Donate
   
Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Root Search
ak has 2 results
        Root Word (Pāṇini Dhātupāṭha:)Full Root MarkerSenseClassSutra
√akakaakuṭilāyāṃ gatau1523
√akakiilakṣaṇe171
Amarakosha Search
839 results
WordReferenceGenderNumberSynonymsDefinition
ā3.3.248MasculineSingularprakarṣaḥ, lagnaḥ
abaddhamMasculineSingularanarthakamunmeaning
abhayā2.2.59FeminineSingularśivā, haimavatī, pūtanā, avyathā, śreyasī, harītakī, kāyasthā, cetakī, amṛtā, pathyā
abhirūpaḥ3.3.138MasculineSingularsarpaḥ, sūcakaḥ
abhīṣuḥ3.3.227MasculineSingularśāriphalakam, dyūtam, akṣam
abhram1.3.6-7NeuterSingularmudiraḥ, ambubhṛt, jaladharaḥ, stanayitnuḥ, dhūmayoniḥ, jīmūtaḥ, vāridaḥ, dhārādharaḥ, vārivāhaḥ, jalamuk, ghanaḥ, taḍitvān, balāhakaḥ, meghaḥcloud
abhriḥFeminineSingularkāṣṭhakudālaḥa scraper or shovel
āḍambaraḥ3.3.176MasculineSingularpiṅgalaḥ, vipulaḥ, nakulaḥ, viṣṇuḥ
āḍhakīFeminineSingularkākṣī, mṛtsnā, tuvarikā, mṛttālakam, surāṣṭrajam
adhikāraḥ2.8.31MasculineSingularprakriyā
adhīnaḥ3.1.14MasculineSingularnighnaḥ, āyattaḥ, asvacchandaḥ, gṛhyakaḥ
adhiṣṭhānam3.3.133NeuterSingularkhalaḥ, sūcakaḥ
adhorukam2.6.120NeuterSingularcaṇḍātakam
agniḥMasculineSingularjvalanaḥ, barhiḥ, śociṣkeśaḥ, bṛhadbhānuḥ, analaḥ, śikhāvān, hutabhuk, saptārciḥ, citrabhānuḥ, appittam, vaiśvānaraḥ, dhanañjayaḥ, jātavedāḥ, śuṣmā, uṣarbudhaḥ, kṛśānuḥ, rohitāśvaḥ, āśuśukṣaṇiḥ, dahanaḥ, damunāḥ, vibhāvasuḥ, vahniḥ, kṛpīṭayoniḥ, tanūnapāt, kṛṣṇavartmā, āśrayāśaḥ, pāvakaḥ, vāyusakhaḥ, hiraṇyaretāḥ, havyavāhanaḥ, śukraḥ, śuciḥ, vītihotraḥfire god
agnijvālāFeminineSingularsubhikṣā, dhātakī, dhātṛpuṣpikā
āhatamMasculineSingularmṛṣārthakaman impossibility
ajā2.9.77FeminineSingularstabhaḥ, chāgaḥ, bastaḥ, chagalakaḥ
akhātam1.10.27NeuterSingulardevakhātama natural pond
akṣam3.3.229NeuterSingularaparādhaḥ
akṣāntiḥFeminineSingularīrṣyādetraction
akṣoṭaḥ2.4.28MasculineSingularkarparālaḥ
alakaḥ2.6.97MasculineSingularcūrṇakuntalaḥ
alpam3.1.61MasculineSingulartanuḥ, sūkṣmam, stokaḥ, kaṇaḥ, truṭiḥ, kṛśam, ślakṣaṇam, leśaḥ, mātrā, dabhram, kṣullakaḥ, aṇuḥ, lavaḥ
amaraḥ1.1.7-9MasculineSingularnirjaraḥ, vibudhaḥ, sumanasaḥ, āditeyaḥ, aditinandanaḥ, asvapnaḥ, gīrvāṇaḥ, daivatam, devaḥ, suraḥ, tridiveśaḥ, diviṣad, ādityaḥ, amartyaḥ, dānavāriḥ, devatā, tridaśaḥ, suparvā, divaukāḥ, lekhaḥ, ṛbhuḥ, amṛtāndhāḥ, vṛndārakaḥimmortal
aṃkoṭaḥMasculineSingularnikocakaḥ
anadhīnakaḥ2.10.9MasculineSingularkauṭatakṣaḥ
anāhatam2.6.113MasculineSingulartantrakam, navāmbaram, niṣpravāṇi
aṅgāradhānikā2.9.30FeminineSingularaṅgāraśakaṭī, hasantī, hasa‍nī
añjanam2.9.101NeuterSingularvi‍tunnakam, ‍mayūrakam, tutthāñjanam
aṅkyaḥ1.7.5MasculineSingularāliṅgyaḥ, ūrdhvakaḥdrum, a synonm of mridanga
antaram3.3.195NeuterSingularvraṇakārī
anupadam3.1.77MasculineSingularanvak, anvakṣam, anugam
āpaḥ1.10.3-4FemininePluralsalilam, payaḥ, jīvanam, kabandham, puṣkaram, arṇaḥ, nīram, śambaram, vāḥ, kamalam, kīlālam, bhuvanam, udakam, sarvatomukham, toyaḥ, kṣīram, meghapuṣpam, vāri, jalam, amṛtam, vanam, pāthaḥ, ambhaḥ, pānīyam, ambu, ghanarasaḥwater
