force or violence, perpetrated with violence, cruel, brutal, ferocious, rapacious View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. overstraining or overworking one's self View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. punitive, castigatory View this entry on the original dictionary page scan.
sāhasikam. a robber, freebooter View this entry on the original dictionary page scan.
sāhasikam. Name of a cook View this entry on the original dictionary page scan.
sāhasikatāf. cruelty, ferocity, impetuosity View this entry on the original dictionary page scan.
sāhasikyan. rashness, foolhardiness, temerity View this entry on the original dictionary page scan.
sāhasikyan. violence, force View this entry on the original dictionary page scan.
sahasinmfn. powerful, mighty View this entry on the original dictionary page scan.
sāhasinmfn. rash, precipitate, inconsiderate, foolhardy View this entry on the original dictionary page scan.
sāhasinmfn. cruel, violent, ferocious View this entry on the original dictionary page scan.
śairasim. patronymic fr. śiras- gaRa bāhv-ādi-. View this entry on the original dictionary page scan.
śaivasiddhāntadīpikāf. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasāram. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasārāvalīf. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntaśekharam. Name of work View this entry on the original dictionary page scan.
sakalasiddhif. the success of all ( sakalasiddhida -da- mfn."granting success to all") View this entry on the original dictionary page scan.
sakalasiddhimfn. possessing all perfection View this entry on the original dictionary page scan.
sakalasiddhidamfn. sakalasiddhi
sākārasiddhif. Name of work View this entry on the original dictionary page scan.
sākūtahasitan. idem or 'n. a significant or meaning smile, wanton glance ' View this entry on the original dictionary page scan.
śākyasiṃham. " śakya- lion", Name of gautama- buddha- View this entry on the original dictionary page scan.
samānaprasiddhimfn. having equal success View this entry on the original dictionary page scan.
samarasiṃham. "battle-lion", Name of an astronomer View this entry on the original dictionary page scan.
sāmasiddhamfn. accomplished in a peaceable way View this entry on the original dictionary page scan.
samasiddhāntamfn. pursuing equal objects View this entry on the original dictionary page scan.
sāmasiddhif. the art of accomplishing something in a peaceable way View this entry on the original dictionary page scan.
śambarasiddhim. See above. View this entry on the original dictionary page scan.
śāmbarasilpan. the art of jugglery, magic View this entry on the original dictionary page scan.
saṃgītasiddhāntam. Name of work View this entry on the original dictionary page scan.
saṃgrāmasiddhim. Name of an elephant View this entry on the original dictionary page scan.
saṃgrāmasiṃham. "lion in battle", Name of an official in the lower regions View this entry on the original dictionary page scan.
samīpāvasitamfn. settled down in the neighbourhood View this entry on the original dictionary page scan.
saṃkalpasiddhamfn. accomplished by mental resolve or will, one who has gained supernatural power through strength of will View this entry on the original dictionary page scan.
saṃkalpasiddhif. accomplishment of an object by (strength of) will View this entry on the original dictionary page scan.
śaṃkarasiddhim. Name of a man View this entry on the original dictionary page scan.
saṃkṣepasiddhivyavasthāf. Name of work on dharma- View this entry on the original dictionary page scan.
saṃkṣiptanirṇayasindhum. Name of work View this entry on the original dictionary page scan.
samprasic Passive voice -sicyate-, to flow out, issue View this entry on the original dictionary page scan.
samprasiddhamfn. (3. sidh-) well prepared, cooked View this entry on the original dictionary page scan.
samprasiddhif. success, good luck View this entry on the original dictionary page scan.
sāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
sāmrājyasiddhidāf. Name of the family deity of the uddālaka-s View this entry on the original dictionary page scan.
saṃskārasiddhidīpikāf. Name of work View this entry on the original dictionary page scan.
samucchvasitamfn. breathed or sighed deeply (n. used impersonally) View this entry on the original dictionary page scan.
samucchvasitan. breathing View this entry on the original dictionary page scan.
samucchvasitan. a heavy or deep sigh View this entry on the original dictionary page scan.
samullasitamfn. shining forth, gleaming, brilliant, beautiful View this entry on the original dictionary page scan.
samullasitamfn. sportive, sporting View this entry on the original dictionary page scan.
samyagvyavasitamfn. firmly resolved View this entry on the original dictionary page scan.
sānasimfn. bringing wealth or blessings, laden with spoils, victorious View this entry on the original dictionary page scan.
sanātanasiddhāntam. Name of work View this entry on the original dictionary page scan.
saptasif. betel (wrong reading -śirā-). View this entry on the original dictionary page scan.
sarasi(locative case of saras-), in compound View this entry on the original dictionary page scan.
sārasiddhāntakaumudīf. Name of work View this entry on the original dictionary page scan.
sarasijamfn. produced or living in lakes or ponds (as fish) View this entry on the original dictionary page scan.
sarasijan. a lotus View this entry on the original dictionary page scan.
sarasijākṣīf. a lotus-eyed woman, View this entry on the original dictionary page scan.
sarasijamukhīf. a lotus-faced woman, View this entry on the original dictionary page scan.
sarasikam. the Indian crane (also sarasīka-; see sārasa-) View this entry on the original dictionary page scan.
sarasika sarasi-ja- etc. See p.1182. View this entry on the original dictionary page scan.
sārasif. a female Indian crane View this entry on the original dictionary page scan.
sarasiñanmanm. "lotus-born", Name of brahmā- View this entry on the original dictionary page scan.
sārasindhum. Name of work View this entry on the original dictionary page scan.
sarasiruhan. "growing in a lake or pond", a lotus View this entry on the original dictionary page scan.
sarasiruhajanmanm. "lotus-born", Name of brahmā- View this entry on the original dictionary page scan.
sarasiruhasūnum. "lotus-son" idem or 'm. "lotus-born", Name of brahmā- ' View this entry on the original dictionary page scan.
śaratparvaśasinm. śaratparvan
sarvārthasiddhamfn. one who has accomplished all aims View this entry on the original dictionary page scan.
sarvārthasiddham. Name of gautama- buddha- (so called, according to some, because his parents' wishes were all fulfilled by his birth) View this entry on the original dictionary page scan.
sarvārthasiddham. of a king View this entry on the original dictionary page scan.
sarvārthasiddhif. accomplishment of all aims View this entry on the original dictionary page scan.
sarvārthasiddhif. Name of various works. View this entry on the original dictionary page scan.
sarvārthasiddhim. plural (with jaina-s) a class of deities View this entry on the original dictionary page scan.
sarvasampradāyābhedasiddhāntam. Name of work View this entry on the original dictionary page scan.
sarvasiddhāf. Name of the 4th and 9th and 14th lunar nights. View this entry on the original dictionary page scan.
sarvasiddhāntam. Name of work View this entry on the original dictionary page scan.
sarvasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
sarvasiddhārthamfn. having every object accomplished, having every wish gratified View this entry on the original dictionary page scan.
sarvasiddhif. accomplishment of every object, universal success View this entry on the original dictionary page scan.
sarvasiddhif. entire proof, complete result View this entry on the original dictionary page scan.
sarvasiddhim. Aegle Marmelos View this entry on the original dictionary page scan.
sarvatantrasiddhāntam. a dogma admitted by all systems (opp. to pratitantra-s- q.v) View this entry on the original dictionary page scan.
sarvavedasinmfn. giving away all one's property View this entry on the original dictionary page scan.
sasiddhācāryam. Name of a teacher View this entry on the original dictionary page scan.
śasitaSee vi-ś-. View this entry on the original dictionary page scan.
sasitamfn. with sugar View this entry on the original dictionary page scan.
sasitopalamfn. idem or 'mfn. with sugar ' View this entry on the original dictionary page scan.
sasitotpalamālinmfn. wreathed with white lotus flowers View this entry on the original dictionary page scan.
śasitṛSee vi-ś-. View this entry on the original dictionary page scan.
śasitvāind. having praised etc. (equals śastvā-See śaṃs-) View this entry on the original dictionary page scan.
śasitvāind. having wounded or hurt View this entry on the original dictionary page scan.
śāstrasiddhamfn. established by the śāstra- View this entry on the original dictionary page scan.
śāstrasiddhāntaleśasaṃgraham. Name of work View this entry on the original dictionary page scan.
śāstrasiddhāntaleśasaṃgrahasāram. Name of work View this entry on the original dictionary page scan.
satkāryavādasiddhāntam. satkāryavāda
satpratipakṣasiddhāntagranthadīdhitiṭīkāf. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntakroḍam. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntānugamam. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
sattarkasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
sātvatasiddhāntaśatakan. Name of a vedānta- work View this entry on the original dictionary page scan.
saurasiddhāntam. Name of work View this entry on the original dictionary page scan.
sauyavasim. a patronymic View this entry on the original dictionary page scan.
śavasinmfn. idem or 'mfn. mighty, powerful ' View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthadīdhitiṭīkāf. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthalokam. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthaprakāśam. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagrantharahasyan. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
siddhāntasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
siddhāntasindhum. Name of work View this entry on the original dictionary page scan.
siddhasiddhamfn. thoroughly efficacious (said of a particular mantra-) View this entry on the original dictionary page scan.
siddhasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
siddhasiddhāntam. Name of work View this entry on the original dictionary page scan.
siddhasiddhāntapaddhatif. Name of work View this entry on the original dictionary page scan.
siddhasindhum. "river of the siddha-s", Name of the heavenly Ganges. View this entry on the original dictionary page scan.
siddhyasiddhif. dual number success and misfortune View this entry on the original dictionary page scan.
simasimāya (onomatopoetic (i.e. formed from imitation of sounds)) A1. yate-, to bubble, simmer, crackle View this entry on the original dictionary page scan.
siṃhasiddhāntasindhum. Name of work View this entry on the original dictionary page scan.
śirasi locative case of śiras-, in compound View this entry on the original dictionary page scan.
śirasijam. (in fine compositi or 'at the end of a compound' f(ā-).) "produced on the head", the hair of the head View this entry on the original dictionary page scan.
śirasijapāśam. a tuft of hair View this entry on the original dictionary page scan.
śirasiruh() () m. "growing on the head", the hair. View this entry on the original dictionary page scan.
śirasiruha() m. "growing on the head", the hair. View this entry on the original dictionary page scan.
śirasisicf. a head-cloth View this entry on the original dictionary page scan.
śirasitamfn. exalted (?) View this entry on the original dictionary page scan.
śītarasikamfn. having or causing a cold flavour View this entry on the original dictionary page scan.
sitasiddhārtha m. white mustard (or a grain of white mustard-seed) View this entry on the original dictionary page scan.
sitasiddhārthakam. white mustard (or a grain of white mustard-seed) View this entry on the original dictionary page scan.
sitasiṃhīf. a white-blossomed kaṇṭakārī- View this entry on the original dictionary page scan.
sitasindhuf. the Ganges View this entry on the original dictionary page scan.
sitasiva varia lectio for -śiva- View this entry on the original dictionary page scan.
śivādvaitasiddhāntaprakāśikāf. Name of work View this entry on the original dictionary page scan.
śivamānasikasnānan. Name of work View this entry on the original dictionary page scan.
śivaprakāsakasiṃha m. Name of the author of the bhāgavata-tattva-bhāskara-. View this entry on the original dictionary page scan.
śivasiddhāntam. (also śivasiddhāntaśāstra -śāstra- n.) Name of an astrology work View this entry on the original dictionary page scan.
śivasiddhāntaśāstran. śivasiddhānta
śivasiṃham. (also -deva-) Name of various princes (especially of a king of mithilā-, brother of padma-siṃha-, and patron of vidyā-pati-)
śmasiin See vaś-. View this entry on the original dictionary page scan.
somasiddhāntam. a particular heretical tantra- system (followed by a sect of śaiva-s and personified in the 3rd Act of the prabodha-candrodaya-) View this entry on the original dictionary page scan.
somasiddhāntam. Name of various astronomical works View this entry on the original dictionary page scan.
somasiddhāntam. of a particular buddha- View this entry on the original dictionary page scan.
somasiddhāntinm. a follower of the above system View this entry on the original dictionary page scan.
somasindhum. "ocean of soma-", Name of viṣṇu- View this entry on the original dictionary page scan.
sotkṛṣṭahasitasvaramfn. accompanied by loud laughter View this entry on the original dictionary page scan.
sotprāsahasitan. derisive or sarcastic laughter View this entry on the original dictionary page scan.
sparśarasikamfn. fond of sensation, sensual, lustful, View this entry on the original dictionary page scan.
sphuṭasiddhāntam. Name of an astronomy work View this entry on the original dictionary page scan.
śrāddhavasiṣṭhamn. Name of work View this entry on the original dictionary page scan.
śramasiddhamfn. accomplished by exertion or labour View this entry on the original dictionary page scan.
śrautasiddhāntam. Name of work View this entry on the original dictionary page scan.
śreyasitarā f. a more excellent woman View this entry on the original dictionary page scan.
śṛṅgārasiṃham. Name of a man View this entry on the original dictionary page scan.
sthaṇḍilasitakan. an altar (equals vedi-) View this entry on the original dictionary page scan.
sthūlasiktan. Name of a tīrtha- View this entry on the original dictionary page scan.
sundarasiddhāntam. Name of work View this entry on the original dictionary page scan.
suparyavasitamfn. well carried out View this entry on the original dictionary page scan.
suparyavasitārthamfn. thoroughly acquainted with anything View this entry on the original dictionary page scan.
sūpasiddhamfn. well-seasoned, made savoury or relishable View this entry on the original dictionary page scan.
suprasiddhamfn. well known View this entry on the original dictionary page scan.
suprasiddhapadamañjarīf. Name of work View this entry on the original dictionary page scan.
supratyavasitamfn. (perhaps) safely returned to one's own country View this entry on the original dictionary page scan.
śūrasiṃham. Name of an author View this entry on the original dictionary page scan.
surasindhuf. equals -sarit- View this entry on the original dictionary page scan.
surasindhuf. equals mandākinī- (Scholiast or Commentator) View this entry on the original dictionary page scan.
sūratasiṃham. Name of a king (patron of śrī-nivāsa- bhaṭṭa-) View this entry on the original dictionary page scan.
sūryasiddhāntam. a celebrated astronomical text-book (said to be a direct revelation from the Sun) View this entry on the original dictionary page scan.
sūryasiddhāntam. of another work View this entry on the original dictionary page scan.
sūryasiddhāntabhāṣyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntadīpikāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntamañjarīf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntapradīpikāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntaprakāśam. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntarahasyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntasāraṇīf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntaṭīkāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavāsanābhāṣyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyānan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyāvivaraṇan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntodāharaṇan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiṃham. Name of a king View this entry on the original dictionary page scan.
sūtakasiddhāntam. Name of work View this entry on the original dictionary page scan.
suvarcasinm. Name of śiva- (see prec.) View this entry on the original dictionary page scan.
suvarcasinm. natron, alkali View this entry on the original dictionary page scan.
suvarṇasiddham. an adept in acquiring gold by magical means View this entry on the original dictionary page scan.
suyavasinmfn. having good pasturage View this entry on the original dictionary page scan.
svabhāvasiddhamfn. established by nature, natural, innate View this entry on the original dictionary page scan.
svabhāvasiddhamfn. self-evident, obvious View this entry on the original dictionary page scan.
svārājyasiddhif. Name of a vedānta- work View this entry on the original dictionary page scan.
svarasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
svarasiddhāntakaumudīf. Name of work View this entry on the original dictionary page scan.
svarasiddhāntamañjarīf. Name of work View this entry on the original dictionary page scan.
svārasikamfn. (fr. sva-rasa-) possessing inherent flavour or sweetness (as a poem etc.) View this entry on the original dictionary page scan.
svārasikamfn. natural, self-evident View this entry on the original dictionary page scan.
svarasiṃham. Name of work View this entry on the original dictionary page scan.
svarṇasindūram. a particular medicinal preparation View this entry on the original dictionary page scan.
svārthasiddhif. (equals sādhana-) View this entry on the original dictionary page scan.
svasicmfn. pouring out spontaneously (see su-s/ic-). View this entry on the original dictionary page scan.
svasiddhamfn. spontaneously effected View this entry on the original dictionary page scan.
svasiddhamfn. naturally one's own, belonging to one's self by nature View this entry on the original dictionary page scan.
śvasitamfn. breathed, sighed etc. View this entry on the original dictionary page scan.
śvasitamfn. possessed of breath or life, vivified, revived
śvasitan. breathing, breath, respiration, sighing, a sigh View this entry on the original dictionary page scan.
svasitamfn. very black (in yata-locana-,"having very black and long eyes"), mal-. View this entry on the original dictionary page scan.