apāmārgaḥMasculineSingularpratyakparṇī, kīśaparṇī, kiṇihī, śaikharikaḥ, kharamañjarī, dhāmārgavaḥ, mayūrakaḥ
āpūpikaḥ2.9.29MasculineSingularkāndavikaḥ, bhakṣyakāraḥ
āragvadhaḥ2.4.23MasculineSingularsaṃpākaḥ, caturaṅgulaḥ, ārevataḥ, vyādhighātaḥ, kṛtamālaḥ, rājavṛkṣaḥ, suvarṇakaḥ
arālam3.1.70MasculineSingularbhugnam, natam, jihmam, vakram, kuṭilam, kuñcitam, vṛjinam, vellitam, āviddham, ūrmimat
arghaḥ3.3.32MasculineSingularmāsam, amātyaḥ, atyupadhaḥ, medhyaḥ, sitaḥ, pāvakam
ariṣṭaḥ2.2.62MasculineSingularmālakaḥ, picumardaḥ, nimbaḥ, sarvatobhadraḥ, hiṅguniryāsaḥ
aritramMasculineSingularkenipātakaḥthe rudder
aśmarī2.6.57FeminineSingularmūtrakṛccham
asrī2.9.35MasculineSingularśākam, haritakam
astaḥMasculineSingularcaramakṣmābhṛt
aśvaḥ2.8.44MasculineSingular‍saptiḥ, gandharvaḥ, vājī, turagaḥ, saindhavaḥ, arvā, turaṅgam, ghoṭakaḥ, ghoड़ा, hayaḥ, vāhaḥ, turaṅgaḥ
atimuktaḥMasculineSingularpuṇḍrakaḥ, vāsantī, mādhavīlatā
āvāpakaḥ2.6.108MasculineSingularpārihāryaḥ, kaṭakaḥ, valayaḥ
avarṇaḥMasculineSingularākṣepaḥ, garhaṇam, jugupsā, parīvādaḥ, nindā, upakrośaḥ, nirvādaḥ, kutsā, apavādaḥcensure, blame, or contempt
avyaktaḥ3.3.68MasculineSingularprakaraṇam, prakāraḥ, kārtsnyam, vārtā
āyuḥMasculineSingularjīvitakālaḥ
bāhlīkam3.3.9NeuterSingularaśvasyakhuraḥ
bahulaḥ3.3.207MasculineSingularkṣārakaḥ, samūhaḥ, ānāyaḥ, gavākṣaḥ
bāhumūlaḥ2.6.80NeuterSingularkakṣaḥ
bahupradaḥ3.1.4MasculineSingularvadānyaḥ, sthūlalakṣyaḥ, dānaśauṇḍaḥ
balāUbhaya-lingaSingularvāṭyālakaḥ
balabhadraḥ1.1.23-24MasculineSingularbaladevaḥ, balaḥ, saṅkarṣaṇaḥ, tālāṅkaḥ, halāyudhaḥ, revatīramaṇaḥ, pralambaghnaḥ, kālindībhedanaḥ, halī, rauhiṇeyaḥ, kāmapālaḥ, acyutāgrajaḥ, ānakadundubhiḥ, sīrapāṇiḥ, musalī, nīlāmbaraḥ, rāmaḥbalaram
bālaḥ2.6.42MasculineSingularmāṇavakaḥ
balākā2.5.27FeminineSingularvisakaṇṭhikā
balam2.8.107NeuterSingularparākramaḥ, sthāma, taraḥ, śaktiḥ, śauryam, draviṇam, prāṇaḥ, śuṣmam, sahaḥ
bandhyaḥMasculineSingularaphalaḥ, avakeśī
bhairavam1.7.19MasculineSingularbhīṣaṇam, pratibhayam, bhīṣmam, ghoram, bhīmam, bhayānakam, dāruṇam, bhayaṅkaramhorrer
bhāṇḍam3.3.50NeuterSingulararbhakaḥ, straiṇagarbhaḥ
bhartsanamNeuterSingularapakāragīḥreproach
bherīFeminineSingularānakaḥ, dundubhiḥa kettle drum
bhittamNeuterSingularśakalam, khaṇḍam, ardhaḥa part
bhṛṅgāraḥ2.8.33MasculineSingularkanakālukā
bhṛtyaḥ2.10.17MasculineSingular‍paricārakaḥ, ‍‍kiṅkaraḥ, ‍gopyakaḥ, dāseyaḥ, bhujiṣyaḥ, niyojyaḥ, dāsaḥ, ‍‍praiṣyaḥ, ceṭakaḥ, dāseraḥ
bhūrjaḥ2.2.46MasculineSingularcarmī, mṛdutvak
bhūtakeśaḥ2.9.112MasculineSingularraktacandanam
bhūtiḥ1.1.59-60Ubhaya-lingaSingularbhasma, kṣāraḥ, rakṣā, bhasitamash
bījākṛtam2.9.8MasculineSingularuptakṛṣṭam
brahmā1.1.16-17MasculineSingularprajāpatiḥ, viścasṛṭ, aṇḍajaḥ, kamalodbhavaḥ, satyakaḥ, ātmabhūḥ, pitāmahaḥ, svayaṃbhūḥ, abjayoniḥ, kamalāsanaḥ, vedhāḥ, vidhiḥ, pūrvaḥ, sadānandaḥ, haṃsavāhanaḥ, surajyeṣṭhaḥ, hiraṇyagarbhaḥ, caturāsanaḥ, druhiṇaḥ, sraṣṭā, vidhātā, nābhijanmā, nidhanaḥ, rajomūrtiḥ, parameṣṭhī, lokeśaḥ, dhātā, virañciḥbramha
cakṣuṣyā2.9.103FeminineSingularpuṣpakam, ku‍sumāñjanam, puṣpaketu
cāmpeyaḥ2.2.63MasculineSingularcampakaḥ, hemapuṣpakaḥ