śvetasiddham. Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
śvetasiṃhīf. a kind of pot-herb View this entry on the original dictionary page scan.
tāmasikamfn. relating to the quality tamas- (q.v) View this entry on the original dictionary page scan.
asitiind. idem or 'ind. (sad-iti-) ' View this entry on the original dictionary page scan.
tejasiṃham. Name of a man (son of raṇa-dara-) View this entry on the original dictionary page scan.
tejasiṃham. see jaḥ-s-. View this entry on the original dictionary page scan.
tilakasiṃhan. Name of a man View this entry on the original dictionary page scan.
tṛṇasiṃham. "reed-lion", axe View this entry on the original dictionary page scan.
tulasimetrically for - View this entry on the original dictionary page scan.
tulasif. equals -, View this entry on the original dictionary page scan.
ucchvasitamfn. heaving, beating, breathed, inspired View this entry on the original dictionary page scan.
ucchvasitamfn. recovered, calm View this entry on the original dictionary page scan.
ucchvasitamfn. revived, refreshed, gladdened etc. View this entry on the original dictionary page scan.
ucchvasitamfn. heaving, swelling up, raised, lifted etc. View this entry on the original dictionary page scan.
ucchvasitamfn. expanded, burst, unfastened, untied View this entry on the original dictionary page scan.
ucchvasitamfn. blooming View this entry on the original dictionary page scan.
ucchvasitan. breathing out, respiration View this entry on the original dictionary page scan.
ucchvasitan. exhalation View this entry on the original dictionary page scan.
ucchvasitan. breath View this entry on the original dictionary page scan.
ucchvasitan. throbbing, sighing View this entry on the original dictionary page scan.
ucchvasitan. bursting View this entry on the original dictionary page scan.
ucchvasitan. unfastening, untying View this entry on the original dictionary page scan.
udavasitan. a house, dwelling View this entry on the original dictionary page scan.
udayasiṃham. Name of a king. View this entry on the original dictionary page scan.
ujjvalanarasiṃham. Name of a tīrtha- . View this entry on the original dictionary page scan.
ullasitamfn. shining, bright, brilliant View this entry on the original dictionary page scan.
ullasitamfn. coming forth, rising, appearing View this entry on the original dictionary page scan.
ullasitamfn. ejected, brought out View this entry on the original dictionary page scan.
ullasitamfn. drawn, unsheathed (as a sword) View this entry on the original dictionary page scan.
ullasitamfn. merry, happy, joyful View this entry on the original dictionary page scan.
ullasitamfn. moving, trembling. View this entry on the original dictionary page scan.
upahasitamfn. laughed at, derided View this entry on the original dictionary page scan.
upahasitan. laughter accompanied by shaking the head (sa-śiraḥ-kampam-) View this entry on the original dictionary page scan.
upasicP. -siñcati-, to pour upon, sprinkle View this entry on the original dictionary page scan.
upasicya ind.p. pouring on, sprinkling View this entry on the original dictionary page scan.
upasiddhamfn. (3. sidh-) ready, prepared (food; confer, compare - pasiddha-), View this entry on the original dictionary page scan.
upasidhP. (imperfect tense -asedhat-) to keep off View this entry on the original dictionary page scan.
upasiktamfn. sprinkled with View this entry on the original dictionary page scan.
upāvasitamfn. settled or abiding near by View this entry on the original dictionary page scan.
urasi(in compound for /uras-above) . View this entry on the original dictionary page scan.
urasijam. "produced on the chest", the female breast
urasikṛtyaSee /uras- above. View this entry on the original dictionary page scan.
urasilamfn. having a full or broad breast, broad-chested gaRa picchādi- View this entry on the original dictionary page scan.
urasilomanmfn. having hair on the breast commentator or commentary on View this entry on the original dictionary page scan.
urasiruham. idem or 'm. "produced on the chest", the female breast ' View this entry on the original dictionary page scan.
ūṣasikatan. granular salt View this entry on the original dictionary page scan.
vādībhasiṃham. Name of a jaina- View this entry on the original dictionary page scan.
vāgasim. "speech-sword", sharp or cutting speech View this entry on the original dictionary page scan.
vaidikasiddhāntam. Name of work View this entry on the original dictionary page scan.
vaidyanarasiṃhasenam. Name of a scholiast View this entry on the original dictionary page scan.
vaidyasika wrong reading for vaighasika- View this entry on the original dictionary page scan.
vaidyasiṃhīf. Gendarussa Vulgaris View this entry on the original dictionary page scan.
vaighasikamfn. feeding on the residue or remains of food View this entry on the original dictionary page scan.
vaikhānasim. a patronymic View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntadīpikāf. Name of work View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntatattvan. Name of work View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntavaijayantīf. Name of work View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntabhūṣaṇan. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntabhūṣaṇasāram. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntadīpikāf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntakaumudīf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntamañjūṣāf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntamañjūṣāsāram. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntaratnākaram. Name of work View this entry on the original dictionary page scan.
vajrasiṃham. Name of a king View this entry on the original dictionary page scan.
vakṣasijam. equals vakṣo-ja- View this entry on the original dictionary page scan.
vākyakaraṇasiddhāntam. Name of work View this entry on the original dictionary page scan.
vākyasiddhāntastotran. Name of work View this entry on the original dictionary page scan.
vallabhasiddhāntaṭīkāf. Name of work on bhakti-. View this entry on the original dictionary page scan.
vanakārpasi() f. the wild cotton tree. View this entry on the original dictionary page scan.
vanasindhuram. equals -karin- View this entry on the original dictionary page scan.
varcasinSee brahma-- and su-v- View this entry on the original dictionary page scan.
vārimasi(more correctly -maṣi-) f. "water-ink", a rainy cloud View this entry on the original dictionary page scan.
varivasitamfn. equals varivasyita- View this entry on the original dictionary page scan.
varṇasim. or f. (?) water View this entry on the original dictionary page scan.
vasim. or f. (for 2.See column 3) equals vastra-, clothes etc. View this entry on the original dictionary page scan.
vasim. (for 1.See column 1) dwelling or a dwelling-place View this entry on the original dictionary page scan.
vasikamfn. empty (see vaśika-, vaśin-) View this entry on the original dictionary page scan.
vasikamfn. one who sits in the padmāsana- posture View this entry on the original dictionary page scan.
vasinm. (fr. vasā-) an otter View this entry on the original dictionary page scan.
vasiram. Scindapsus Officinalis (n. its fruit) (varia lectio vasīra-and vaśira-) View this entry on the original dictionary page scan.
vasiram. Achyranthes Aspera View this entry on the original dictionary page scan.
vasiran. sea salt (varia lectio vaśira-and vaśīra-) View this entry on the original dictionary page scan.
vasiṣṭhamfn. (superl. fr. 1. v/asu-; see v/asīyas-and under3. vas-) most excellent, best, richest View this entry on the original dictionary page scan.
vasiṣṭham. (wrongly written vaśiṣṭha-),"the most wealthy", Name of a celebrated Vedic ṛṣi- or sage (owner of the"cow of plenty" , called nandinī-, offspring of surabhi-, which by granting all desires made him, as his name implies, master of every vasu-or desirable object;he was the typical representative of Brahmanical rank, and the legends of his conflict with viśvā-mitra-, who raised himself from the kingly or kṣatriya- to the Brahmanical class, were probably founded on the actual struggles which took place between the Brahmans and kṣatriya-s;a great many hymns of the are ascribed to these two great rivals;those of the seventh maṇḍala-, besides some others, being attributed to vasiṣṭha-, while those of the third maṇḍala- are assigned to viśvā-mitra-;in one of vasiṣṭha-'s hymns he is represented as king su-dās-'s family priest, an office to which viśvā-mitra- also aspired;in another hymn vasiṣṭha- claims to have been inspired by varuṇa-, and in another[ ] he is called the son of the apsaras- urvaśī- by mitra- and varuṇa-, whence his patronymic maitrāvaruṇi-;in manu- , he is enumerated among the ten prajā-pati-s or Patriarchs produced by manu- svāyambhuva- for the peopling of the universe;in the he is mentioned as the family priest of the solar race or family of ikṣvāku- and rāma-candra-, and in the purāṇa-s as one of the arrangers of the veda-s in the dvāpara- age;he is, moreover, called the father of aurva-[ ],of the sukālin-s[ ],of seven sons[ ] , and the husband of akṣa-mālā- or arundhatī-[ ]and of ūrjā-[ ];other legends make him one of the 7 patriarchal sages regarded as forming the Great Bear in which he represents the starSee ṛṣi-) etc. (see )
vasiṣṭham. Name of the author of a law-book and other works (prob. intended to be ascribed to the Vedic ṛṣi- above) View this entry on the original dictionary page scan.
vasiṣṭham. plural the family of vasiṣṭha- (vasiṣṭhasyāṅkuśaḥ-etc.Name of sāman-s ) View this entry on the original dictionary page scan.
vasiṣṭham. Name of an anuvāka- on Va1rtt. 2 View this entry on the original dictionary page scan.
vasiṣṭhan. flesh View this entry on the original dictionary page scan.
vasiṣṭha vasīyas- See p.930. View this entry on the original dictionary page scan.
vasiṣṭhabhṛgvatrisamamfn. equal to (the three great saints) vasiṣṭha- and bhṛgu- and atri- View this entry on the original dictionary page scan.
vasiṣṭhahomaprakāram. Name of work View this entry on the original dictionary page scan.
vasiṣṭhakam. the sage vasiṣṭha- (See above) . View this entry on the original dictionary page scan.
vasiṣṭhakālpam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhakaśyapikāf. a matrimonial alliance between the descendants of vasiṣṭha- and those of kaśyapa- View this entry on the original dictionary page scan.
vasiṣṭhaliṅgapurāṇan. Name of a purāṇa-. View this entry on the original dictionary page scan.
vasiṣṭhanihavam. Name of a sāman-, View this entry on the original dictionary page scan.
vasiṣṭhaprācīf. Name of a place View this entry on the original dictionary page scan.
vasiṣṭhapramukhamfn. preceded or led by vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhaputram. plural "the sons or descendants of vasiṣṭha-", Name of the authors of View this entry on the original dictionary page scan.
vasiṣṭhasaṃhitāf. View this entry on the original dictionary page scan.
vasiṣṭhasaṃsarpam. a particular catur-aha-, View this entry on the original dictionary page scan.
vasiṣṭhaśapham. dual number Name of a sāman- View this entry on the original dictionary page scan.
vasiṣṭhasiddhāntam. View this entry on the original dictionary page scan.
vāsiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhaśikṣāf. Name of a śikṣā-. View this entry on the original dictionary page scan.
vasiṣṭhaśilāf. Name of a place View this entry on the original dictionary page scan.
vasiṣṭhasmṛtif. View this entry on the original dictionary page scan.
vasiṣṭhaśrāddhakalpam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhatantran. Name of a tantra-. View this entry on the original dictionary page scan.
vasiṣṭhatvan. the state or condition of being vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhavatind. like vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhayajña(v/a-) m. Name of a particular sacrifice View this entry on the original dictionary page scan.
vasiṣṭhopapurāṇan. Name of an upapurāṇa-. View this entry on the original dictionary page scan.
vasitamfn. (for 2.See column 3) worn, put on View this entry on the original dictionary page scan.
vasitan. cloth View this entry on the original dictionary page scan.
vasitamfn. (for 1.See column 1) = 2. uṣita-, inhabiting etc. View this entry on the original dictionary page scan.
vasitamfn. stored (as grain) View this entry on the original dictionary page scan.
vasitan. abiding, abode, residence View this entry on the original dictionary page scan.
vasitavyamfn. to be worn or put on View this entry on the original dictionary page scan.
vasitṛmfn. one who wears or puts on ( vasitṛtama -tama- mfn. equals ācchādayitṛ-tama-,used to explain vasiṣṭha-) on View this entry on the original dictionary page scan.
vasitṛtamamfn. vasitṛ
vaṭeśvarasiddhāntam. Name of work View this entry on the original dictionary page scan.
vayasinSee pūrva-- and prathama-v-. View this entry on the original dictionary page scan.
vedāntasārasiddhāntatātparyan. Name of work View this entry on the original dictionary page scan.
vedāntasiddhāntam. Name of work ( vedāntasiddhāntakaumudī ta-kaumudī- f. vedāntasiddhāntacandrikā -candrikā- f. vedāntasiddhāntadīpikā -dīpikā- f. vedāntasiddhāntapradīpa -pradīpa- m. vedāntasiddhāntabheda -bheda- m. vedāntasiddhāntamuktāvalī -muktāvalī- f. vedāntasiddhāntaratnāñjali -ratnāñjali- m. vedāntasiddhāntasūktimañjarīprakāśa -kti-mañjarī-prakāśa- m.) View this entry on the original dictionary page scan.
vedāntasiddhāntabhedam. vedāntasiddhānta
vedāntasiddhāntacandrikāf. vedāntasiddhānta
vedāntasiddhāntadīpikāf. vedāntasiddhānta
vedāntasiddhāntakaumudīf. vedāntasiddhānta
vedāntasiddhāntamuktāvalīf. vedāntasiddhānta
vedāntasiddhāntapradīpam. vedāntasiddhānta
vedāntasiddhāntaratnāñjalim. vedāntasiddhānta
vedāntasiddhāntasūktimañjarīprakāśam. vedāntasiddhānta
vedāntasiṃham. Name of work (equals -śata-ślokī-), View this entry on the original dictionary page scan.
vedasif. Name of a river (varia lectio vetasinī-). View this entry on the original dictionary page scan.
vetālasiddhif. the supernatural power of a vetāla-, View this entry on the original dictionary page scan.
vetasif. Name of a place View this entry on the original dictionary page scan.
vetasif. Name of a river (see vedasinī-). View this entry on the original dictionary page scan.
vibhūrasim. (literally"thou art mighty") a form of agni- or the god of fire View this entry on the original dictionary page scan.
vicakṣaṇacanasitavatmfn. accompanied by the word vicakṣaṇa-, or canasita- View this entry on the original dictionary page scan.
vicitrasiṃham. Name of a man View this entry on the original dictionary page scan.
viḍḍasiṃham. Name of a man View this entry on the original dictionary page scan.
vidyāmātrasiddhif. View this entry on the original dictionary page scan.
vidyāmātrasiddhitridaśaśāstrakārikāf. Name of Buddhist works. View this entry on the original dictionary page scan.
vighātanasiddhif. the settling or removal of obstacles or impediments View this entry on the original dictionary page scan.
vighnasiddhif. the settling or removal of obstacles View this entry on the original dictionary page scan.
vihasitamfn. laughing, smiling View this entry on the original dictionary page scan.
vihasitamfn. laughed, smiled at View this entry on the original dictionary page scan.
vihasitan. laughter, laughing, smiling View this entry on the original dictionary page scan.
vihasitikāSee hasatikā-. View this entry on the original dictionary page scan.
vijayagovindasiṃham. Name of authors View this entry on the original dictionary page scan.
vijayasiddhif. accomplishment of victory, success View this entry on the original dictionary page scan.
vijayasiṃham. Name of various kings View this entry on the original dictionary page scan.
vikasitamfn. () opened, open, expanded, budded, blown etc. View this entry on the original dictionary page scan.
vikasitakumudendīvarālokinmfn. looking like the expanded white and blue lotus View this entry on the original dictionary page scan.
vikasitanayanavadanakamalamfn. opening (her) lotus-like eyes and mouth View this entry on the original dictionary page scan.
vikasitavadanamfn. with opened mouth View this entry on the original dictionary page scan.
vikramasiṃham. Name of a king of ujjayinī- View this entry on the original dictionary page scan.
vikramasiṃham. of a king of ujjayinī- View this entry on the original dictionary page scan.
vilasitamfn. gleaming, glittering, shining forth, appearing View this entry on the original dictionary page scan.
vilasitamfn. played, sported (n. also impersonal or used impersonally) View this entry on the original dictionary page scan.
vilasitamfn. moving to and fro View this entry on the original dictionary page scan.
vilasitan. flashing, quivering (of lightning) View this entry on the original dictionary page scan.
vilasitan. appearing, manifestation (vidyā-, v-manifestation of knowledge) View this entry on the original dictionary page scan.
vilasitan. sport play, pastime, dalliance View this entry on the original dictionary page scan.
vilasitan. any action or gesture View this entry on the original dictionary page scan.
viniśvasitan. exhalation View this entry on the original dictionary page scan.
vinodarasikamfn. given or addicted to pleasure View this entry on the original dictionary page scan.
vipravasitamfn. withdrawn, departed (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
vīraśaivasiddhāntam. Name of work View this entry on the original dictionary page scan.
vīraśaivasiddhāntaśikhāmaṇim. Name of work View this entry on the original dictionary page scan.
vīrasiṃham. Name of various kings and authors View this entry on the original dictionary page scan.
vīrasiṃhadevam. Name of the patron of mitra-- miśra- View this entry on the original dictionary page scan.
vīrasiṃhamitrodayesaṃskāraprakaraṇan. Name of work View this entry on the original dictionary page scan.
vīrasiṃhaśivendrapūjākārikāf. Name of work View this entry on the original dictionary page scan.
vīrasiṃhāvalokam. Name of work View this entry on the original dictionary page scan.
vīrasiṃhāvalokanan. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagranthālokam. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagrantharahasyan. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
viśasi gaRa brāhmaṇādi- () View this entry on the original dictionary page scan.
viśasitamfn. cut up, dissected View this entry on the original dictionary page scan.
viśasitṛm. one who cuts up, a dissector View this entry on the original dictionary page scan.
viśeṣocchvasitan. the peculiar breath or life (cherished object), a peculiar treasure (applied to an object especially dear) View this entry on the original dictionary page scan.
viśiṣṭādvaitasiddhāntam. Name of work View this entry on the original dictionary page scan.
viṣṇuguptasiddhāntam. Name of work View this entry on the original dictionary page scan.
viṣṇurāmasiddhāntavāgīśam. Name of authors View this entry on the original dictionary page scan.
visraṃsraṃsitasitāṃśukamfn. one whose white garment has slipped down View this entry on the original dictionary page scan.
viśrotasif. equals pramāda- View this entry on the original dictionary page scan.
viśuddhasiṃham. Name of a man View this entry on the original dictionary page scan.
viśvakarmasiddhāntam. Name of work View this entry on the original dictionary page scan.
viśvanāthasiṃham. Name of author. View this entry on the original dictionary page scan.
viśvanāthasiṃhadevam. Name of author. View this entry on the original dictionary page scan.
viśvapādasirogrīvamfn. one whose feet and head and neck are formed of the universe View this entry on the original dictionary page scan.
viśvasiṃham. Name of a king View this entry on the original dictionary page scan.
viśvasitamfn. full of confidence, fearless, unsuspecting View this entry on the original dictionary page scan.
viśvasitamfn. trusted, believed or confided in View this entry on the original dictionary page scan.
viśvasitavyamfn. equals śvasanīya- View this entry on the original dictionary page scan.
vivādasindhum. Name of work View this entry on the original dictionary page scan.
vivāhasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
vivekasārasindhum. Name of work View this entry on the original dictionary page scan.
vivekasindhum. Name of work View this entry on the original dictionary page scan.
vorasiddhiSee bora-s-. View this entry on the original dictionary page scan.
vṛddhavasiṣṭham. the older vasiṣṭha- or an older recension of vṛddha-'s law-book View this entry on the original dictionary page scan.
vṛndasindhum. Name of medical work View this entry on the original dictionary page scan.
vyadhyasiramfn. vyadhya
vyākaraṇasiddhamfn. established by grammar, grammatical View this entry on the original dictionary page scan.
vyāsādipañcasiddhāntam. plural Name of work View this entry on the original dictionary page scan.
vyāsasiddhāntam. Name of work View this entry on the original dictionary page scan.
vyasimfn. swordless View this entry on the original dictionary page scan.
vyasi vy-asu- etc. See .
vyavasitamfn. finished, ended, done View this entry on the original dictionary page scan.
vyavasitamfn. decided, determined, resolved, undertaken (also n. impersonal or used impersonally;with dative case or infinitive mood) etc. View this entry on the original dictionary page scan.
vyavasitamfn. one who has resolved upon or is determined or willing to (locative case, dative case,or infinitive mood) View this entry on the original dictionary page scan.
vyavasitamfn. settled, ascertained, known (n. impersonal or used impersonally), convinced or sure of anything (with samyak-,"one who has ascertained what is right";with accusative,"one who has acknowledged anything as true") View this entry on the original dictionary page scan.
vyavasitamfn. deceived, tricked, cheated, disappointed View this entry on the original dictionary page scan.
vyavasitamfn. energetic, persevering, making effort or exertion View this entry on the original dictionary page scan.
vyavasitan. resolution, determination View this entry on the original dictionary page scan.
vyavasitan. an artifice, contrivance View this entry on the original dictionary page scan.
vyavasitavaseyan. (impersonal or used impersonally) it is to be settled or determined View this entry on the original dictionary page scan.
vyavasitavasitif. ascertainment, determination, resolution View this entry on the original dictionary page scan.
yajñasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
yajñasiddhāntavigraham. Name of work View this entry on the original dictionary page scan.
yajñasiddhif. Name of work View this entry on the original dictionary page scan.
yaśasinmfn. See deva-- and manuṣya-yaśas/in-. View this entry on the original dictionary page scan.
yathāvyavasitamind. as has been determined View this entry on the original dictionary page scan.
yāvasikam. a mower of grass View this entry on the original dictionary page scan.
yavasinSee -yavas/in-, -yavasy/u-. View this entry on the original dictionary page scan.
yogasiddhamfn. perfected by means of Yoga View this entry on the original dictionary page scan.
yogasiddham. Name of an author View this entry on the original dictionary page scan.
yogasiddhāf. Name of a sister of bṛhas-pati- View this entry on the original dictionary page scan.
yogasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
yogasiddhāntapaddhatif. Name of work View this entry on the original dictionary page scan.
yogasiddhif. simultaneous accomplishment View this entry on the original dictionary page scan.
yogasiddhimatmfn. experienced in the art of magic View this entry on the original dictionary page scan.
yogasiddhiprakriyāf. Name of work View this entry on the original dictionary page scan.
Apte Search
100 results
atasi अतसिः Ved. [अत्-असिच्] A wandering mendicant. कन्नव्यो अतसीनां तुरो गृणीत मर्त्यः Rv.8.3.13.
atasi अतसिका Flax; Bhāg 3.28.24. see अतसी 2.3.
atiśreyasi अतिश्रेयसिः [श्रेयसीमतिक्रान्तः] A man superior to the most excellent woman.
adhyavasita अध्यवसित p. p. Attempted, mentally apprehended, determined.
adhyavasin अध्यवसिन् a. One who observes a vow, धर्माश्रमे$- ध्यवसिनां ब्राह्मणानां युधिष्ठिरः Mb.12.64.6.
anavasita अनवसित a. [न. त.] Not ended or finished; not determined. -ता N. of a kind of Triṣṭubh metre, consisting of four lines with 11 feet in each.
aniravasita अनिरवसित a. [P. P. of निर् + अव + सो 4 P.] Śūdras who are not expelled (from dish), i. e. those Śūdras who are not regarded so low as to defile the plates and vessels permanently in which they might have taken their meal. cf. पात्रादनिरवसितानाम् । यैक्ते पात्रं संस्कारेण शुध्यति ते अनिरवरिताः । यैर्भुक्ते पात्रं संस्कारेणापि न सुध्यति ते निर- वसिताः शूद्राणामनिरवसितानाम्; (P.II.4.1 Sk.).
anurasita अनुरसित a. Sounding, echoing; उद्ग्रीवैरनुरसितस्य पुष्करस्य M.1.21 accompanied in sound.
anuvasita अनुवसित a. [वस्-क्त] 1 Dressed, clothed, wrapped up. -2 Fastened, or bound to, attached to.
anvavasita अन्ववसित a. Connected with, bound or fastened to.
apasiddhāntaḥ अपसिद्धान्तः A wrong or erroneous conclusion; सिद्धा- न्तमभ्युपेत्यानिथमात् कथाप्रसङ्गो$पसिद्धान्तः Gaut. S.
apahasitam अपहसितम् हासः Silly or causeless laughter; often laughter with tearful eyes (नीचानामपहसितम्).
aprasiddha अप्रसिद्ध a. 1 Unknown, unimportant, insignificant अप्यप्रसिद्धं यशसे हि पुंसाम् Ku.3.19. -2 Unusual, uncommon; ˚पदम् an obsolete word.
aprasiddhiḥ अप्रसिद्धिः f. Obscurity, insignificance.
arasika अरसिक a. 1 Devoid of taste, sapless, insipid, flavourless (of a thing). -2 Void of feeling or taste, dull, unfeeling, inappreciative, insensible to the charms (of poetry &c.); अरसिकेषु कवित्वनिवेदनं शिरसि मा लिख मा लिख मा लिख Udb.
āndhasikaḥ आन्धसिकः [अन्धो भक्तं शिल्पमस्य ठक्] A cook.
āmbhasika आम्भसिक a. (-की f.) [अम्भसी वर्तते ठक्] Acquatic. -कः A fish.
āvasita आवसित [आ-अव-सो-क्त] 1 Finished or completed. -2 Decided, determined, settled. -3 Stored (as grain); winnowed. -4 Ripe, full-grown. -तम् Ripe corn when (thrashed.)
ucchvasita उच्छ्वसित p. p. (Used actively). 1 Heaving, breathing; U.3. -2 Emitting or sending out vapour (refreshed); V.4. -3 Full blown, opened, expanded; Māl.4; ˚मूर्तिः K.92 raised up, Ch. P.13. -4 (a) Enlivened, gladdened, refreshed; त्वन्निष्यन्दोच्छ्वसित- वसुधागन्धसंपर्करम्यः Me.44. (b) Inspired or animated with hope; कामस्योच्छ्वसितं मनः Ku.6.14. -5 Breathing a sigh of relief; हृदयमुच्छ्वसितं मम विक्लवम् M.3.6; R.1.73; K.181. -6 Consoled; उत्कण्ठोच्छ्वसितहृदया Me.12. -7 Waving, dishevelled; ˚अलकम् R.8.55. -8 Effaced; (सम्˚) किंचित्समुच्छ्वासितपत्रलेखनम् Ku.3.38. -तम् 1 Breath, the (very) life; सा कुलपतेरुच्छ्वसितमिव Ś.3; Ku.7.4. -2 Blooming, blowing. -3 Exhalation; विशदोच्छ्वसितेन मेदिनी कथयामास कृतार्थतामिव R.8.3. -4 Heaving upheaval, throbbing; केयूरबन्धोच्छ्वसितैर्नुनोद R.6.68; V.1. -5 Becoming loose or relaxed. -6 Sighing. -7 The vital airs of the body.
udavasitam उदवसितम् [उद्-अव-सो-क्त] A house, dwelling; जानीषे रेभिलस्योदवसितम् Mk.4; Śi.11.18.
upasi उपसि ind. Ved. In the lap, on the hip; near, at hand; पितुर्न पुत्र उपसि प्रेष्ठः Rv.
upahasita उपहसित p. p. Ridiculed, derided. -तम् Satirical laughter, ridicule.
urasiloman उरसिलोमन् a. Having hair on the breast.
ullasita उल्लसित p. p. 1 Shining, brilliant, splendid. -2 Happy, delighted. -3 Drawn up, uplifted, brandishing (as a sword.) ददृशुरुल्लसितासिलतासिताः Śi.6.51. -4 Gleaming, fluttering. ˚हरिणकेतनः रथः V.1.
aujasika औजसिक a. (-की f.) [औजसा वर्तते ठक्] Energetic, vigorous, acting with strength. -कः A hero.
aupacchandasikam औपच्छन्दसिकम् N. of a metre; see App.
auṣasika औषसिक औषिक a. (-की f.) 1 Walking out at day-break. -2 Early born or produced at dawn.
kasipuḥ कसिपुः Food, boiled rice.
grasiṣṇu ग्रसिष्णु a. Accustomed to swallow; भूतभर्तृ च यज्ज्ञेयं ग्रसिष्णु प्रभविष्णु च Bg.13.16. -m. The Supreme Soul.
ghasi घसिः Ved. Food.
canasita चनसित a. Ved. Delighted, satisfied, pleased.
camasi चमसिः f. A kind of cake.
caittasika चैत्तसिक a. Relating to the mind.
tāmasika तामसिक a. (-की f.) [तमसा निर्वृत्तं ठञ्] 1 Dark. -2 Belonging to, derived from, or connected with तमस्.
tulasi तुलसि (Metrically for तुलसी), -तुलसिका See तुलसी; वाचश्च नस्तुलसिवद्यदि ते$ङ्घ्रिशोभाः Bhāg.3.15.49; तुलसिका- दूर्वाङ्कुरैरपि... परितुष्यसि 5.3.6.
daivasika दैवसिक a. Happening in one day; इत्युक्त्वा ब्राह्मणाय दैवसिकामुत्पत्तिं प्रादात् Mb.3.196.13.
dhvasira ध्वसिर a. Ved. Destroyed; also ध्वस्मन्, ध्वस्र.
namasita नमसित नमस्यित a. Revered, respected, saluted.
nārasiṃha नारसिंह a. (-ही f.) Pertaining to Narasimha. -हः 1 An epithet of Viṣṇu. -2 The 16th period of the world (कल्प). -Comp. -चूर्णम् N. of a particular aphrodisiac.
niḥśvasita निःश्वसित p. p. 1 Breathed out, sighed. -2 Sighing. -तम् 1 Expiration. -2 A sigh; स्तनकम्पक्रियालक्ष्यैर्नस्तं निःश्वसितैरिव (हृदयम्) V.2.19. निःश्वासः niḥśvāsḥ निश्वासः niśvāsḥ निःश्वासः निश्वासः 1 Breathing out, expiration. -2 Sighing, a sigh, breath. -Comp. -परम a. melancholy.
panasi पनसिका Pustules on the ears and neck.
paryavasita पर्यवसित p. p. 1 Finished, ended, completed. -2 Perished, lost. -3 Determined. -Comp. -मति a. thoroughly acquainted.
pāyasika पायसिक a. (-की f.) Fond of boiled milk; P.IV. 2.47; Vārt.17.
pārasikaḥ पारसिकः 1 Persia. -2 = पारसीक 2 q. v.
paiṭhīnasi पैठीनसिः N. of an ancient sage, author sage, author of a system of laws. पैण़्डिक्यम् paiṇ&tod;ḍikyam पैण्डिन्यम् paiṇḍinyam पैण़्डिक्यम् पैण्डिन्यम् Living on alms, mendicity.
pratyavasita प्रत्यवसित a. 1 Eaten, drunk. -2 Relapsed into the old (bad) way of life; ये प्रत्यवसिताश्चैव ते वै निरयगामिनः Mb.13.23.67. प्रत्यवस्कन्दः pratyavaskandḥ दनम् danam प्रत्यवस्कन्दः दनम् (In law) A special plea; admitting a fact, but qualifying it in such a manner that it may not appear as a count of accusation.
prasita प्रसित p. p. 1 Bound, fastened. -2 Devoted to, engaged in, occupied with; प्रसितावुदयापवर्गयोरुभयीं सिद्धिमुभाववा- पतुः R.8.23. -3 Intent on, longing for, craving after (with instr. or loc.); क्षितिपतेः प्रसितो वरिवस्यया Rām. Ch. 4.85; लक्ष्म्या लक्ष्म्यां वा प्रसितः Sk.; R.8.23. -4 Very clear. -तम् Pus, matter.
prasitiḥ प्रसितिः f. 1 A net. -2 A ligament. -3 A tie, fetter. -4 An attack, assault. -5 A throw, shot. -6 Reach, extent. -7 A series, succession. -8 Power, authority, influence. -9 Ved. A flame. -1 A track, path.
prasidh प्रसिध् 4 P. 1 To be accomplished or effected; शरीर- यात्रापि च ते न प्रसिध्येदकर्मणः Bg.3.8. -2 To succeed. -3 To be made known. -4 To be got or obtained; तपसैव प्रसिद्ध्यन्ति तपस्तेषां हि साधनम् Ms.11.237. -5 To be established. -6 To be decorated.
prasiddha प्रसिद्ध p. p. 1 Renowned, famous, celebrated. -2 Decorated, ornamented, adorned; सालक्तकौ भूपतयः प्रसिद्धै- र्ववन्दिरे मौलिभिरस्य पादौ R.18.41; यथा प्रसिद्धैर्मधुरं शिरोरुहैः Ku.5.9;7.16. -3 Excellent; द्रव्यैः प्रसिद्धैर्मद्यागः प्रतिमादिष्व- मायिनः । भक्तस्य च यथालब्धैर्हृदि भावेन चैव हि ॥ Bhāg.11.27. 15. -द्धा A particular measure in music.
prasiddhiḥ प्रसिद्धिः f. 1 Fame, celebrity, publicity, renown. -2 Success, accomplishment, fulfilment; आधिद्विषामा तपसां प्रसिद्धेः Ki.3.39; Ms.4.3; Bhāg.11.3.3. -3 Ornament, decoration.
prahasita प्रहसित p. p. 1 Laughing. -तम् 1 Laughter, mirth. -2 Displaying bright gaudy colours; Jātakam.
prātidaivasika प्रातिदैवसिक a. (-की f.) Occurring daily.
bhasita भसित a. Reduced to ashes; यस्त्वन्तकाल इदमात्मकृतं स्वनेत्रवह्निस्फुलिङ्गशिखया भसितं न वेद Bhāg.8.7.32. -तम् Ashes; अनलभसितजालास्पदमभूत् Bv.1.84; भसितोद्धूलनविधिम् Sundaralaharī 2. भस्त्रका bhastrakā भस्त्रा bhastrā भस्त्रिः bhastriḥ भस्त्रका भस्त्रा भस्त्रिः f. [भस्-ष्ट्रन्] 1 A bellows; भस्त्राः किं न श्वसन्त्युत Bhāg.2.3.18. -2 A leathern vessel for holding water. -3 A pouch, leathern bag; भस्त्रा माता पितुः पुत्रो येन जातः स एव सः Mb.1.74.1; Bhāg.9.2.21.
manasija मनसिज a. [मनसि जायते जन्-ड अलुक्˚] Mind-born, mental. -जः 1 The god of love; मनसिजरुजं सा वा दिव्या ममालमपोहितुम् R.18. 52. -2 Love, passion; मनसिजरुजं सा वा दिव्या ममालमपोहितुम् V.3.1; समस्तापः कामं मनसिजनिदाघप्रसरयोः Ś.3.9. -3 The moon.
manasiśayaḥ मनसिशयः 1 The god of love; मनसिशयमहास्त्रमन्यथामी न कुसुमपञ्चकमप्यलं विसोढुम् Śi.7.2. -2 The moon.
masi मसिः m. f. 1 Ink. -2 Lampblack, soot. -3 A black powder used to paint the eyes; अस्रैरुपात्तमषिभिः कुचकुङ्कु- मानि (मृजन्त्यः) Bhāg.1.29.29. -Comp. -आधारः, -कूपी, -धानम्, -धानी, -मणिः an ink-bottle, an ink-stand. -जलम् ink. -पण्यः a writer, scribe. -पथः a pen. -प्रसूः f. 1 a pen. -2 an ink-bottle. -लेख्यदलः a particular palm-leaf (for writing). -वर्ण a. black as ink, inky. -वर्धनम् myrrh.