cāmpeyaḥ2.2.65MasculineSingularkesaraḥ, nāgakesaraḥ, kāñcanāhvayaḥ
caṇḍaḥ3.1.30MasculineSingularatyantakopanaḥ
cāṇḍālikā2.10.32FeminineSingularkāṇḍolavīṇā, caṇḍālavallakī
candrakaḥ2.5.33MasculineSingularmecakaḥ
carcā2.6.123FeminineSingularcārcikyam, sthāsakaḥ
carmī2.8.72MasculineSingular‍phalakapāṇiḥ
caṣālaḥ2.7.20MasculineSingularyūpakaṭakaḥ
caurakaḥ2.10.24MasculineSingularparāskandī, taskaraḥ, aikāgārikaḥ, ‍‌pratirodhī, dasyuḥ, malimlucaḥ, ‍‍‍pāṭaccaraḥ, moṣakaḥ, stenaḥ
chatrā2.9.38FeminineSingular‍vitunnakam, kustumburu, dhānyakam
chekaḥ2.2.45MasculineSingulargṛhyakaḥ
cirivilvaḥ2.2.47MasculineSingularnaktamālaḥ, karajaḥ, karañjakaḥ
citrāFeminineSingularmūṣikaparṇī, pratyakśreṇī, dravantī, raṇḍā, vṛṣā, nyagrodhī, sutaśreṇī, śambarī, upacitrā
citrabhānuḥ3.3.112MasculineSingularpakṣī, śaraḥ
colaḥ2.6.119MasculineSingularkūrpāsakaḥ
cūḍālāFeminineSingularcakralā, uccaṭā
daivajñaḥ2.8.13MasculineSingularmauhūrttaḥ, sāṃvatsaraḥ, ‍kārtāntikaḥ, jyautiṣikaḥ, daivajñaḥ, gaṇakaḥ, mauhūrttikaḥ
dakṣaṇīyaḥ3.1.3MasculineSingulardakṣiṇyaḥ, dakṣiṇārhaḥ
daraḥ3.3.192MasculineSingularvinā, tādarthyam, paridhānam, avasaraḥ, ātmīyaḥ, bhedaḥ, avadhiḥ, antarātmā, bahiḥ, chidram, antardhiḥ, avakāśaḥ, madhyaḥ
dātyūhaḥMasculineSingularkālakaṇṭhakaḥ
dhāma3.3.131NeuterSingularprabhāvaḥ, adhyāsanam, cakram, puram
dhamanīFeminineSingularhanuḥ, haṭṭavilāsinī, añjanakeśī
dhāmārgavaḥMasculineSingularghoṣakaḥ
dhānyam2.9.22NeuterSingularvrīhiḥ, stambakariḥ
dharmarājaḥ1.1.61-62MasculineSingularantakaḥ, daṇḍadharaḥ, yamarāṭ, kṛtāntaḥ, pitṛpatiḥ, vaivasvataḥ, kālaḥ, śamanaḥ, paretarāṭ, śrāddhadevaḥ, yamaḥ, yamunābhrātā, samavartīyama
dhīndriyam1.5.8NeuterSingularghrāṇaḥ, rasanā, tvak, manaḥ, netram, śrotraman intellectual organ
dhṛṣṭaḥ3.1.24MasculineSingulardhṛṣṇak, vayātaḥ
dhūrtaḥ2.10.44MasculineSingularakṣadhūrttaḥ, dyūtakṛt, akṣadevī, kitavaḥ
dhūrtaḥ3.1.47MasculineSingularvañcakaḥ
digdhaḥ2.8.90MasculineSingular‍viṣāktaḥ, liptakaḥ
ḍimbhaḥ3.3.142MasculineSingularbherī, akṣedundubhiḥ
dīrghasūtraḥ3.1.15MasculineSingularcirakriyaḥ
diśFeminineSingularkakup, kāṣṭhā, āśā, haritquarter or region pointed at/ direction
doṣā2.4.6MasculineSingularnaktam
draviṇam3.3.58NeuterSingularsādhakatamam, kṣetram, gātram, indriyam
dṛṣṭāntaḥ3.3.69MasculineSingularśleṣmādiḥ, aśmavikṛtiḥ, rasādiḥ, śabdayoniḥ, raktādiḥ, mahābhūtādiḥ, mahābhūtaguṇāḥ, indriyāṇi
dūram3.1.67MasculineSingularviprakṛṣṭam
durnāmāFeminineSingulardīrghakośikāa cockle
durvaṇam2..9.97NeuterSingularārakūṭaḥ
dūṣyā2.8.42FeminineSingularkakṣyā, varatrā
dvārapālaḥ2.8.6MasculineSingularpratīhāraḥ, dvāsthaḥ, ‍dvāsthitaḥ, darśakaḥ
dyūtaḥ2.10.45MasculineSingularpaṇaḥ, akṣavatī, kaitavam
ekaḥ3.3.16MasculineSingularpaktiḥ, śiśuḥ
ekākī3.1.81MasculineSingularekaḥ, ekakaḥ
evam3.3.258MasculineSingularbhūṣaṇam, paryāptiḥ, śaktiḥ, vāraṇam
gaḍakaḥ1.10.17MasculineSingularśakulārbhakaḥsheat fish
gajabhakṣyāFeminineSingularsuvahā, hlādinī, surabhī, rasā, maheraṇā, kundurukī, sallakī
gandhanam3.3.122NeuterSingularavakāśaḥ, sthitiḥ
gantrī2.8.53FeminineSingularkambalivāhyakam
gardabhāṇḍaḥ2.2.43MasculineSingularplakṣaḥ, kandarālaḥ, kapītanaḥ, supārśvakaḥ