masikaḥ मसिकः A serpent's hole.
masina मसिन a. Pounded, well-grounded. -नम् kinship through the right of presenting the पिण्ड to the common progenitor (सापिण्ड्य).
mānasika मानसिक a. (-की f.) 1 Mental, spiritual. -2 Imaginary. -3 Committed in thought (as a sin). -कः An epithet of Viṣṇu.
yāvasikaḥ यावसिकः A mower of grass.
rasika रसिक a. [रसो$स्त्यस्य ठन्] 1 Savoury, sapid, tasteful. -2 Graceful, elegant, beautiful. -3 Impassioned. -4 Apprehending flavour or excellence, possessed of taste, appreciative, discriminating; तद् वृत्तं प्रवदन्ति काव्यरसिकाः शार्दूलविक्रीडितम् Śrut.4. -5 Finding pleasure or taking delight in, delighting in, devoted to (usually in comp.); इयं मालती भगवता सदृशसंयोगरसिकेन वेधसा मन्मथेन मया च तुभ्यं दीयते Māl.6; so कामरसिकः Bh.3.112; परोपकाररसिकस्य Mk.6.19. -6 Humorous, witty. -7 Fanciful. -8 Lustful. -कः 1 A man of taste or feeling, an appreciator of excellence or beauty; cf. अरसिक. -2 A libertine. -3 An elephant. -4 A horse. -5 The Sārasa bird. -का 1 The juice of sugar-cane, molasses. -2 The tongue. -3 A woman;s girdle; see रसाला also.
rasikatā रसिकता त्वम् 1 Taste, feeling. -2 Tastefulness. -3 Appreciative power.
rasita रसित p. p. 1 Tasted. -2 Having flavour or senti ment. -3 Gilded. -4 Sounded, making indistinct sound. -तम् 1 Wine or liquor. -2 A cry, roar, roaring noise, sound or noice in general हेरम्बकण्ठरसितप्रतिमानमेति Māl. 9.3. -3 Thunder; जीमूतजालरसितानुकृतिर्निनादः Māl.6.4.
rasin रसिन् a. 1 Juicy, liquid. -2 Impassioned, full of feeling. -3 Tasteful, savoury.
lasi लसिका Spittle, saliva.
lasita लसित p. p. [लस्-क्त] Played, sported, appeared, manifested, skipping about &c.; see लस्.
varivasi वरिवसि (स्यि) त a. Worshipped, honoured, adored, revered.
varivasitṛ वरिवसितृ a. Worshipper; न तच्चित्रं तस्मिन् वरिवसितरि त्वच्चरणयोर्न कस्या उन्नत्यै भवति शिरसस्त्वय्यवनतिः Śiva-mahimna 13.
varṇasi वर्णसिः [Uṇ.4.118] 1 Water. -2 A lotus.
vasi वसिः [वस्-इन् Uṇ.4.151] 1 Clothes. -2 A dwelling, an abode.
vasita वसित p. p. 1 Worn, put on. -2 Dwelling. -3 Stored (as grain). -तम् Abode, residence.
vasin वसिन् m. An otter.
vasiram वसिरम् Sea-salt.
vasiṣṭhaḥ वसिष्ठः (also written वशिष्ठ) N. of a celebrated sage, the family priest of the solar race of kings, and author of several Vedic hymns, particularly of the seventh Maṇḍala of the Rigveda. He was the typical representative of true Brāhmanic dignity and power, and the efforts of Viśvāmitra to rise to his level from the subject of many legends; cf. विश्वामित्र. -2 N. of the author of a Smṛiti (sometimes ascribed to the sage himself). -ष्ठम् Flesh.
vikasita विकसित p. p. Blown, fully opened or expanded; विकसितवदनामनल्पजल्पे$पि Bv.1.1.
vipravasita विप्रवसित p. p. Withdrawn, departed; भिक्षुभिर्विप्र- वसिते Bhāg.1.6.2.
vibhūrasi विभूरसिः The god of fire.
vilasita विलसित p. p. 1 Glittering, shining, gleaming. -2 Appeared, manifested; तया विलसितेष्वेषु गुणेषु गुणवनिव Bhāg.1.2.31. -3 Sportive, wanton. -तम् 1 Glittering, gleaming. -2 A gleam, flash; रोधोभुवां मुहुरमुत्र हिरण्मयीनां भासस्तडिद्विलसितानि विडम्बयन्ति Ki.5.46; Me.83; V.4. -3 Appearance, manifestation; as in अज्ञानविलसितम् &c. -4 Sport, play; dalliance, amorous or wanton gesture (fig. also); अतिपिशुनानि चैकान्तनिष्ठुरस्य दैवहतकस्य विलसितानि K. -5 Action or gesture in general. -6 Effect, fruit, result; सुकृतविलसितानां स्थानमूर्जस्वलानाम् Māl.2.9.
viśasitṛ विशसितृ m. A dissector; Ms.5.51.
viśvasita विश्वसित p. p. 1 Full of confidence, fearless. -2 Trusted.
vaighasika वैघसिक a. Feeding on the residue of food (a class of hermits); Mb.14.92.7.
vyavasita व्यवसित p. p. 1 Endeavoured, attempted; स्वजनमनु- गन्तुं व्यवसिता Ś.6.9. -2 Undertaken. -3 Resolved, determined, settled. -4 Devised, planned. -5 Endeavouring, resolving. -6 Persevering, energetic. -7 Cheated, deceived. -8 Convinced, sure (of anything); सम्यग्व्यवसिता बुद्धिस्तव राजर्षिसत्तम Bhāg.1.1.15. -तम् Ascertainment, determination; यत्ते व्यवसितं तात तदस्माकमपि प्रियम् Mb.6.119.37. -2 An artifice, contrivance.
vyavasitiḥ व्यवसितिः 1 Determination. -2 Endeavour; भूम्नौत्सुक्यानुरूपव्यवसितिरधिकं पर्यवप्लुत्य गत्वा Mv.6.51.
śirasijaḥ शिरसिजः The hair of the head; श्लथशिरसिजपाशपात- भारात् Śi.7.62. -Comp. -पाशः a tuft of hair.
śvasita श्वसित p. p. [श्वस्-क्त] 1 Breathed, sighed. -2 Breathing. -तम् 1 Breathing, respiration. -2 Sighing.
saṃprasiddhiḥ संप्रसिद्धिः Success, good luck.
sarasi सरसि (सी) कः The Sārasa bird (crane).
sarṇasi सर्णसिः m. [Uṇ.4 111] Water.
sānasi सानसिः Gold.
sārasi सारसिका A female (Indian) crane; कामे कान्ते सार- सिकाकाकुरुतेन Śi.6.76.
sāhasika साहसिक a. (-की f.) [साहसे प्रसृतः ठक्] 1 Using great force or violence, brutal, violent, rapacious, cruel, felonious. -2 Bold, daring, rash, inconsiderate, reckless; न सहास्मि साहसमसाहसिकी Śi.9.59; केचित्तु साहसिकास्त्रि- लोचनमिति पेठुः Malli. on Ku.3.44. -3 Castigatory, punitive. -कः 1 A bold or adventurous person, an enterprising man; भयमतुलं गुरुलोकात् तृणमिव तुलयन्ति साधु साहसिकाः Pt.5.31. -2 A desperado, desperate or dangerous person; या किल विविधजीवोपहारप्रियेति साहसिकानां प्रवादः Māl. 1; साहसिकः खल्वेषः 6. -3 A felon, freebooter, robber. -4 An adulterer. -कम् A bold, daring action; सुग्रीव एव विक्रान्तो वीर साहसिकप्रिय Rām.4.23.4.
sāhasikyam साहसिक्यम् 1 Rashness, temerity. -2 Violence, force; P.I.3.32.
sāhasin साहसिन् a. [साहस-इनि] 1 Violent, ferocious; cruel. -2 Bold, daring, rash, impetuous; क्रियाफलमविज्ञाय यतते साहसी च सः.
svārasika स्वारसिक a. (-की f.) 1 Possessing inherent flavour or sweetness (said of a poetical composition). -2 Voluntary, spontaneous; विधेरपि स्वारसिकः प्रयासः परस्परं योग्यसमागमाय N.3.48.
hasi हसिका Laughter, derision.
hasita हसित p. p. [हस्-कर्तरि क्त] 1 Laughed, laughing. -2 Blown, expanded. -तम् 1 Laughter. -2 Joke, jesting; कीर्तितानि हसिते$पि तानि यं व्रीडयन्ति चरितानि मानिनम् Ki.13.47. -3 The bow of the god of love.
hrasita ह्रसित p. p. 1 Sounded. -2 Shortened, curtailed.
hrasiman ह्रसिमन् m. Smallness, shortness.
hrasiṣṭha ह्रसिष्ठ a. (Superl. of ह्रस्व) Shortest, smallest.
Macdonell Vedic Search
4 results
asita ás-ita, (pp.) a. black, iv. 51, 9.
prasiti prá-siti, f. toils, x. 34, 15 [si bind].
vasiṣṭha vás-iṣṭha, spv. a. best; m. name of a seer, vii. 86, 5; pl. a family of ancient seers, x. 15, 8 [vasshine].
sānasi sān-as-í, a. bringing gain, iii. 59, 6 [san gain].
Macdonell Search
45 results
asi m. sword.
asiddha pp. not established: -tva, n. inconclusiveness.
asiddhi f. non-attainment, failure; inconclusiveness.
asidhārā f. sword-blade: -vrata, n. vow of lying with a sword between oneself and a woman=excessively difficult under taking; -dhenu, -kâ, f. knife.
asiknī f. (of ásita) night.
asikta pp. unwatered.
asiṃhāsana a. throneless.
asinva a. insatiable.
asipattra n. sword-blade; m. a tree; -vana, n. a certain hell; -putrikâ, f. knife.
asita a. (â or -iknî) dark-coloured, black; m. N.: -paksha, m. dark half of a month; -pîtaka, a. (ikâ) dark yellow; -½as man, m. sapphire; -½îkshana, a. black-eyed; -½utpala, n. blue lotus.
asita pp. unrestrained.
atihasita (pp.) n. immoderate laughter.
atyasita a. extremely black.
adhyavasita pp. √ sâ.
anāyasita pp. not drawn (bow); -kârmuka, a. not plying his bow strenuously.
arasika a. unaesthetic.
udavasita (pp.) n. dwelling, house.
ullasita ul-las-ita, ullāsita pp. √ las.
kāmarasika a. indulging in love; libidinous; -rûpa, n. any form desired; a. assuming any form at will; m. pl. N. of a people in western Assam; -rûpin, a. id.; -vat, a. enamoured; -varsha, a.raining as desired; -vâda, m. talking as one lists; -vâs in, a. changing one's abode at pleasure; -vritta, pp. indulging one's desires, pleasure-loving; -sara, m. arrow of Kâma; -sâsana, m. ep. of Siva; -sâstra, n. treatise on love, T. of various works; -sû, a. granting desires; -sûtra, n. a Sûtra treating of love; -haituka, a. caused by desire only.
ṭasat tasat, ṭasiti ij. bang!
durgasiṃha m. N. of an astronomer, & of a grammarian; -sena, m. N. of an author.
upasindhu ad. near the Indus.
dharṇasi a. strong, vigorous.
dhvasira a. bestrewn, covered; dusty, obscured; -ti, f. disappearance; one of the four states of a Yogin in which all the consequences of actions disappear; -ra, a. withered; falling off.
paṭhitasiddha pp. taking effect as soon as repeated.
praśvasitavya fp. n. imps. one should restore or revive any one (g.) by means of (in.); -svâsa, m. inhalation.
prasita pp. (√ si) devoted to, intent on (in. or lc.); (á)-siti, (V.) f. onward rush (of fire); onset; shot, missile; extension, sphere; duration; dominion, power; -siddha, pp. √ sidh: -tâ, f., -tva, n.notoriousness; -siddhi, f. accomplishment, success; proof; current opinion, general acceptation; publicity, no toriousness; fame, celebrity: -m utpâdya, having spread the rumour; ato me sasa&ndot;ka iti prasiddhih, therefore I am generally known as Sasa&ndot;ka: -mat, a. universally known, famous.
bhasita (pp.) n. ashes (C.).
manasija m. (born in the heart), love, passion; god of love; moon: -taru, m. tree of love, -rug, f. pain of love; -saya, m. (lying in the heart), love; god of love.
mānasika a. mental; imaginary; m. ep. of Vishnu.
rasita (pp.) n. roar, yell, cry; re verberation, thunder; rattle, jingle; -i-tri, m. 1. roarer; 2. taster; -ín, a. juicy; pos sessed of taste, aesthetic.
rasika a. possessed of taste, aesthetic; having a taste for or a sense of, fond of, appre ciating, understanding (lc., --°ree;); having a special taste or hobby; devoted to (lc., --°ree;); tasteful: -tâ, f. tasteor fondness for (lc.), -tva, n. devotion, addiction.
lasi f. saliva, spittle.
vasiṣṭha spv. [brightest: √ 1. vas] best, most excellent, wealthiest (V., E.); m. N. of one of the leading Vedic Rishis, com- poser of the seventh Mandala of the RV.; in C. he is regarded as one of the seven Rishis and is mentioned as a lawgiver (often incor rectly spelt Vasishtha).
vyasi a. swordless (sheath); -½asu, a. lifeless, dead; -½asta, pp. √ 2. as: -pada, n. counter-plaint.
śirasija m. (produced on the head), hair of the head.
śvasita pp. n. breathing, breath (sts. pl.).
sarasija a. produced or living in pools; n. lotus; -ganman, m. ep. of Brah man; -ga-mukhî, f. lotus-faced woman; -ga½akshî, f. lotus-eyed woman; -ruha, n. lotus.
sānasi (RV.) a. [√ san] winning or laden with spoils, victorious (steed, car); bringing blessings.
sārasi f. female crane.
sāhasika a. (î) committing or guilty of violence; bold, daring; rash, reck less; m. desperado, robber; N. of a cook: -tâ, f. daring; -in, a. committing violence; over-exerting oneself.
sauyavasi m. (V.) pat. fr. Suyavasa.
sparśarasika a. fond of sensa tion, sensual, lustful; -vat, a. tangible; plea sant to the touch; -samkârin, a. transmitted by contact, infectious (disease); -½anukûla, a. pleasant to the touch, cooling.
svasita a. beautifully black.
svārasika a. [sva-rasa] natural, self-evident.
Vedic Index of
Names and Subjects
45 results10 results
asi Usually denotes the sacrificial knife,but occasionally appears to mean a knife used in war. Mention is made of a sheath (vavri) to which a belt (vāla) was attached. The word asi-dhārā also denotes ‘sheath.’
asiknī (‘Black’) is the name in the Rigveda of the river known later as Candra-bhāgā, and to the Greeks as Akesines, now the Chenab in the Punjab.
asita Is a name of the ‘ black snake,’ referred to in the later Samhitās.
asita A mythical sage of this name figures as a magician in the Atharvaveda in conjunction with Gaya1 or with Jamadagni.2 In the śatapatha Brāhmana3 he appears as
asita varṣagaṇa is a pupil of Harita Kaśyapa according to the Vamśa or Genealogy in the Brhadāranyaka Upanisad
asitamṛga is the designation in the Aitareya Brāhmana1 of a family of the Kaśyapas who were excluded from a sacrifice by Janamejaya, but who took away the conduct of the offering from the Bhūtavīras, whom the king employed. In the Jaiminīya Brāhmana[1] and the Sadvimsa Brāhmana[2] the Asita- mrgas are called 4 sons of the Kaśyapas,’ and one is mentioned as Kusurubindu4 Auddālaki.
daśonasi Is the name of a kind of snake in the Atharvaveda. The reading of the Paippalāda recension is Naśonaśī.
prasiti In the Vājasaneyi Samhitā and the Taittirīya Brāhmana denotes a divine ‘ missile,’ but does not seem to be used of human combatants.
vasiṣṭha Is the name of one of the most prominent priestly figures of Vedic tradition. The seventh Maṇdala of the Rigveda is ascribed to him ; this ascription is borne out by the fact that the Vasisthas and Vasistha are frequently mentioned in that Maṇdala, besides being sometimes referred to elsewhere. That by the name Vasiṣçha a definite individual is always meant is most improbable, as Oldenberg shows; Vasiṣtha must normally mean simply ‘ a Vasiṣtfia.’ But it is not necessary to deny that a real Vasiṣtha existed, for one hymn seems to show clear traces of his authorship, and of his assist­ance to Sudās against the ten kings. The most important feature of Vasiṣtha’s life was apparently his hostility to Viśvāmitra. The latter was certainly at one time the Purohita (‘ domestic priest ’) of Sudās, but he seems to have been deposed from that post, to have joined Sudās’ enemies, and to have taken part in the onslaught of the kings against him, for the hymn of Sudās’ triumph has clear references to the ruin Viśvāmitra brought on his allies. Oldenberg, however, holds that the strife of Viśvāmitra and Vasistha is not to be found in the Rigveda. On the other hand, Geldner is hardly right in finding in the Rigveda a compressed account indicating the rivalry of śakti, Vasiṣṭha’s son, with Viśvāmitra, the acquisition by Viśvāmitra of special skill in speech, and the revenge of Viśvāmitra, who secured the death of śakti by Sudās’ servants, an account which is more fully related by Sadguruśiṣya, which appeared in the śātyāya- naka, and to which reference seems to be made in the brief notices of the Taittirīya Samhitā and the Pañcavimśa Brāhmaṇa regarding Vasiṣtha's sons having been slain, and his overcoming the Saudāsas. But it is important to note that no mention is made in these authorities of Sudās himself being actually opposed to Vasistha, while in the Aitareya Brāhmaṇa Vasiṣtha appears as the Purohita and consecrator of Sudās Paijavana. Yāska recognizes Viśvāmitra as the Purohita of Sudās; this accords with what seems to have been the fact that Viśvāmitra originally held the post. Probably, however, with the disappearance of Sudās, Viśvāmitra recovered his position, whereupon Vasiṣtha in revenge for the murder of his sons secured in some way unspecified the defeat of the Saudāsas. At any rate it is hardly necessary to suppose that the enmity of the Saudāsas and Vasiṣthas was permanent. There is evidence that the Bharatas had the Vasisthas as Purohitas, while other versions regard them as Purohitas for people (prajāh) generally. It seems that the Vasiṣthas were pioneers in adopting the rule that Purohitas should act as Brahman priest at the sacrifice: the śatapatha Brāhmaṇa states that the Vasiṣthas were once the only priests to act as Brahmans, but that later any priest could serve as such. A rivalry with Jamadgni and Viśvāmitra is reported in the Taittirīya Samhitā. Parāśara and śatayātu are associated with Vasiṣtha in the Rigveda, being apparently, as Geldner thinks, the grandson and a son of Vasiṣtha. According to Pischel, in another hymn, Vasiṣtha appears as attempting to steal the goods of his father Varuṇa; Geldner also shows that the Rigveda contains a clear reference to Vasistha’s being a son of Varuṇa and the nymph Urvaśī. Perhaps this explains the fact that the Vasiṣthas are called the Tptsus in one passage of the Rigveda; for being of miraculous parentage, Vasistha would need adoption into a Gotra, that of the princes whom he served, and to whom Agastya seems to have introduced him. There are numerous other references to Vasistha as a Ṛṣi in Vedic literature, in the Sūtras, and in the Epic, where he and Viśvāmitra fight out their rivalry.
sauyavasi ‘Descendant of Suyavasa,’ is the patronymic of Ajīgarta.