garut2.5.38NeuterSingularpakṣaḥ, chadaḥ, pattram, patattram, tanūruham
garutmānMasculineSingularnāgāntakaḥ, viṣṇurathaḥ, garuḍaḥ, suparṇaḥ, tārkṣyaḥ, pannagāśanaḥ, vainateyaḥ, khageśvaraḥa heavanly bird
gauḥ2.9.67-72FeminineSingularupasaryā, rohiṇī, bahusūtiḥ, kapilā, navasūtikā, ekahāyanī, droṇakṣīrā, bandhyā, saurabheyī, garbhopaghātinī, arjunī, acaṇḍī, dhavalā, vaṣkayiṇī, dvivarṣā, pīnoghnī, tryabdā, samāṃsamīnā, sandhinī, vaśā, praṣṭhauhī, naicikī, pareṣṭukā, pāṭalā, suvratā, caturabdā, droṇadugdhā, avatokā, usrā, kālyā, aghnyā, sukarā, kṛṣṇā, dhenuḥ, ekābdā, pīvarastanī, trihāyaṇī, māheyī, vehad, śṛṅgiṇī, bālagarbhiṇī, śavalī, cirasūtā, dvihāyanī, sukhasaṃdohyā, caturhāyaṇī, dhenuṣyā, sravadgarbhā, mātā(49)cow
gauraḥ3.3.197MasculineSingularvyāsaktaḥ, ākulaḥ
ghanāghanaḥ3.3.117MasculineSingularnartakī, dūtī
ghṛṇā3.3.57FeminineSingulargṛham, rakṣitā
golīḍhaḥ2.4.39MasculineSingularjhāṭalaḥ, ghaṇṭāpāṭaliḥ, mokṣaḥ, muṣkakaḥ
golomīFeminineSingulargaṇḍālī, śakulākṣakaḥ, śatavīryā
goṣṭhamNeuterSingulargosthānakam
gṛdhnuḥ3.1.21MasculineSingulargardhanaḥ, lubdhaḥ, abhilāṣukaḥ, tṛṣṇakaḥ
grīṣmaḥ1.4.19MasculineSingulartapaḥ, ūṣmakaḥ, nidāghaḥ, uṣṇopagamaḥ, uṣṇaḥ, ūṣmāgamaḥsummer
gundraḥMasculineSingulartejanakaḥ, śaraḥ
gutstakaḥMasculineSingularstabakaḥ
hallakam1.10.36NeuterSingularraktasandhyakamred lotus
haṃsaḥ2.5.26MasculineSingularcakrāṅgaḥ, mānasaukāḥ, śvetagarut
hañjikāFeminineSingularvardhakaḥ, bhārgī, brāhmaṇayaṣṭikā, aṅgāravallī, bāleyaśākaḥ, brāhmaṇī, varvaraḥ, padmā
hariṇī3.3.56MasculineSingularpratyak, surā
hastyārohaḥ2.8.60MasculineSingularādhoraṇaḥ, hastipakaḥ, niṣādī
hāyanaḥ3.3.115MasculineSingularśakraḥ, ghātukaḥ, varṣukābdaḥ
hetiḥ3.3.77FeminineSingularpakṣamūlam
hetuśūnyā3.2.2FeminineSingularvilakṣaṇam
himāṃśuḥ1.3.13-14MasculineSingularśaśadharaḥ, induḥ, sudhāṃśuḥ, niśāpatiḥ, somaḥ, kalānidhiḥ, nakṣatreśaḥ, candramāḥ, kumudabāndhavaḥ, śubhrāṃśuḥ, abjaḥ, glauḥ, dvijarājaḥ, kṣapākaraḥ, candraḥ, vidhuḥ, oṣadhīśaḥ, jaivātṛkaḥ, mṛgāṅkaḥthe moon
hlādinīFeminineSingulardambholiḥ, śatakoṭiḥ, kuliśam, śambaḥ, paviḥ, vajram, aśaniḥ, svaruḥ, bhiduramthe thunderbolt of indra
indraḥ1.1.45MasculineSingularmarutvān, pākaśāsanaḥ, puruhūtaḥ, lekharṣabhaḥ, divaspatiḥ, vajrī, vṛṣā, balārātiḥ, harihayaḥ, saṅkrandanaḥ, meghavāhanaḥ, ṛbhukṣāḥ, maghavā, vṛddhaśravāḥ, purandaraḥ, śakraḥ, sutrāmā, vāsavaḥ, vāstoṣpatiḥ, śacīpatiḥ, svārāṭ, duścyavanaḥ, ākhaṇḍalaḥ, viḍaujāḥ, sunāsīraḥ, jiṣṇuḥ, śatamanyuḥ, gotrabhid, vṛtrahā, surapatiḥ, jambhabhedī, namucisūdanaḥ, turāṣāṭ, sahasrākṣaḥindra, the king of the gods
indrāyudhamNeuterSingularśakradhanuḥ, rohitamrainbow
īṣikā2.8.38FeminineSingularakṣikūṭakam
jaḍulaḥ2.6.49MasculineSingularkālakaḥ, pipluḥ
jagalaḥ2.10.42NeuterSingularmedakaḥ
jagaraḥ2.8.66MasculineSingularkaṅkaṭakaḥ, kavacaḥ, tanutram, varma, daṃśanam, uraśchadaḥ
jagat3.3.86MasculineSingularkṛtrimam, lakṣaṇopetam
jālmaḥ3.1.16MasculineSingularasamīkṣyakārī
janīFeminineSingularcakravartinī, saṃsparśā, jatūkā, rajanī, jatukṛt
jārajaḥ2..6.36MasculineSingularkuṇḍaḥ, golakaḥ
jāyakam2.6.126NeuterSingularkālīyakam, kālānusāryam
jihmaḥ3.3.149MasculineSingularyuktam, śaktam, hitam
kākaḥ2.5.22MasculineSingularcirañjīvī, parabhṛt, sakṛtprajaḥ, karaṭaḥ, maukuliḥ, vāyasaḥ, ātmaghoṣaḥ, balipuṣṭaḥ, ekadṛṣṭiḥ, balibhuk, dhvāṅkṣaḥ, ariṣṭaḥ
kākapakṣaḥ2.6.97MasculineSingularśikhaṇḍakaḥ
kākenduḥMasculineSingularkulakaḥ, kākapīlukaḥ, kākatindukaḥ
kalabhaḥ2.8.36MasculineSingularkariśāvakaḥ
kalaṃkaḥMasculineSingularlakṣma, lakṣaṇam, aṅkaḥ, lāñchanam, cihnama spot or mark
kalaṅkaḥ3.3.4MasculineSingulartucchadhānyam, saṅkṣepaḥ, bhaktam, sikthakam
kalikāFeminineSingularkorakaḥ
kalkaḥ3.3.14MasculineSingularkarṇabhūṣaṇam, karihastaḥ, aṅguliḥ, padmabījakośī
kāmam2.9.58MasculineSingulariṣṭam, yathepsitam, prakāmam, ‍paryāptam, ‍nikāmam
kambalaḥ2.6.117MasculineSingularrallakaḥ
kāmpilyaḥFeminineSingularrocanī, karkaśaḥ, candraḥ, raktāṅgaḥ
kaṇā2.9.37FeminineSingularupakuñcikā, suṣavī, kāravī, pṛthvī, pṛ‍thuḥ, kālā
kaṇaḥ3.3.52MasculineSingularstutiḥ, akṣaraḥ, dvijādiḥ, śuklādiḥ
karambhaḥ2.9.48MasculineSingulardadhisaktavaḥ
karapatram2.10.35FeminineSingularkrakacaḥ
karaṭaḥ3.3.40MasculineSingularakāryam, matsaraḥ, tīkṣṇaḥ, rasaḥ
kāravellaḥMasculineSingularkaṭillakaḥ, suṣavī
karcūrakaḥMasculineSingulardrāviḍakaḥ, kālpakaḥ, vedhamukhyakaḥ
karīraḥMasculineSingularkrakaraḥ, granthilaḥ
karkaśaḥ3.1.75MasculineSingularmūrtimat, krūram, mūrttam, kaṭhoram, niṣṭhuram, dṛḍham, jaraṭham, kakkhaṭam
karṇejapaḥ3.1.45MasculineSingularsūcakaḥ
karṇikā3.3.15FeminineSingularvalayaḥ, cakraḥ, bhūbhrūnnitambaḥ
karpaṭaḥ2.6.116MasculineSingularnaktakaḥ
kārtikeyaḥMasculineSingularmahāsenaḥ, kumāraḥ, śikhivāhanaḥ, bāhuleyaḥ, senānīḥ, ṣaḍānanaḥ, śaktidharaḥ, viśākhaḥ, guhaḥ, skandaḥ, śarajanmā, krauñcadāruṇaḥ, ṣāṇmāturaḥ, tārakajit, agnibhūḥ, pārvatīnandanaḥkaarttik
kaṭam2.9.27MasculineSingularkiliñjakaḥ
kaṭiḥ2.6.75FeminineSingularśroṇiḥ, kakudmatī
kattṛṇamNeuterSingularpauram, saugandhikam, dhyāmam, devajagdhakam, rauhiṣam
kaṭuḥFeminineSingularcakrāṅgī, kaṭaṃvarā, śakulādanī, aśokarohiṇī, kaṭurohiṇī, matsyapittā, kṛṣṇabhedī
kesaraḥ2.2.64MasculineSingularvakulaḥ
ketanam3.3.121NeuterSingularlokavādaḥ, paśvahipakṣiṇāṃyuddham
kevalam3.3.211MasculineSingulardakṣaḥ, cāruḥ
khaḍgaḥ2.8.90MasculineSingularkṛpāṇaḥ, asiḥ, riṣṭiḥ, kaukṣethakaḥ, maṇḍalāgraḥ, nistriṃśaḥ, karavālaḥ, candrahāsaḥ
khagaḥ2.5.35-36MasculineSingularvihaṅgamaḥ, pakṣī, śakunaḥ, pattrī, pattrarathaḥ, vājī, viṣkiraḥ, garutmān, vihaṅgaḥ, vihāyāḥ, śakuniḥ, dvijaḥ, patagaḥ, aṇḍajaḥ, vikiraḥ, patatriḥ, pitsan, vihagaḥ, śakuntiḥ, śakuntaḥ, patatrī, patan, nagaukāḥ, viḥ, nīḍodbhavaḥ, nabhasaṅgamaḥ
kharāśvāFeminineSingularkāravī, dīpyaḥ, mayūraḥ, locamastakaḥ
kila3.3.262MasculineSingularantardhiḥ, tiryak
kiñjalkaḥ3.3.21MasculineSingularbālaḥ, bhedakaḥ
klībam3.3.221MasculineSingularrahaḥ, prakāśaḥ
klīvaḥ2.6.39MasculineSingular‍ṣaṇḍaḥ, napuṃsakam, tṛtīyāprakṛtiḥ, śaṇḍhaḥ
kolāhalaḥMasculineSingularkalakalaḥa confused sound
kolakam1.2.130NeuterSingularkakkolakam, kośaphalam
koṭhaḥ2.6.54MasculineSingularmaṇḍalakam
kovidāraḥ2.4.22MasculineSingularyugapatrakaḥ, camarikaḥ, kuddālaḥ
kṛkaṇaḥ2.5.21MasculineSingularkrakaraḥ