Bloomfield Vedic
45 results10 results90 results
asi kṣattā vāmasya deva bhūreḥ RV.6.13.2d; MS.4.10.1d: 143.4; Apś.5.23.9d.
asi grāmeṣv avitā purohitaḥ RV.1.44.10c.
asi trito guhyena vratena RV.1.163.3b; VS.29.14b; TS.; KS.40.6b.
asi tvaṃ vikṣu mānuṣīṣu hotā RV.10.1.4d.
asi tvaṃ tasya dūṣaṇaḥ AVP.7.7.4c.
asi dabhrasya cid vṛdhaḥ RV.1.81.2c; AVś.20.56.2c; SV.2.353c.
asi pratūrtaye nṛbhiḥ RV.1.129.2c.
asi praśardha turvaśe RV.8.4.1d; AVś.20.120.1d; SV.1.279d; 2.581d.
asi priyo no atithiḥ RV.6.2.7b.
asi bhago asi dātrasya dātā RV.9.97.55c.
asi bhūri parādadiḥ RV.1.81.2b; AVś.20.56.2b; SV.2.353b.
asi maghavā maghavadbhya indo RV.9.97.55d.
asi māyobhavaṃ kṛtam AVP.15.3.1d.
asi yajñeṣu mānuṣaḥ RV.1.44.10d.
asi yamo asy ādityo arvan RV.1.163.3a; VS.29.14a; TS.; KS.40.6a.
asi radhrasya coditā RV.10.24.3b.
asi satya īśānakṛt RV.8.90.2b; AVś.20.104.4b; SV.2.843b.
asi satya ṛṇayā brahmaṇas pate RV.2.23.11c.
asi satya ṛṇayāvānedyaḥ RV.1.87.4c.
asi somena samayā vipṛktaḥ RV.1.163.3c; VS.29.14c; TS.; KS.40.6c.
asi hi vīra senyaḥ RV.1.81.2a; AVś.20.56.2a; SV.2.353a.
asi hotā na īḍyaḥ RV.1.12.3c; AVś.20.101.3c; SV.2.142c; KS.39.13c; TB.; Apś.16.11.11c; 35.5c.
asi hotā manurhitaḥ RV.1.13.4c; SV.2.700c. Cf. Mahābh.12.343.10--11.
asiknīḥ kṛṣṇā oṣadhīḥ AVś.8.7.1c.
asiknīm eti ruśatīm apājan RV.10.3.1d; SV.2.896d. Cf. apājait.
asikniy# see asikny-.
asikny (TB. asikniy) asy oṣadhe AVś.1.23.3c; AVP.1.16.3c; TB.
asiknyā (TA. asikniyā) marudvṛdhe vitastayā RV.10.75.5c; TA.10.1.13c; MahānU.5.4c; N.9.26c.
asiknyāṃ yajamāno na hotā RV.4.17.15a.
asi sūnāṃ navaṃ carum RV.10.86.18c; AVś.20.126.18c.
asimatīm iṣumatīm AVP.5.10.10a.
asiñcann utsaṃ gotamāya tṛṣṇaje RV.1.85.11b.
asinvā te vartatām indra hetiḥ RV.10.89.12b.
asinvaṃ vavraṃ mahy ādad ugraḥ RV.5.32.8b.
asinvan daṃṣṭraiḥ pitur atti bhojanam RV.2.13.4c.
asinvan bhūry āvayaḥ RV.8.45.38b.
asinvann atti jihvayā vanāni RV.10.79.2b.
asinvatī bapsatī bhūry attaḥ RV.10.79.1d; N.6.4.
asir na parva vṛjinā śṛṇāsi RV.10.89.8b.
asir me tigmasyāyasaḥ AVP.15.23.2a.
asiṣyadanta gāva ā na dhenavaḥ RV.9.68.1b; SV.1.563b.
asitagrīvaś chāgaiḥ VS.23.13; śB. See lohitagrīvaś.
asitāhe 'rasaṃ viṣam AVP.13.3.8a.
asitajñave svāhā TS.
asitaṃ te pralayanam (TB. nilayanam) AVś.1.23.3a; AVP.1.16.3a; TB.
asitānām etaj jātam AVP.8.7.3c.
asitasya gṛhebhyaḥ AVś.6.137.1d.
asitasya te (AVP. omits te) brahmaṇā AVś.1.14.4a; AVP.1.15.4a.
asitasya taimātasya AVś.5.13.6a; AVP.1.44.1a; 8.2.4a. Cf. Kauś.29.9.
asitasya brahmaṇā see prec. but one.
asitasya vidradhasya AVP.1.90.1a; 8.7.8a. Cf. vidradhasya balāsasya.
asitau petvāv iva N.12.2b.
asitavarṇā harayaḥ suparṇāḥ TS.; Apś.19.27.1. See kṛṣṇaṃ niyānaṃ.
asitāya svāhā TS.; KSA.5.1; TB.; Apś.20.12.4.
asitiṃ cārthasiddhiṃ ca RVKh.1.191.8a.
asito dhānvo rājā (Aś. dhānvaḥ; śś. dhānvanaḥ), tasyāsurā viśas ta ima āsate, māyā (Aś.śś. asuravidyā) vedaḥ so 'yam śB.; Aś.10.7.7; śś.16.2.19--21.
asito rakṣitā AVś.3.27.1; AVP.3.24.1; TS.; MS.2.13.21: 166.13; ApMB.2.17.14.
apasidhya duritaṃ dhattam āyuḥ # AVś.8.2.7d.
ayasi trīṇi tapasāviṣṭitāni # AVś.5.28.1d; AVP.2.59.10d.
arcāmasi vīra brahmavāhaḥ # RV.6.21.6d.
arhāmasi pramiyaṃ sānv agneḥ # RV.4.55.7d.
upāsyāmasi yo guruḥ # AVś.6.42.2d.
uśmasi tvā sadhastha ā # RV.8.45.20c.
gṛṇīmasi tveṣaṃ rudrasya nāma # RV.2.33.8d.
goarṇasi tvāṣṭre aśvanirṇiji # RV.10.76.3c.
ghasi (Apś. ghasīnā) me mā saṃpṛkthāḥ # VSK.2.3.6; Apś.3.20.1.
canasita # Apś.10.12.8; Mś. Cf. Apś.10.12.7.
juhūmasi dyavi-dyavi # RV.1.4.1c; AVś.20.57.1c; 68.1c; SV.1.160c; 2.437c.
juhūmasi śravasyavaḥ # RV.8.52 (Vāl.4).4d.
tapasi krāntaṃ salilasya pṛṣṭhe # AVś.10.7.38b.
tapasi juhomi (Mś. adds svāhā) # TA.3.6.1; Mś.
tapasi sarvaṃ pratiṣṭhitam # TA.10.63.1d; MahānU.22.1d.
doṣoṣasi praśasyate # RV.2.8.3b.
dharṇasi bhūridhāyasam # RV.9.26.3c.
nāśayāmasi tat tvat (AVP. -masi tad vayam) # AVś.3.23.1b; AVP.3.14.1b.
nāśayāmasi brahmaṇā # AVP.15.20.9d.
norasi tāḍam ā ghnate # AVś.19.32.2b; AVP.11.12.2b. Cf. under āghnānāḥ.
paśyāmasi nopanipadyamānam # RV.1.152.4b.
pṛthuśravasi kānīte # RV.8.46.21d.
proṣādasāvirasi (?) viśvam ejat # MG.2.7.1d.
bibhṛmasi prasravaṇe na somam # RV.10.148.2d.
bodhāmasi tvā haryaśva yajñaiḥ (Mś. mss. yajñe) # RV.7.21.1c; SV.1.313c; Mś.
brahmaṇāchāvadāmasi # AVś.10.10.4d; AVP.1.29.1d.
brahmaṇāpombhāmasi # AVP.1.49.3b.
brahmavarcasinaṃ ma karotu # ApMB.2.7.25d; HG.1.10.6e (bis); 11.3.
brahmavarcasi yaśasi vīrye 'nnādye # ApMB.2.11.16e.
bhūyasi haviṣkaraṇa upahūtaḥ (TB., -hūtā) # TS.; TB.; 13.3; śB. See upahūto bhūyasi.
bhramasi # śB.; BṛhU.6.3.9.
manasi me cakṣur adhāś cakṣuṣi me manaḥ # JB.1.167.
minīmasi dyavi-dyavi # RV.1.25.1c; TS.; MS.4.12.6c: 197.10.
Dictionary of Sanskrit Search
"asi" has 176 results
asi(1)Uṇādi affix अस्; (2) taddhita affix. affix अस्. See a reference to some preceding word, not necessarily on the same page. the word अस्.
aprasiddhaNot well-known: secondary (used in connection with sense) confer, compare एवं चाप्रसिद्धत्वं गौणलाक्षणिकत्वं चात्र गौणत्वम् Par. Śek Pari. 15
aprasiddhiabsence of clear sense or interpretation; cf इतरेतराश्रयत्वादप्रसिद्धि: Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.1.1. Vārttika (on the Sūtra of Pāṇini). 8, I.1.38 Vārttika (on the Sūtra of Pāṇini). 4.
asicsamāsa-ending affix अस्. See a reference to some preceding word, not necessarily on the same page. the word अस्.
asiddhainvalid; of suspended validity for the time being: not functioning for the time being. The term is frequently used in Pāṇini's system of grammar in connection with rules or operations which are prevented, or held in suspense, in connection with their application in the process of the formation of a word. The term (असिद्ध) is also used in connection with rules that have applied or operations that have taken place, which are, in certain cases, made invalid or invisible as far as their effect is concerned and other rules are applied or other operations are allowed to take place, which ordinarily have been prevented by those rules which are made invalid had they not been invalidatedition Pāṇini has laid down this invalidity on three different occasions (1) invalidity by the rule पूर्वत्रासिद्धम् VIII.2.1. which makes a rule or operation in the second, third and fourth quarters of the eighth chapter of the Pāṇini's Aṣṭādhyāyī. invalid when any preceding rule is to be applied, (2) invalidity by the rule असिद्धवदत्राभात् which enjoins mutual invalidity in the case of operations prescribed in the Ābhīya section beginning with the rule असिद्धवत्राभात् (VI. 4.22.) and going on upto the end of the Pāda (VI.4.175), (3) invalidity of the single substitute for two letters, that has already taken place, when ष् is to be substituted for स्, or the letter त् is to be prefixed, confer, compare षत्वतुकोरसिद्धः (VI. 1.86). Although Pāṇini laid down the general rule that a subsequent rule or operation, in case of conflict, supersedes the preceding rule, in many cases it became necessary for him to set, that rule aside, which he did by means of the stratagem of invalidity given a reference to some preceding word, not necessarily on the same page.. Subsequent grammarians found out a number of additional cases where it became necessary to supersede the subseguent rule which they did by laying down a dictum of invalidity similar to that of Pāṇini. The author of the Vārttikas, hence, laid down the doctrine that rules which are nitya or antaraṅga or apavāda, are stronger than, and hence supersede, the anitya, bahiraṅga and utsarga rules respectively. Later gram marians have laid down in general, the invalidity of the bahiraṅga rule when the antaraṅga rule occurs along with it or subsequent to it. For details see Vol. 7 of Vvyākaraṇa Mahābhāṣya(D. E. Society's edition) pages 217-220. See also Pari. Śek. Pari. 50.
asiddhatvainvalidity of a rule or operation on account of the various considerations sketched a reference to some preceding word, not necessarily on the same page.. See असिद्ध.
asiddhaparibhāṣāthe same as Antaraṅga Paribhāṣā or the doctrine of the invalidity of the bahiraṅga operation. See the word असिद्ध a reference to some preceding word, not necessarily on the same page.. For details see the Paribhāṣā 'asiddham , bahiraṅgam antaraṅge' Paribhāṣenduśekhara of Nāgeśa. Pari. 50 and the discussion thereon. Some grammarians have given the name असिद्धपरिभाषा to the Paribhāṣā असिद्धं बहिरङ्गमन्तरङ्गे as contrasted with अन्तरङ्गं बहुिरङ्कगाद् वलीयः which they have named as बहिरङ्गपरिभाषा.
kātantrapariśiṣṭasiddhāntaratnāṅkuraa gloss on the Kātantra-pariśiṣṭa by Śivarāmendra, who is believed to have written a gloss on the Sūtras of Pāṇini also.
asicase-ending of the ablative case, changed into अात् after bases ending in अ and into स्मात् after pronouns; confer, compareP.IV.1.2,VII.1.12,15.
jasicase termination अस् of the nominative case. plural mentioned as जस् by Panini in IV. 1.2, but referred to as जसि by him; confer, compare P.IV.1.31 and VII.1.50.
jñāpakasiddharealized from the ज्ञापक wording; the conclusion drawn from an indicatory. word in the form of Paribhāșās and the like. Such conclusions are not said to be universally valid; confer, compare ज्ञापकसिद्धं न सर्वत्र Paribhāṣenduśekhara of Nāgeśa. Pari, 110.7.
tasi(1)taddhita affix.affix तस् showing direction by means of a thing exempli gratia, for example वृक्षमूलतः, हिमवत्तः; confer, compare Kas on P.IV.3.114,115; (2) taddhita affix.affix तस् applied in the sense of the ablative case. case and substituted for the ablative case. case affix: exempli gratia, for example ग्रामतः अागच्छति, चोरतो विभेति; sometimes the affix is applied instead of the instrumental or the genitive case also. e. g. वृत्ततः न व्यथते for वृत्तेन न व्यथते; देवा अर्जुनतः अभवन्, for अर्जुनस्य पक्षे अभवन् confer, compare Kas, on P.V.4.44-49.
tasil(1)taddhita affix. affix तस् added to pronouns from सर्व upto द्वि, to the pronoun किम् and after परि and अभि; exempli gratia, for example कुतः; यतः, ततः, अभितः; cf Kāśikā of Jayāditya and Vāmana. on P.V.3. 7 to 9.
tasilādia class of taddhita affixes headed by the affix तस् ( तसिल् ) as given by Panini in his sutras from पञ्चम्यास्तसिल् P. V. 3. 7. upto संख्यायाः क्रियाभ्यावृत्तिगणने कृत्वसुच् V.3.17; confer, compare P. VI.3.35. The words ending with the affixes from तसिल् in P.V.3.7 upto पाशप् in P.V.3.47 (excluding पाशप्) become indeclinables; confer, compare Kas on P.I.1.38.