kṛṣṇāFeminineSingularkolā, uṣaṇā, māgadhī, śauṇḍī, kaṇā, vaidehī, pippalī, capalā, upakulyā
kṛṣṇaḥMasculineSingularśyāmaḥ, kālaḥ, śyāmalaḥ, mecakaḥ, nīlaḥ, asitaḥblack or dark blue
kṛṣṇapākaphalaḥ2.2.67MasculineSingularavignaḥ, suṣeṇaḥ, karamardakaḥ
kṣārakaḥMasculineSingularjālakam
kṣatavrataḥ2.7.58MasculineSingularavakīrṇī
kṣattā3.3.69MasculineSingularasarvagocaraḥ, kakṣāntaraḥ, nṛpasya(śuddhāntaḥ)
kṣayaḥ2.6.51MasculineSingularśoṣaḥ, yakṣmā
kṣudrā3.3.185FeminineSingularvāhanam, pakṣam
kṣudraśaṃkhaḥMasculineSingularśaṅkanakāḥsmall shell
kuberaḥ1.1.68-69MasculineSingularekapiṅgaḥ, paulastyaḥ, dhanādhipaḥ, manuṣyadharmā, tryambakasakhaḥ, śrīdaḥ, yakṣaḥ, vaiśravaṇaḥ, rājarājaḥ, guhyakeśvaraḥ, aiḍaviḍaḥ, naravāhanaḥ, kinnareśaḥ, dhanadaḥ, yakṣarāṭ, puṇyajaneśvaraḥkuber
kukubhaḥMasculineSingularprasevakaḥthe belly below the neck of a lute
kulakamNeuterSingularpaṭolaḥ, tiktakaḥ, paṭuḥ
kulīraḥMasculineSingularkarkaṭakaḥcrab
kulmāṣaḥ2.9.19MasculineSingularyāvakaḥ
kumāraḥ1.7.12MasculineSingularbhartṛdārakaḥa prince
kuṅkumam2.6.124NeuterSingularlohitacandanam, saṅkocam, bāhlīkam, kāśmīrājanma, dhīram, raktam, varam, piśunam, pītanam, agniśikham
kūpakaḥMasculineSingularvidārakaḥa temporarry well
kūpakaḥ1.10.12MasculineSingularguṇavṛkṣakaḥthe mast
kūrcaśīrṣaḥMasculineSingularśṛṅgaḥ, hrasvāṅgaḥ, jīvakaḥ, madhurakaḥ
kuruvindaḥMasculineSingularmeghanāmā, mustā, mustakam
kuśalam3.3.212NeuterSingularmūrkhaḥ, arbhakaḥ
kuṭajaḥ2.2.66MasculineSingulargirimallikā, śakraḥ, vatsakaḥ
kūṭam3.3.43MasculineSingularjñānam, akṣi, darśanam
kuṭannaṭamNeuterSingulargonardam, dāśapuram, kaivartīmustakam, vāneyam, paripelavam, plavam, gopuram
laghuḥ3.3.33MasculineSingularhāraḥ, stabakaḥ
lājāḥ2.9.47MasculineSingularakṣatāḥ
lākṣā2.6.126FeminineSingularrākṣā, jatu, yāvaḥ, alaktaḥ, drumāmayaḥ
lakṣmīḥ1.1.27FeminineSingularbhārgavī, , haripriyā, padmā, kṣīrasāgarakanyakā, ramā, lokamātā, śrīḥ, padmālayā, lokajananī, kṣīrodatanayā, indirā, kamalālaxmi, goddess of wealth
lakṣmīvataḥ3.1.13MasculineSingularśrīmān, lakśmaṇaḥ, śīlaḥ
lāṅgalīFeminineSingularśāradī, toyapippalī, śakulādanī
laśunamNeuterSingularariṣṭaḥ, mahākandaḥ, rasonakaḥ, mahauṣadham, gṛñjanaḥ
lavaṅgam2.6.126NeuterSingulardevakusumam, śrīsaṃjñam
lekhakaḥ2.8.15MasculineSingularakṣaracaṇaḥ, akṣaracuñcuḥ, lipiṃkaraḥ
locanam2.6.94NeuterSingulardṛṣṭiḥ, netram, īkṣaṇam, cakṣuḥ, akṣiḥ, dṛk, nayanam
lokālokaḥMasculineSingularcakravālaḥ
lūtā2.2.14FeminineSingularmarkaṭakaḥ, tantuvāyaḥ, ūrṇanābhaḥ
madaḥ3.3.98MasculineSingularsthānam, lakṣma, aṅghri, vastu, vyavasitiḥ, trāṇam
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketanaḥ, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
madhuḥ2.9.108NeuterSingular‍sikthakam
madhukamNeuterSingularklītakam, yaṣṭīmadhukam, madhuyaṣṭikā
mahīlatā1.10.21FeminineSingulargaṇḍūpadaḥ, kiñculakaḥa worm
makūlakaḥMasculineSingularnikumbhaḥ, dantikā, pratyakśreṇī, udumbaraparṇī
malam3.3.204MasculineSingularsak, āvalī
mālyam1.2.136NeuterSingularmālā, srak
mandaḥ2.10.18MasculineSingularalasaḥ, a‍nuṣṇaḥ, ‍tundaparimṛjaḥ, ālasyaḥ, śītakaḥ
maṇḍūkaparṇaḥ2.2.56MasculineSingularkuṭannaṭaḥ, śukanāsaḥ, kaṭvaṅgaḥ, araluḥ, dīrghavṛntaḥ, syonākaḥ, naṭaḥ, śoṇakaḥ, ṛkṣaḥ, ṭuṇṭukaḥ, pattrīrṇaḥ
manthanī2.9.75FeminineSingularkramelakaḥ, mayaḥ, mahāṅgaḥ
manyuḥ3.3.161MasculineSingularsthānam, gṛham, bham(nakṣatram), agniḥ
mārjāraḥ2.2.7MasculineSingularotuḥ, viḍālaḥ, vṛṣadaṃśakaḥ, ākhubhuk
māṣakaḥ2.9.86MasculineSingularakṣaḥ
masūraḥ2.9.17MasculineSingularmaṅgalyakaḥ
matallikāFeminineSingularuddhaḥ, tallajaḥ, macarcikā, prakāṇḍamexcellence or happiness
mātaṅgaḥ3.3.26MasculineSingularhariṇaḥ, śabalaḥ, cātakaḥ
māyākāraḥ2.10.11MasculineSingularprātihārakaḥ
mayūraḥ2.5.32MasculineSingularmeghanādānulāsī, nīlakaṇṭhaḥ, bhujaṅgabhuk, śikhāvalaḥ, śikhī, barhiṇaḥ, kekī, barhī
mekhalā2.6.109FeminineSingularkāñcī, saptakī, raśanā, sārasanam
mitraḥ3.3.175MasculineSingularparicchadaḥ, jaṅgamaḥ, khaḍgakośaḥ
mitram2.8.10NeuterSingularsak, suhṛt
mogham3.1.80MasculineSingularnirarthakam
muhuḥ2.4.1MasculineSingularabhīkṣṇyam, asakṛt, punaḥpunaḥ, śaśvat
mukham2.6.90NeuterSingularvadanam, tuṇḍam, ānanam, lapanam, vaktram, āsyam
mūlamNeuterSingularbudhnaḥ, aṅghrināmakaḥ
muṣkaḥ2.6.77MasculineSingularaṇḍakośaḥ, vṛṣaṇaḥ
nadī1.10.29-30FeminineSingularkūlaṅkaṣā, sravantī, dhunī, śaivalinī, rodhovak, apagā, dvīpavatī, hradinī, taraṅgiṇī, nirjhariṇī, nimnagā, srotasvatī, taḍinī, sarit, sarasvatīa river
nāḍī3.3.49FeminineSingularsthūlaḥ, pragāḍham, śaktaḥ
nadīsarjaḥ2.2.45MasculineSingularvīrataruḥ, indradruḥ, kakubhaḥ, arjunaḥ
nagaḥ3.3.24MasculineSingularsūryaḥ, pakṣī
nākaḥ3.3.2MasculineSingularcipiṭaḥ, arbhakaḥ
nakṣatramNeuterSingularbham, tārā, tārakā, uḍuḥ, ṛkṣamstar
nākulīFeminineSingularrāsnā, suvahā, sugandhā, gandhanākulī, nakuleṣṭā, bhujaṅgākṣī, surasā, chatrākī
namaskārīFeminineSingulargaṇḍakālī, samaṅgā, khadirā
nārācaḥ2.8.87MasculineSingularprakṣveḍanaḥ
nārakaḥMasculineSingularnarakaḥ, nirayaḥ, durgatiḥhell
nāyakaḥ3.3.19MasculineSingulargrāmaḥ, phalakaḥ
nidigdhikāFeminineSingularrāṣṭrikā, kulī, bṛhatī, duḥsparśā, pracodanī, vyāghrī, kṣudrā, kaṇṭakārikā, spṛśī
nikāraḥ3.4.15MasculineSingularviprakāraḥ
nikṛṣṭaḥ3.1.53MasculineSingularrephaḥ, garhyaḥ, kutsitaḥ, avamaḥ, arvā, kheṭaḥ, kupūyaḥ, yāpyaḥ, pratikṛṣṭaḥ, aṇakaḥ, avadyaḥ, adhamaḥ
nikṛtaḥ3.1.40MasculineSingularviprakṛtaḥ
nīlīFeminineSingulardolā, śrīphalī, grāmīṇā, droṇī, rañjnī, klītakikā, nīlinī, tutthā, madhuparṇikā, kālā
nīpaḥMasculineSingularpriyakaḥ, kadambaḥ, halipriyaḥ
nirhāraḥ2.4.17MasculineSingularabhyavakarṣaṇam
nirmuktaḥMasculineSingularmuktakañcukaḥa snake that has cast his slough
nirvādaḥ3.3.97MasculineSingulargoṣṭhādhyakṣaḥ
niryātanam3.3.127NeuterSingularguhyam, akāryam
niṣkāsitaḥ3.1.38MasculineSingularavakṛṣṭaḥ
nūpuraḥ2.6.110MasculineSingularpādāṅgadam, tulākoṭiḥ, mañjīraḥ, haṃsakaḥ, pādakaṭakaḥ
nyagrodhaḥ3.3.103MasculineSingularcetaḥpīḍā, adhiṣṭhānam, bandhakam, vyasanam
odanam2.9.49MasculineSingulardīdiviḥ, ‍bhissā, ‍bhaktam, andhaḥ, annam
pādastrīyaḥ2.9.90MasculineSingular‍bhāgaḥ, vaṇṭakaḥ
padmakam2.8.40NeuterSingularbindujālakam
pakṣadvāramNeuterSingularpakakaḥ
pakṣatiḥ2.5.38FeminineSingularpakṣamūlam