durgasiṃhathe famous commentator of the Katantra sutras, whose Vrtti on the sutras is the most popular one. It is called , कातन्त्रसूत्रवृत्ति or कातन्तवृत्ति or दौर्गसिंहीवृत्ति , also. A work on Paribhasas named परिभाषावृति, in which Paribhasas are explained and established as based on the Katantra Vyakarana sutras, is attributed to Durgasimha. It is doubtful whether this commentator Durgasimha is the same as Durgacarya, the famous commentator of Yaska's Nirukta. There is a legend that Durgasimha was the brother of Vikramaditya, the founder of the Vikrama Era. Besides the gloss on the Katantra sutras, some grammar works such as a gloss on the unadi sutras, a gloss ( वृत्ति ) on Kalapa-Vyakarana Sutras, a commentary on Karakas named षट्कारकरत्न, Namalinganusasana and Paribhasavrtti are ascribed to Durgasimha. Some scholars believe that the term अमरसिंह was only a title given to Durgasimha for his profound scholarship, and it was Durgasimha who was the author of the well-known work Amarakosa.
nyāyasiddhaestablished by a maxim; with full justification; confer, compare न्यायसिद्धमेवैतत् Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ).on V.1.19.The word is used as opposed to ज्ञापकसिद्ध by Nāgesa; confer, compare Par. Sek. Pari. 1.
prasiddha(1)established in existence: confer, compare क्रमेण नार्थः पदसंहिताविदः पुराsप्रसिद्धा श्रयपूर्वसिद्धिभिः, Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.) XI.34 where the Kramapatha is said to be one which was not established before the Samhitapatha; (2) known ; confer, compare अनिटि प्रसिद्धे क्सो भविष्यति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. III. 1.45 Vart. 4, लोकत एते शब्दाः प्रसिद्धाः स्त्री पुमान् नपुंसकमिति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. IV. 1.3: (3) brought about, accomplished, realized; तथास्य छः प्रसिद्धो भवति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. IV. 1.89 Vart. 2, सर्वत्रैव जश्त्वेन सिद्धं स्यात् , Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P.VIII 2.25
bṛhadvyākaraṇasiddhāntamañjūṣāa grammar work written by Ramanatha Chobhe.
madhyasiddhāntakaumudīSee मध्यकौमुदी
masipersonal ending formed by adding इ to मस् of the 1st person (उत्तमपुरुष) plural in Vedic Literature दीपयामसि, भजयामसि, confer, compare Kāś. on इदन्तो मसि P.VII.1.46.
rāmasiṃhṛvarmāpossibly the same king of Sringaberapura who patronised Nagesabhatta. He is said to have written some Small comments on " the Ramayana and a small grammar work named धातुरत्नमञ्जरी.
rūpasiddhiliterally the formation of words; the name रूपासिद्वि is given to a small literary work on the formation of words written by Dayānandasarasvatī.
vārttikasiddhāntacategorical conclusive statements made by the Varttikakara many of which were cited later on as Paribhasas by later writers For details see pp. 212220 Vol. VII, Vyakarana Mahbhasya, D. E. Society's edition.
vaiyākaraṇasiddhāntakārikāa very scholarly work by Bhattoji Diksita on the interpretation of words and sentences, based upon the learned discussions on that subject introduced in the Mahabhasya, Vakyapadiya, Pradipa, et cetera, and others and discussed fully in his Sabdakaustubha by the author himselfeminine. The work although scholarly and valuable, is compressed in only 72 verses ( karikas ) and has to be understood with the help of the Vaiyakaranabhusana or BhuSansara written by Kondabhatta, the nephew of the author. See वैयाकरणभूषण and वैयाकरणभूषणसार.
vaiyākaraṇasiddhāntakaimudīan extremely popular work on the subject of Sanskrit grammar written for the use of students, which, although difficult at a few places, enables the students by its careful study to get a command over the subject. and enable him to read other higher works on grammar. The work is based on the Astadhyayi of Panini without omitting a single Sutra. The arrangement of the Sutras is, entirely different, as the author, for the sake of facility in understanding, has divided the work into different topics and explained the Sutras required for the topic by bringing them together in the topic. The main topics or Prakaranas are twelve in number, viz. (1) संज्ञापरिभाषा, (2) पञ्चसंधि, (3) सुबन्त or षड्लिङ्ग, (4) स्त्रीप्रत्यय, (5) कारक, (6) समास, (7) तद्धित, (8) तिङन्त, (9) प्रक्रिया, (10) कृदन्त, (11) वैदिकी and (12) स्वर which are sometimes styled as व्याकरणद्वादशी. The work is generally known by the term सिद्धान्तकौमुदी, or even कौमुदी, and it has got a large number of scholarly and ordinary commentaries as also commentaries on commentaries, all numbering a reference to some preceding word, not necessarily on the same page. twelve, and two abridgments the Madhyakaumudi and the Laghukaumudi. The work was written by the reputed scholar Bhattoji Diksita of Varanasi in the seventeenth century. See Bhattoji Diksita.
vaiyākaraṇasiddhāntakaumudīṭīkāor सिद्धान्तकौमुदीव्याख्या a general name given to the large number of commentaries written by members of the line of pupils, and pupils of pupils of Bhattoji. The well-known among the commentaries are प्रौढमनोरमा by the author himself, तत्त्वबोधिनी by ज्ञानेन्द्रसरस्वती, सुबोधिनी by जयकृष्णभट्ट मौनी बालमनोरमा by वासुदेवदीक्षित, and crowning all, the लघुशब्देन्दुशेखर by नागेशभट्ट. The प्रौढमनोरमा has got a learned commentary written by हरिदीक्षित called लघुशब्दरत्न or शब्दरत्न, which also has on it commentaries named भावप्रक्राश by बाळंभट्ट and शब्दरत्नदीप by कल्याणमल्ल. The Laghusabdendusekhara has got commentaries reaching about ten in number.
vaiyākaraṇasiddhāntabhūṣaṇathe same as वैयाकरणभूषण, which see a reference to some preceding word, not necessarily on the same page..
vaiyākaraṇasiddhāntamañjūṣāa well-known work on the syntax and denotation of words written by Nagesabhatta which is popular by the name Laghumanjusha. The Paramalaghumanjusha is an abridgment of this work by the author himselfeminine.
vaiyākaraṇasiddhāntaratnākaraname of a commentary on the Siddhantakaumudi by Ramakrsna in the latter half of the seventeenth century.
vaiyākaraṇasiddhāntarahasyaname of a commentary on the Siddhantakaumudi by Nilakantha.
śabdasiddhi(1)formation of a complete word fit for use by adding proper suffixes to the crude base and . making the necessary modifications confer, compare नैव व्याकरणादृते शब्दसिद्धिः | ( 2 ) name of a commentary by महादेव on the Katantra sutravrtti by Durgasimha.
śūrasiṃhaname of a grammarian who wrote a gloss named दीपिका on the Sarasvata Vyakarana.
sārasiddhāntakaumudīthe same as लघुसिद्धान्त= कौमुदी. See लघुकौमुदी.
sārasvatasiddhāntacandrikāa work on the Sarasvata Vyakarana by a grammarian named Ramasrama.
sphoṭasiddhāntathe doctrine of Sphota, as advocated by the grammarians and criticised by others. See the word स्फोट,
sphīṭasiddhi(1)name of a short treatise on the nature of Sphota, written by a grammarian named Bharata MiSra; (2) name of a short disquisition on Sphota by MandanamiSra.
aḥ( : )visarga called visarjanīya in ancient works and shown in writing by two dots, one below the other, exactly of the same size, like the pair of breasts of a maiden as jocularly larly expressed by Durgasiṁha's Kātantra-Sūtravṛtti.. confer, compare अः ( : ) इति विसर्जनीयः । अकार इह उच्चारणार्थः । कुमारीस्तनयुगाकृतिर्वर्णो विसजर्नीयसंज्ञो भवति ( दुर्गसिंह on कातन्त्र I.1.16). विसर्ग is always a dependent letter included among the Ayogavāha letters and it is looked upon as a vowel when it forms a part of the preceding vowel; while it is looked upon as a consonant when it is changed into the Jihvāmūlīya or the Upadhmānīya letter.
a,k(ೱ),(ೱ)जिह्वामूलीय, represented by a sign like the वज्र in writing, as stated by Durgasiṁha's Kātantra-Sūtravṛtti. who remarks वज्राकृतिर्वर्णो जिह्वामूलीयसंज्ञो भवति. the Jihvāmūlīya is only a voiceless breath following the utterance of a vowel and preceding the utterance of the guttural letter क् or ख् . It is looked upon as a letter (वर्ण), but dependent upon the following consonant and hence looked upon as a consonant. e. g. विष्णु ೱ करोति.
a,pೱ,(ೱ)Upadhmānīya represented by a sign like the temple of an elephants stated by Durgasiṁha's Kātantra-Sūtravṛtti. who remarks "गजकुम्भाकृतिर्वर्ण उपध्मानीयसंज्ञो भवति." Kāt.I. It is a voiceless breath following the utterance of a vowel and preceding the utterance of the labial letter p ( प् ) or ph ( फ ). It is looked upon as a letter ( वर्ण ), but dependent upon the following consonant and hence looked upon as a consonant. अ:कार name given to the nominative case. case in the Taittiriya Prātiśākhya. cf अ:कार इति प्रथमाविभक्तेरुपलक्षणम् Taittirīya Prātiśākhya.I. 23.
adhikāragoverning rule consisting of a word (exempli gratia, for example प्रत्ययः, धातोः, समासान्ताः et cetera, and others) or words (exempli gratia, for example ङ्याप्प्रातिपदिकात्, सर्वस्य द्वे et cetera, and others) which follows or is taken as understood in every following rule upto a particular limit. The meaning of the word अधिकार is discussed at length by Patañjali in his Mahābhāṣya on II.1.1, where he has given the difference between अधिकार and परिभाषा; confer, compare अधिकार: प्रतियोगं तस्यानिर्देशार्थ इति योगे योगे उपतिष्ठते। परिभाषा पुनरेकदेशस्था सती सर्वं शास्त्रमभिज्वलयति प्रदीपवत् । See also Mahābhāṣya on I.3.11, I. 4.49 and IV. I.83. The word or wording which is to repeat in.the subsequent rules is believed to be shown by Pāṇini by characterizing it with a peculiarity of utterance known as स्वरितोच्चार or स्वरितत्वेन उच्चारणम्. The word which is repeated in the following Sūtras is stated to be अधिकृत. The Śabda Kaustubha defines adhikāra as एकंत्रोपात्तस्यान्यत्र व्यापार: अधिकारः Śab. Kaus. on P.1.2.65. Sometimes the whole rule is repeated e. g. प्रत्यय: P.III.1.1, अङ्गस्य P.VI.4.1 समासान्ताः P.V.4.68 while on some occasions a part only of it is seen repeatedition The repetition goes on upto a particular limit which is stated as in असिद्धवदत्राभात् P.VI.4.22, प्राग्रीश्वरान्निपाताः P.I.4.56. Many times the limit is not stated by the author of the Sūtras but it is understood by virtue of a counteracting word occurring later on. On still other occasions, the limit is defined by the ancient traditional interpreters by means of a sort of convention which is called स्वरितत्वप्रतिज्ञा. This अधिकार or governance has its influence of three kinds: ( 1 ) by being valid or present in all the rules which come under its sphere of influence, e. g. स्त्रियाम् or अङ्गस्य; (2) by showing additional properties e. g. the word अपादान being applied to cases where there is no actual separation as in सांकाश्यकेभ्यः पाटलिपुत्रका अभिरूपतराः: (3) by showing additional force such as setting aside even subsequent rules if opposingular. These three types of the influence which a word marked with स्वरित and hence termed अधिकार possesses are called respectively अधिकारगति, अधिक क्रार्य and अधिक कार. For details see M.Bh. on I.3.11. This अधिकार or governing rule exerts its influence in three ways: (1) generally by proceeding ahead in subsequent rules like the stream of a river, (2)sometimes by jumps like a frog omitting a rule or more, and (3)rarely by proceeding backward with a lion's glance; confer, compare सिंहावलोकितं चैव मण्डूकप्लुतमेव च ।; गड्गाप्रवाहवच्चापि अधिकारास्त्रिधा मताः ॥
anavakāśahaving no occasion or scope of application; used in connection with a rule the whole of whose province of application is covered by a general rule, and hence which becomes technically useless, unless it is allowed to set aside the general rule: confer, compare अनवकाशा हि विधयो बाधका भवन्तिrules which have no opportunity of taking effect( without setting aside other rules ) supersede those rules; M.Bh. on V.4.154, also Paribhāṣenduśekhara of Nāgeśa. on Pari. 64.
anavakāśatvaabsence of any opportunity of taking effect, scopelessness considered in the case of a particular rule, as a criterion for setting aside that general rule which deprives it of that opportunity confer, compare अनवकाशत्वं निरवकाशत्वं वा बाधकत्वे बीजम्. This अनवकाशत्व is slightly different from अपवादत्व or particular mention which is defined usually by the words सामान्यविधिरुत्सर्गः । विशेषविधिरपवादः ।
antaraṅgaparibhāṣāthe phrase is used generally for the परिभाषा "असिद्धं बहिरङ्गमन्तरङ्गे' described a reference to some preceding word, not necessarily on the same page.. See the word अन्तरङ्ग. The परिभाषा has got a very wide field of application and is used several times in setting aside difficulties which present themselves in the formation of a word. Like many other paribhāṣās this paribhāṣā is not a paribhāṣā of universal application.
antaraṅgalakṣaṇacharacterized by the nature of an antaraṅga operation which gives that rule a special strength to set aside other rules occurring together with it.
apavādaa special rule which sets aside the general rule; a rule forming an exception to the general rule. exempli gratia, for example आतोनुपसर्गे कः III.2.2 which is an exception of the general rule कर्मण्यण् III.2.1; confer, compare येन नाप्राप्तो यो विधिरारभ्यते स तस्य बाधको भवति, तदपवादोयं येागो भवति; Pari. Śekh. Par 57; for details see Pari. Śekh. Pari. 57-65: cf न्यायैर्मिश्रानपवादान् प्रतीयात् । न्याया उत्सर्गाः महाविधयः । अपवादा अल्पविषयाः विधय: । तानुत्सर्गेण मिश्रानेकीकृताञ् जानीयात् । अपवादविषयं मुक्त्वा उत्सर्गाः प्रवर्तन्ते इत्यर्थः । Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.) I. 23 and commentary thereon ; (2) fault; confer, compare शास्त्रापवादात् प्रतिपत्तिभेदात् Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.) XIV. 30 on which उव्वट remarks शास्त्राणामपवादा दोषाः सन्ति पुनरुक्तता अविस्पष्टार्थता, कष्टशब्दार्थता...
apialso in addition to; अपि is used sometimes to mean absolute of or ungualified by any condition; confer, compare अन्येभ्येपि दृश्यते । अपिशब्दः सर्वोपाधिव्यभिचारार्थः । निरुपपदादपि भवति । धीवा पीवा । KS. on P. III. 2.75, III. 2.101, VII. 1.38; confer, compare अपिग्रहणे व्यभिचारार्थम् ) Durgasiṁha's Kātantra-Sūtravṛtti. on Kātantra vyākaraṇa Sūtra.II.3.64.
avakāśaoccasion; possibility of application; confer, compare इको गुणवृद्धी इत्यस्यावकाशः। चयनं चायकः लवनं लावकः इति । इहोभयं प्राप्नोति | मेद्यति । मार्ष्टीति । Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.1.3. Vārttika (on the Sūtra of Pāṇini). 6.
avaśyamnecessarily; the expression अवश्यं चैतदेवं विज्ञेयम् is very frequently used in the Mahābhāṣya when the same statement is to be emphasizedition
āgamaaugment, accrement, a word element which is added to the primitive or basic word during the process of the formation of a complete word or pada. The āgama is an adventitious word element and hence differs from ādeśa, the substitute which wholly takes the place of the original or ( आदेशिन् ). Out of the several āgamas mentioned by Pāṇini, those that are marked with mute ट् are prefixed, those, marked with क्, are affixed, while those, marked with म्, are placed immediately after the last vowel of the word. The augments become a part and parcel of the word to which they are added, and the characteristics of which they possess;confer, compareयदागमास्तद्गुणीभूतास्तद्ग्रहणेन गृह्यन्ते, also आगमानां आगमिधर्मिवैशिष्ट्यम् Paribhāṣenduśekhara of Nāgeśa. Pari.11. Those grammarians, who hold the view that words are unproduced and eternal, explain the addition of an augment as only the substitution of a word with an augment in the place of a word without an augment; confer, compare आदेशास्तर्हिमे भविष्यन्ति अनागमकानां सागमकाः Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.1.20; I.1.46. The term āgama is defined as अन्यत्र विद्यमानस्तु यो वर्णः श्रुयतेधिकः । आगम्यमानतुल्यत्वात्स आगम इति स्मृतः Com. on Tait. Prāt.I. 23.
uṇādisūtravṛttia gloss on the Uṇādi Sūtras in the different versions. Out of the several glosses on the Uṇādi Sūtras, the important ones are those written by Ujjvaladatta, Govardhana, Puruṣottamadeva's Paribhāṣāvṛtti.adeva, Rāmacandra Dīkṣita and Haridatta. There is also a gloss called Uṇādisūtrodghātana by Miśra. There is a gloss by Durgasiṁha's Kātantra-Sūtravṛtti. on the Kātantra version of the Uṇādi Sūtras.
egeliṃg( Eggeling )a well-known German scholar of Sanskrit Grammar who flourished in the l9th century and who edited the Kātantra Vyākaraṇa with the commentary of Durgasiṁha's Kātantra-Sūtravṛtti. and many appendices in 1876.
kalāparatnaa commentary on the kāraka portion of the Kalāpa grammar ascribed to the famous commentator Durgasiṁha's Kātantra-Sūtravṛtti..
kātantradhātuvṛttiascribed to Durgasiṁha's Kātantra-Sūtravṛtti., the famous commentator of the Kātantra Sūtras who lived in the ninth or the tenth century.
kātantradhātuvṛttiṭīkāa commentary ascribed to Ramanātha and called Manoramā on the Kātantradhātuvṛtti of Durgasiṁha's Kātantra-Sūtravṛtti.. See कातन्त्रधातुवृत्ति a reference to some preceding word, not necessarily on the same page..
kātantrapañjikāa name usually given to a compendium of the type of Vivaraṇa or gloss written on the Kātantra Sūtras. The gloss written by Durgasiṁha's Kātantra-Sūtravṛtti. on the famous commentary on the Kātantra Sūtras by Durgasiṁha's Kātantra-Sūtravṛtti. ( the same as the the famous Durgasiṁha's Kātantra-Sūtravṛtti. or another of the same name ) known as दौर्गसिंही वृत्ति is called Kātantra Pañjika or Kātantravivaraṇa. A scholar of Kātantra grammar by name Kuśala has written a Pañjika on दुर्गसिंहृ's वृत्ति which is named प्रदीप, Another scholar, Trivikrama has written a gloss named Uddyota.
kātantraparibhāṣāvṛtti(1)name of a gloss on the Paribhāṣāpaṭha written by Bhāvamiśra, probably a Maithila Pandit whose date is not known. He has explained 62 Paribhāṣās deriving many of them from the Kātantra Sūtras. The work seems to be based on the Paribhāṣā works by Vyāḍiparibhāṣāsūcana.and others on the system of Pāṇini, suitable changes having been made by the writer with a view to present the work as belonging to the Kātantra school; (2) name of a gloss on the Paribhāṣāpaṭha of the Kātantra school explaining 65 Paribhāṣās. No name of the author is found in the Poona manuscript. The India Office Library copy has given Durgasiṁha's Kātantra-Sūtravṛtti. as the author's name; but it is doubted whether Durgasiṁha's Kātantra-Sūtravṛtti. was the author of it. See परिभाषासंग्रह edition by B. O. R. I. Poona.
kātantrapradīpaa grammar work written by a scholar named Kuśala on the Kātantrasūtravṛtti by Durgasiṁha's Kātantra-Sūtravṛtti.. See कातन्त्रपञ्जिका.
kātantravṛttiname of the earliest commentary on the Kātantra Sūtras ascribed to Durgasiṁha's Kātantra-Sūtravṛtti.. The commentary was once very popular as is shown by a number of explanatory commentaries written upon it, one of which is believed to have been written by Durgasiṁha's Kātantra-Sūtravṛtti. himselfeminine. See Durgasiṁha's Kātantra-Sūtravṛtti..
kātantravṛttiṭīkāa commentary on Durgasiṁha's Kātantra-Sūtravṛtti.'s Kātantravṛrtti by Mokṣeśvara in the fifteenth century A.D.
kātantravṛttivyākhyānamed Aṣṭamaṅgalā on Durgasiṁha's Kātantra-Sūtravṛtti.'s Kātantravṛtti written by Rāmakiśora Cakravartin who is believed to have written a grammatical work शाब्दबोधप्रकाशिका.
kātantrasūtravṛttian old Vṛtti on the Kātantra Sūtras ascribed to Vararuci who is, of course, different from Vararuci Kātyāyana. The Vṛtti appears to have been occupying a position similar to that of Durgasiṁha's Kātantra-Sūtravṛtti..
kumārīstanayugākṛtia phrase used in the gloss on the कातन्त्र by Durgasiṁha's Kātantra-Sūtravṛtti. to give along with the definition of र्विसर्जनीय or विसर्ग a graphic description of it as shown in script confer, compare Kāt, I.1.16 commentary
koṇḍabhaṭṭaa reputed grammarian who wrote an extensive explanatory gloss by name Vaiyākaraṇabhūṣaṇa on the Vaiyākaraṇasiddhāntakārikā of Bhaṭṭoji Dīkṣita. Another work Vaiyākaraṇabhūṣaṇasāra. which is in a way an abridgment of the Bhūṣaṇa, was also written by him. Koṇḍabhaṭṭa lived in the beginning of the l7th century. He was the son of Raṅgojī and nephew of Bhaṭṭojī Dīkṣita. He was one of the few writers on the Arthavicāra in the Vyākaraṇaśāstra and his Bhūṣaṇasāra ranks next to the Vākyapadīya of Bhartṛhari. Besides the Bhūṣaṇa and Bhūṣaṇasāra, Koṇḍabhaṭṭa wrote two independent works viz. Vaiyākaraṇsiddhāntadīpika and Sphoṭavāda.
gajakumbhākṛtia graphic description of the Jihvāmūlīya letter as found in script, given by Durgasiṁha's Kātantra-Sūtravṛtti.; confer, compare गजकुम्भाकृतिर्वर्ण उपध्मानीयसंज्ञो भवति Durgasiṁha's Kātantra-Sūtravṛtti.'s commentary on Kātantra vyākaraṇa Sūtra.I.1. 18. see ( उपधानीय ).
gūḍhārthadīpinīa commentary ( वृत्ति ) on the sutras of Panini by Sadasiva Misra who lived in the seventeenth century.
gaurādia class of words to which the affix ई ( ङीष्) is added to form the feminine base; exempli gratia, for example गौरी, मत्सी, हयी, हरिणी; the class contains a large number of words exceeding 150; for details see Kasika on P.IV.1. 41; (2) a small class of eleven words, headed by the word गौर which do not have the acute accent on the last syllable in a tatpurusa compound when they are placed after the preposition उप; confer, compare P. VI.2.194.
ṅuṭaugment ङ् mentioned as ङुठ्, in Kasika, added to the vowel following the consonant ङ् at the end of a word. See ङमुट्.
cintyaquestionable; contestable: which cannot be easily admittedition The word is used in connection with a statement made by a sound scholar which cannot be easily brushed aside; confer, compare एतेन यत्कैयटे केचिदित्यादिना अस्यैव वाग्रहृणस्य तदनित्यत्वज्ञापकतोक्ता सापि चिन्त्या, Par. Sekh. Pari. 93. 5.
cullibhaṭṭia grammarian who is supposed to have written a gloss ( वृत्ति ) on the Sutras of Panini; confer, compare तत्र च वृतिः पाणिनिप्रणीतानां सूत्राणां विवरणं चुल्लिभट्टिनल्लूरादि( V. 1. निर्लूरादि-) विरचितम् , Nyasa, on the benedictory verse of Kasika: वृत्तौ भाष्ये तथा घातुनामपारायणादिषु at the very beginning.
jayakṛṣṇaa famous grammarian of the Mauni family who lived in Varanasi in the seventeenth century. He wrote विभक्त्यर्थनिर्णय, स्फोटचन्द्रिका, a commentary on the Siddhantakaumudi called सुबोधिनी and a commentary on the Madhya Kaumudi named विलास. He wrote a commentary on the Laghukaumudi also.
jātigenus; class;universal;the notion of generality which is present in the several individual objects of the same kindeclinable The biggest or widest notion of the universal or genus is सत्ता which, according to the grammarians, exists in every object or substance, and hence, it is the denotation or denoted sense of every substantive or Pratipadika, although on many an occasion vyakti or an individual object is required for daily affairs and is actually referred to in ordinary talks. In the Mahabhasya a learned discussion is held regarding whether जाति is the denotation or व्यक्ति is the denotation. The word जाति is defined in the Mahabhasya as follows:आकृतिग्रहणा जातिर्लिङ्गानां च न सर्वभाक् । सकृदाख्यातनिर्गाह्या गोत्रं च चरणैः सह ॥ अपर आह । ग्रादुभीवविनाशाभ्यां सत्त्वस्य युगपद्गुणैः । असर्वलिङ्गां बह्वर्थो तां जातिं कवयो विदुः Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on IV. 1.63. For details see Bhartphari's Vakyapadiya.
jinendrabuddhia reputed Buddhist Grammarian of the eighth century who wrote a scholarly commentary on the Kasikavrtti ofJayaditya and Vamana. The commentary is called न्यास or काशिकाविवरणपञ्जिका and the writer is referred to as न्यासकार in many later grammar works Some scholars identify him with पूज्यपाददेवनन्दिन् the writer of the जैनेन्द्रव्याकरण, but this is not possible as पूज्यपाददेवनन्दिन् was a Jain Grammarian who flourished much earlier.
jainendravyākaraṇaname of a grammar work written by Pujyapada Devanandin, also called Siddhanandin, in the fifth century A.D. The grammar is based on the Astadhyay of Panini,the section on Vedic accent and the rules of Panini explaining Vedic forms being,of course, neglectedition The grammar is called Jainendra Vyakarana or Jainendra Sabdanusasana. The work is available in two versions, one consisting of 3000 sutras and the other of 3700 sutras. it has got many commentaries, of which the Mahavrtti written by Abhayanandin is the principal one. For details see Jainendra Vyakarana, introduction published by the Bharatiya Jnanapitha Varadasi.
jauhotyādikaa root belonging to the जुहोत्यादिगण or the third conjugation. ज्ञानदीपिका name of a commentary on Amarasimha’s Amarakosa written by Sripati (Chakravartin) in the 14th century.
jyotsnā(Ι)name of a commentary by Rāmacandra possibly belonging to the 18th century on the Vājasaneyi Prātiśākhya; (2) name of a commentary on Nāgeśa's 'Laghuśabdenduśekhara by Udayaṃakara Pāṭhaka of Vārāṇasi in the 18th century.
tattvavimarśinīname of a commentary on the Kasikavrtti by a grammarian named Nandikeśvarakārikā.kārikābhāṣya by the beginning of the nineteenth century A. D.
dayānandasarasvatia brilliant Vedic scholar of the nineteenth century belonging to North India who established on a sound footing the study of the Vedas and Vyakarana and encouraged the study of Kasikavrtti. He has written many books on vedic studies.
dvikarmakaa term used in connection with roots governing two objects or two words in the accusative case, exempli gratia, for example दुह् in, गां दोग्धि पयः; the term कर्म according to the strict definition of the term कर्तुरीप्सिततमं कर्म or अाप्यं कर्म applies to one of the two, which is called the प्रधानकर्म or the direct object, the other one, which, in fact, is related to the verbal activity by relation of any other karaka or instrument is taken as karmakaraka and hence put in the accusative case. For details see Mahabhasya and Kasika on P.I.4.51. Some roots in their causal formation govern two objects out of which one object is the actual one while the other is the subject of the primitive root. exempli gratia, for example गमयति माणवकं ग्रामम्; बोधयति माणवकं धर्मम्; cf Kas on P.I.4.52. See for details Mahabhasya on P. I. 4.52.
dvyaca word possessed of two vowels in it; dissyllabic words; the word is frequently used in Panini's Astadhyayi and Patanjali's Mahabhasya, Kasika Vrtti and other works on Panini's grammar.
dharaṇīdharaa grammarian of the sixteenth century at the court of Udayasimha who wrote a commentary on the sutras of Panini which was named वैयाकरणसर्वस्व as also a commentary on the Siksa of Panini.
dhātua root; the basic word of a verbal form,defined by the Bhasyakara as क्रियावचनो धातुः or even as भाववचने धातु:, a word denoting a verbal activity. Panini has not defined the term as such, but he has given a long list of roots under ten groups, named dasagani, which includes about 2200 roots which can be called primary roots as contrasted with secondary roots. The secondary roots can be divided into two main groups ( l ) roots derived from roots ( धातुजधातवः ) and (2) roots derived from nouns ( नामधातवः ). The roots derived from roots can further be classified into three main subdivisions : (a) causative roots or णिजन्त, (b) desiderative roots or सन्नन्त, (c) intensive roots or यङन्त and यङ्लुगन्त: while roots derived from nouns or denominative roots can further be divided into क्यजन्त, काम्यजन्त, क्यङन्त, क्यषन्त, णिङन्त, क्विबन्त and the miscellaneous ones ( प्रकीर्ण ) as derived from nouns like कण्डू( कण्ड्वादि ) by the application of the affix यक् or from nouns like सत्य,वेद, पाश, मुण्ड,मिश्र, et cetera, and others by the application of the affix णिच्. Besides these, there are a few roots formed by the application of the affix अाय and ईय (ईयङ्). All these roots can further be classified into Parasmaipadin or Parasmaibhasa, Atmanepadin or Atmanebhasa and Ubhayapadin. Roots possessed of a mute grave ( अनुदात्त ) vowel or of the mute consonant ङ् added to the root in the Dhatupatha or ending in the affixes यड्, क्यङ् et cetera, and others as also roots in the passive voice are termed Atmanepadin: while roots ending with the affix णिच् as also roots possessed of a mute circumflex vowel or a mute consonant ञ़़् applied to them are termed Ubhayapadin. All the rest are termed Parasmaipadin. There are some other mute letters or syllables applied by Panini to the roots in his Dhatupatha for specific purposes; exempli gratia, for example ए at the end to signify prohibition of vrddhi to the penultimate अ in the aorist, exempli gratia, for example अकखीत् confer, compare P. VII.2.5; इर् to signify the optional substitution of अ or अङ् for the affix च्लि of the aorist, exempli gratia, for example अभिदत्, अभैत्सीत् ; confer, compare P.III. 1.57; उ to signify the optional application of the augment इ ( इट् ) before क्त्वा exempli gratia, for example शमित्वा, शान्त्वा; confer, compare P.VII. 2. 56; ऊ to signify the optional application of the augment इ ( इट् ) exempli gratia, for example गोप्ता, गेीपिता, confer, compare P.VII.2.44; अा to signify the prohibition of the augment इट् in the case of the past passive voice. participle. exempli gratia, for example क्ष्विण्णः, स्विन्नः, confer, compare P. VII.2.16; इ to signify the addition of a nasal after the last vowel e. g. निन्दति from निदि, confer, compare P. VII.1.58: ऋ to signify the prohibition of ह्रस्व to the penultimate long vowel before णिच्, e. g. अशशासत्, confer, compare P.VII. 4.2;लृ to signify the substitution of अङ् for च्लि in the aorist, exempli gratia, for example अगमत् confer, compare P. III.1.55: ओ to signify the substitution of न् for त् of the past passive voice.participle. exempli gratia, for example लग्नः, अापीनः, सूनः, दून: et cetera, and others; confer, compare P. VIII. 2.45. Besides these,the mute syllables ञि, टु and डु are prefixed for specific purposes; confer, compare P. III.2.187, III.3.89 and III. 3.88. The term धातु is a sufficiently old one which is taken by Panini from ancient grammarians and which is found used in the Nirukta and the Pratisakhya works, signifying the 'elemental (radical)base' for nouns which are all derivable from roots according to the writers of the Nirukta works and the grammarian Siktaayana; confer, compare नाम च धातुजमाह निरुक्ते व्याकरणे शकटस्य च तोकम् Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. III.3.1. Some scholars have divided roots into six categories; confer, compare तत्र धातवः षोढा (a) परिपठिताः भूवादयः, (b) अपरिपठता अान्दोलयत्यादयः, (c) परिपठितापरिपठिताः ( सूत्रपठिताः ) स्कुस्कम्भस्तम्भेत्यादयः, (d) प्रत्ययधातवः सनाद्यन्ताः, (e) नामघातवः कण्ड्वादयः, (f) प्रत्ययनामधातवः होडगल्भक्ली. बप्रभृतयः; cf Sringara Prak. I. For details see M.Bh. on P.I.3.I as also pp 255, 256 Vol. VII Vyakarana-Mahabhasya published by the D.E. Society, Poona.
ghātumañjarīcalled also धातुसंग्रहृ attributed to a grammarian namcd Kasinatha.
dhāturatnamañjarīa treatise dealing with roots believed to have been written by Ramasimhavarman.
nañsvarabalīyastvathe superiority, or strength of the accent caused by नञ्समास which sets aside the accent caused by the case affix; confer, compare विभक्तिस्वरान्नञ्स्वरो बलीयान् P. VI. 2.158 Vart. 13,
navyamataa term used for the differentiation in views and explanations held by the comparatively new school of Bhattoji Diksita, as contrasted with those held by Kasikakara and Kaiyata; the term is sometimes applied to the differences of opinion expressed by Nagesabhatta in contrast with Bhagttoji Diksita. For details see p.p. 23-24 Vol.VII of the Patanjala Mahabhasya edition D.E. Society, Poona.
nitya(1)eternal, as applied to word or Sabda in contrast with sound or dhvani which is evanescent (कार्य ). The sound with meaning or without meaning,made by men and animals is impermanent; but the sense or idea awakened in the mind by the evanescent audible words on reaching the mind is of a permanent or eternal nature; confer, compare स्फोटः शब्दो ध्वनिस्तस्य व्यायामादुपजायते; confer, compare also व्याप्तिमत्त्वा्त्तु शब्दस्य Nir.I.1 ; (2) constant; not liable to be set aside by another; confer, compare उपबन्धस्तु देशाय नित्यम्, न रुन्धे नित्यम्। नित्यशब्दः प्राप्त्यन्तरानिषेधार्थः T.Pr.I.59, IV.14; (3) original as constrasted with one introduced anew such as an augment; confer, compare Taittirīya Prātiśākhya.VI.14; (4) permanently functioning, as opposed to tentatively doing so; confer, compare नित्यविरते द्विमात्रम् Ṛktantra Prātiśākhya.37; (5) unchangeable, permanent, imperishable; confer, compare अयं नित्यशब्दोस्त्येव कूटस्थेष्वविचालिषु भावेषु वर्तते M.Bh. on P. VIII. 1.4; (6) always or invariably applying, as opposed to optional; the word in this sense is used in connection with rules or operations that do not optionally apply; confer, compare उपपदसमासो नित्यसमासः, षष्ठीसमासः पुनार्वेभाषा; Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P.II.2.19; (7) constant,as applied to a rule which applies if another simultaneously applying rule were to have taken effect, as well as when that other rule does not take effect; confer, compare क्वचित्कृताकृतप्रसङ्गमात्रेणापि नित्यता Par. Sek. Pari 46. The operations which are nitya according to this Paribhasa take effect in preference to others which are not 'nitya', although they may even be 'para'; confer, compare परान्नित्यं बलवत् Par. Sek. Pari. 42.
niravakāśapossessed of no scope of, or occasion for, application; the word अनवकाश is also used in this sense. The niravakasa rules always set aside the general rules which are always present wherever they i. e. the niravakasa rules are possible to be appliedition Niravakasatva is looked upon as one of the two criteria for बाध or sublation, the other one being सामान्यविशेषभाव as illustrated by the usual maxim, known as तक्रकौण्डिन्यन्याय. See तक्रकौण्डिन्यन्याय; confer, compare also अनवकाशा हि विधयो बाधका भवन्ति Par. Sek. on Pari. 64.
nirākṛta(1)set aside; answered; the word is frequently used in connection with faults which are stated to occur or present themselves if a particular explanation is given; (2) prevailed over by another; confer, compare तदा न रूपं लभते निराकृतम् Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.) XI. 30, where Uvvata paraphrases निराकृत as विस्मृत.
niruktaname of a class of works which were composed to explain the collections of Vedic words by means of proposing derivations of those words from roots as would suit the sense. The Nirukta works are looked upon as supplementary to grammar works and there must have been a good many works of this kind in ancient times as shown by references to the writers of these viz. Upamanyu, Sakatayana,Sakapuni,Sakapurti and others, but, out of them only one work composed by Yaska has survived; the word, hence has been applied by scholars to the Nirukta of Yaska which is believed to have been written in the seventh or the eighth century B. C. i. e. a century or two before Panini. The Nirukta works were looked upon as subsidiary to the study of the Vedas along with works on phonetics ( शिक्षा ), rituals ( कल्प ), grammar (व्याकरण) prosody (छन्दस्) and astronomy(ज्योतिष)and a mention of them is found made in the Chandogyopanisad. As many of the derivations in the Nirukta appear to be forced and fanciful, it is doubtful whether the Nirukta works could be called scientific treatises. The work of Yaska, however, has got its own importance and place among works subsidiary to the Veda, being a very old work of that kind and quoted by later commentators. There were some glosses and commentary works written upon Yaska's Nirukta out of which the one by Durgacarya is a scholarly one.It is doubtful whether Durgacarya is the same as Durgasimha, who wrote a Vrtti or gloss on the Katantra Vyakarana. The word निरुक्त is found in the Pratisakhya works in the sense of 'explained' and not in the sense of derived; confer, compare Ṛgvedaprātiśākhya by Śaunaka ( Sanskrit Sāhityapariṣad Edition, Calcutta.) XV 6; V.Pr. IV. 19, 195.
padaprakṛtia term used in connection with the Samhitā text or संहितापाठ which is believed to have been based upon words ( पदानि प्रकृति: यस्याः सा ) or which forms the basis of words or word-text or the padapātha (पदानां प्रकृतिः); cf पदप्रकृतिः संहिता Nir.I.17.
paribhāṣāvṛttia general name given to an explanatory independent work on Paribhasas of the type of a gloss on a collection of Paribhasas,irrespective of the system of grammar, whether it be that of Panini, or of Katantra, or of Jainendra or of Hemacandra. The treatises of Vyadi (Panini system), Durgasimha and BhavamiSra (Katantra system), Purusottamadeva and Siradeva (Panini system), Abhyankar (Jainendra system) and others are all known by the name Paribhasavritti.
paribhāṣāsegraha'a work containing a collection of independent works on Paribhasas in the several systems of Sanskrit Grammar, compiled by M. M. K. V. Abhyankar. The collectlon consists of the following works (i) परिभाषासूचन containing 93 Paribhasas with a commentary by Vyadi, an ancient grammarian who lived before Patanjali; ( ii ) ब्याडीयपरिभाषापाठ, a bare text of 140 Paribhaasaas belonging to the school of Vyadi (iii) शाकटायनपरिभाषासूत्र a text of 98 Paribhasa aphorisms, attributed to the ancient grammarian Saka-tayana, or belonging to that school; [iv) चान्द्रपरिभाषासूत्र a text of 86 Paribhasa aphorisms given at the end of his grammar work by Candragomin; (v) कातन्त्रपरिभाषासूत्रवृत्ति a gloss on 65 Paribhas aphorisms of the Katantra school by Durgasimha; (vi) कातन्त्रपारभाषासूत्रवृत्ति a short gloss on 62 Paribhasa aphorisms of the Katantra school by Bhavamisra; (vii) कातन्त्रपरिभाषासूत्र a text of 96 Paribhasa rules belonging to the Katantra school without any author's name associated with it; (viii) कालापपरिभाषासूत्र a text of 118 Paribhasa rules belonging to the Kalapa school without any author's name associated with it; (ix) जैनेन्द्रपरिभाषावृत्ति a gloss written by M. M. K. V. Abhyankar ( the compiler of the collection), on 108 Paribhasas or maxims noticeable in the Mahavrtti of Abhayanandin on the Jainendra Vyakarana of Pujyapada Devanandin; (x) भोजदेवकृतपरि-भाषासूत्र a text of 118 Paribhasa rules given by Bhoja in the second pada of the first adhyaaya of his grammar work named Sarasvatikanthabharana; (xi) न्यायसंग्रह a bare text of 140 paribhasas(which are called by the name nyaya) given by Hema-hamsagani in his named न्यायसंग्रह; (xii) लधुपरिभाषावृत्ति a gloss on 120 Paribhasas of the Panini school written by Puruso-ttamadeva; (xiii) वृहत्परिभाषावृत्ति con-taining 130 Paribhasas with a commentary by Siradeva and a very short,gloss on the commentary by Srimanasarman ( xiv ) परिभाषावृत्ति a short gloss on 140 Paribhasas of the Panini school written by Nilakantha; (xv) परिभाषाभास्कर a collection of 132 Paribhasas with a commentary by Haribhaskara Agnihotri; (xvi) bare text of Paribhasa given and explained by Nagesabhatta in his Paribhasendusekhara. The total number of Paribhasas mentioned and treated in the whole collection exceeds five hundredition
pāṇinithe illustrious ancient grammarian of India who is wellknown by his magnum opus, the Astaka or Astaadhyaayi which has maintained its position as a unique work on Sanskrit grammar unparalleled upto the present day by any other work on grammar, not only of the Sanskrit language, but ofany other language, classical as well as spoken. His mighty intelligence grasped, studied and digested not only the niceties of accentuation and formation of Vedic words, scattered in the vast Vedic Literature of his time, but those of classical words in the classical literature and the spoken Sanskrit language of his time in all its different aspects and shades, noticeable in the various provinces and districts of the vast country. The result of his careful study of the Vedic Literature and close observation ofeminine.the classical Sanskrit, which was a spoken language in his days, was the production of the wonderful and monumental work, the Astaadhyaayi,which gives an authoritative description of the Sanskrit language, to have a complete exposition of which,several life times have to be spent,in spite of several commentaries upon it, written from time to time by several distinguished scholars. The work is a linguist's and not a language teacher's. Some Western scholars have described it as a wonderful specimen of human intelligence,or as a notable manifestation of human intelligence. Very little is known unfortunately about his native place,parentage or personal history. The account given about these in the Kathaasaritsaagara and other books is only legendary and hence, it has very little historical value. The internal evidence, supplied by his work shows that he lived in the sixth or the seventh century B. C., if not earlier, in the north western province of India of those days. Jinendrabuddhi, the author of the Kaasikavivaranapanjikaa or Nyasa, has stated that the word शलातुर् mentioned by him in his sUtra ( IV. 3.94 ) refers to his native place and the word शालातुरीय derived by him from the word शलातुर by that sUtra was, in fact his own name, based upon the name of the town which formed his native placcusative case. Paanini has shown in his work his close knowledge of, and familiarity with, the names of towns, villages, districts, rivers and mountains in and near Vaahika, the north-western Punjab of the present day, and it is very likely that he was educated at the ancient University of Taksasilaa. Apart from the authors of the Pratisaakhya works, which in a way could be styled as grammar works, there were scholars of grammar as such, who preceded him and out of whom he has mentioned ten viz., Apisali, Saakataayana, Gaargya, Saakalya, Kaasyapa, Bharadwaja, Gaalava, Caakravarmana Senaka and Sphotaayana. The grammarian Indra has not been mentioned by Paanini, although tradition says that he was the first grammarian of the Sanskrit language. It is very likely that Paanini had no grammar work of Indra before him, but at the same time it can be said that the works of some grammarians , mentioned by Panini such as Saakaatyana, Apisali, Gaargya and others had been based on the work of Indra. The mention of several ganas as also the exhaustive enumeration of all the two thousand and two hundred roots in the Dhaatupaatha can very well testify to the existence of systematic grammatical works before Paarnini of which he has made a thorough study and a careful use in the composition of his Ganapaatha and Dhaatupatha. His exhaustive grammar of a rich language like Sanskrit has not only remained superb in spite of several other grammars of the language written subsequently, but its careful study is felt as a supreme necessity by scholars of philology and linguistics of the present day for doing any real work in the vast field of linguistic research. For details see pp.151154 Vol. VII of Paatanjala Mahaabhsya, D. E. Society's Edition.
pāṇinisūtracalled also by the name अष्टक or पाणिनीय-अष्टक; name given to the SUtras of Paanini comprising eight adhyaayaas or books. The total number of SUtras as commented upon by the writers of the Kasika and the Siddhaantakaumudi is 3983. As nine sUtras out of these are described as Vaarttikas and two as Ganasutras by Patanjali, it is evident that there were 3972 SUtras in the Astaka of Paanini according to Patanjali. A verse current among Vaiyakarana schools states the number to be 3996; confer, compare त्रीणि सूत्रसहस्राणि तथा नव शतानि च । षण्णवतिश्च सूत्राणां पाणिनिः कृतवान् स्वयम् । The traditional recital by Veda Scholars who look upon the Astadhyayi as a Vedaanga, consists of 3983 Sutras which are accepted and commented upon by all later grammarians and commentators. The SUtras of Paanini, which mainly aim at the correct formation of words, discuss declension, conjugation, euphonic changes, verbal derivatives, noun derivatives and accents. For details see Vol.VII, Vyaakarana Mahaabhaasya, D. E. Society's edition pp. 152-162.
punaḥprasaṅgavijñānaoccurrence or possibility of the application of a preceding grammatical rule or operation a second time again, after once it has been set aside by a subsequent opposing rule or rules in conflict; confer, compare पुनःप्रसङ्गविज्ञानात् सिद्धम् Paribhāṣenduśekhara of Nāgeśa. Pari. 39; confer, compare Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. I. 4.2 Vārttika (on the Sūtra of Pāṇini). 7; confer, comparealso Puru. Pari. 40.
paurastyavaiyākaraṇaa grammarian of the eastern school which is believed to have been started by जिनेन्द्रबुद्धि the writer of the gloss called न्यास on the Kasikavrtti. The school practically terminated with पुरुषोत्तमदेव and सीरदेव at the end of the twelfth century A.D. Such a school existed also at the time of Panini and Patanjali, a reference to which is found made in प्राचां ष्फ ताद्धतः P. IV. 1.17 and प्राचामवृद्धात्फिन् बहुलम् IV.1. 160 and प्राचामुपादेरडज्वुचौ च V.3.80 where the word is explained as प्राचामाचार्याणां by the writer of the Kasika.
prakāra(l)attribute, attribute which differentiates, manner, difference; differentiating description: confer, compare कंचित्प्रकारं प्राप्तः इत्थंभूत: Kāśikā of Jayāditya and Vāmana. on P.II.3.21: (2) resemblance, similarity of one thing with another with slight deficiency: confer, compare प्रकारे गुणवचनस्य । प्रक्रारो भेदः सादृश्यं च। तदिह सादृश्यं प्रकारो गृह्यते । प्रकारे वर्तमानस्य गुणवचनशब्दस्य द्वे भवतः । पटुपटुः मृदुमृदुः । अपरिपूर्णगुण इत्यर्थः । परिपूर्णगुणेन न्यूनगुणस्य उपमाने सत्येवं प्रयुज्यते Kāśikā of Jayāditya and Vāmana. on P. VIII.1.12; (3) differentiating attribute; confer, compare प्रकारवचने थाल् V. 3.23, प्रकारवचने जातीयर् V. 3.69, स्यूलादिभ्यः प्रकारवचने कन् V. 4.3 where Kasika defines the word प्रकार as सामान्यस्य भेदको विशेषः प्रकार: Ka, on V. 3.23 and 69; (4) type, confer, compare इतिशब्दः प्रकारार्थः Kāśikā of Jayāditya and Vāmana. on V. 2.93: confer, compare also अदिशब्दः प्रकारे Kāśikā of Jayāditya and Vāmana. on देवपथादिभ्यश्च P.V.3.100; cf also अादिइाब्दः प्रकारे वर्तते । देवदत्तादय आढ्याः । देवदत्तप्रकारा इत्यर्थः M.Bh. on I.3.1 Vart. 11.
prakriyākaumudīsāraa commentary on Ramacandra's Prakriyakaumud by a grammarian named Kasinatha
pratyārambhaḥ(1)statement after prohibition literally commencing again; inducing a person to do something after he has refused to do it by repeating the order or request for generally by beginning the appeal with the word नह; exempli gratia, for example नह भोक्ष्यसे ? नह अध्येप्यसे; confer, compare नह प्रत्यारम्भे P. VIII. 1.31 and Kasika and Kāśikāvivaraṇapañjikā, a commentary on the Kāśikāvṛtti by Jinendrabuddhi, called Nyāsa. thereon. (2) commencement or laying down again in spite of previous mention; confer, compare शेषवचनात्तु योसौ प्रत्यारम्भात्कृतो बहुव्रीहिः Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. VI-3.46.
pratyāhāraliterally bringing together; bringing together of several letters ( or words in a few cases, such as roots or nouns ) by mentioning the first and the last only for the sake of brevity; the term प्रत्याहार is generally used in connection with brief terms such as अण्, अक् , अच् , हल् and the like, created by Panini in his grammar by taking any particular letter and associating it with any mute final letter ( अनुबन्ध ) of the fourteen Sivasutras, with a view to include all letters beginning with the letter uttered and ending with the letter which precedes the ( mute ) letter. The practice of using such abbreviations was in existence before Panini, possibly in the grammar attributed to Indra. The term प्रत्याहार is not actually used by Panini; it is found in the Rk. Tantra; confer, compare प्रत्याहारार्थो वर्णोनुबन्धो व्यञ्जनम् R.T.I.3. The term appears to have come into use after Panini. Panini has not given any definition of the term प्रत्याहार. He has simply given the method of forming the Pratyaharas and he has profusely used them; confer, compare आदिरन्त्येन सहेता P. I. 1.71. The word कृञ् in P. III.1.40 and तृन् in P. II. 3.69 are used as Pratyaharas. For a list of the Pratyharas which are used by Panini see Kasika on the Maheswara Sutras.
pradīpavivaraṇacalled also उद्द्योत written by the well-known grammarian Nagesabhatta of Varanasi who flourished in the first half of the eighteenth century.
pradeśaliterally district; sphere of application, place of the application of a rule. The word is frequently used in this sense in the Kasika Vritti; confer, compare प्रत्ययप्रदेशाः प्रत्ययलोपे प्रत्ययलक्षणमित्येवमादयः Kāśikā of Jayāditya and Vāmana. on P. III.1.1 . confer, compare also अनुदात्तप्रदेशाः अनुदात्तौ सुप्पितौ इत्यादयः Kāśikā of Jayāditya and Vāmana. on P. I. 2.30. The word प्रदेश is also used in the sense of the place of use or utility; confer, compare संज्ञाशास्त्रस्य तु कार्यकालपक्षे न पृथग्वाक्यार्थबोधः किं तु प्रदेशवाक्येन सहैव । ... कार्यज्ञानं च प्रदेशदेश एव Par. Sek. Pari. 3.
prapañcaamplification, further explanation,clarification. The expression पूर्वस्यैवायं प्रपञ्चः or तस्यैवायं प्रपञ्चः is very frequently used in the Kasika vrtti; confer, compare Kāśikā of Jayāditya and Vāmana. on P.II. 1.33,37,41, 58, II.4.28, III.2.6I et cetera, and others
prayogaratnamālāname of a recognised treatise on grammar written by पुरुषोत्तमविद्यावागीश of Bengal in the fourteenth century. The treatise explains many words which, although current in language and literature, cannot be easily formed by rules of grammar. The author has tried to form them by applying rules of grammar given in the grammatical systems of Panini and Katantra. The al