palagaṇḍaḥ2.10.6MasculineSingularlepakaḥ
palāṇḍuḥMasculineSingularsukandakaḥ
palaṅkaṣāFeminineSingulargokṣurakaḥ, vanaśṛṅgāṭaḥ, ikṣugandhā, śvadaṃṣṭrā, svādukaṇṭakaḥ, gokaṇṭakaḥ
panasaḥ2.2.61MasculineSingularkaṇṭakiphalaḥ
pāribhadraḥMasculineSingularnimbataruḥ, mandāraḥ, pārijātakaḥ
paritaḥ2.4.12MasculineSingularsamantataḥ, sarvataḥ, viṣvak
parīvāraḥ3.3.177MasculineSingulardyūtakāraḥ, paṇaḥ, dyūtam
pariveṣaḥ1.3.32MasculineSingularparidhiḥ, upasūryakam, maṇḍalamhalo
parṇāsaḥMasculineSingularkaṭhiñjaraḥ, kuṭherakaḥ
pārśvabhāgaḥ2.8.40MasculineSingularpakṣabhāgaḥ
pāśaḥ2.6.99MasculineSingularpakṣaḥ, hastaḥ
pāśakaḥ2.10.45MasculineSingularakṣaḥ, devanaḥ
paṭaḥ2.10.18MasculineSingularuṣṇaḥ, dakṣaḥ, caturaḥ, ‍‍‍peśalaḥ, sūtthānaḥ
pāṭhāFeminineSingularpāpacelī, śreyasī, ambaṣṭhā, vanatiktikā, ekāṣṭhīlā, sthāpanī, prācīnā, rasā, viddhakarṇī
pāṭhīMasculineSingularcitrakaḥ, vahnisañjñakaḥ
patrin3.3.113MasculineSingularaśvaḥ, iṣuḥ, pakṣī
pattroṇam2.6.114NeuterSingulardhautakauśeyam
paṭuparṇīFeminineSingularhaimavatī, svarṇakṣīrī, himāvatī
phalam2.9.13NeuterSingularkuṭakam, phālaḥ, kṛṣakaḥ, nirīśam
piṇḍītakaḥ2.2.52MasculineSingularmaruvakaḥ, śvasanaḥ, karahāṭakaḥ, śalyaḥ, madanaḥ
piṣṭātaḥ1.2.140MasculineSingularpaṭavāsakaḥ
pītadruḥMasculineSingularpacampacā, dāruharidrā, parjanī, kālakeyaḥ, haridraḥ, dārvī
piṭakaḥ2.10.30MasculineSingular‍‍‍peṭakaḥ, peṭā, mañjūṣā
pītanaḥMasculineSingularāmrātakaḥ, kapītanaḥ
pītasālakaḥ2.2.43MasculineSingularbandhūkapuṣpaḥ, priyakaḥ, jīvakaḥ, sarjakaḥ, asanaḥ
potaḥ2.5.40MasculineSingularśāvakaḥ, śiśuḥ, pākaḥ, arbhakaḥ, ḍimbhaḥ, pṛthukaḥ
pradhānam1.4.29NeuterSingularprakṛtiḥnatur
pradrāvaḥ2.8.116MasculineSingular‍vidravaḥ, dravaḥ, apakramaḥ, uddrāvaḥ, apayānam, saṃdrāvaḥ, saṃ‍dāvaḥ
prāḍvivākaḥ2.8.5MasculineSingularakṣadarśakaḥ
praiṣaḥ3.3.227MasculineSingularcakram, vyavahāraḥ, kaliḥ, indriyam, drumaḥ, dyūtāṅgam, karṣaḥ
prakīryaḥ2.2.48MasculineSingularpūtikarajaḥ, pūtikaḥ, kalimārakaḥ
prakramaḥ2.4.26MasculineSingularabhyādānam, udghātaḥ, ārambhaḥ, upakramaḥ
prapunnāḍaḥMasculineSingulareḍagajaḥ, dadrughnaḥ, cakramardakaḥ, padmāṭaḥ, uraṇākhyaḥ
pratibhuvaḥ2.10.44MasculineSingularlagnakaḥ
pratihāsaḥMasculineSingularkaravīraḥ, śataprāsaḥ, caṇḍātaḥ, hayamārakaḥ
pratītaḥ3.3.88MasculineSingulardhavalaḥ, mecakaḥ
pratyakṣam3.1.78MasculineSingularaindriyakam
pravaṇam3.3.62MasculineSingularpakṣī, tārkṣyaḥ
pṛśniparṇīFeminineSingularsiṃhapucchī, kalaśiḥ, pṛthakparṇī, dhāvaniḥ, citraparṇī, guhā, aṅghriparṇikā, kroṣṭuvinnā
pṛthukaḥ2.9.48MasculineSingularcipiṭakaḥ
pṛthukaḥ3.3.3MasculineSingularnāgaḥ, vardhakyaḥ
pṛthuromāMasculineSingularvisāraḥ, jhaṣaḥ, śakalī, matsyaḥ, mīnaḥ, vaisāriṇaḥ, aṇḍajaḥa fish
pūgaḥ3.3.25MasculineSingulartilakaḥ
pulākaḥ3.3.5MasculineSingularśūkakīṭaḥ
punarbhavaḥ2.6.84MasculineSingularkararuhaḥ, nakhaḥ, nakharaḥ
pūrṇakumbhaḥ2.8.32MasculineSingularbhadrakumbhaḥ
pūrvaḥ3.3.141MasculineSingulararbhakaḥ, kukṣiḥ, bhrūṇaḥ
pūyaḥ2.9.48MasculineSingularapūpaḥ, ‍piṣṭakaḥ
rājā3.3.118MasculineSingulardehaḥ, tvak
rājādanaḥ2.2.45MasculineSingularphalādhyakṣaḥ, kṣīrikā
rājādanamMasculineSingularsannakadruḥ, dhanuṣpaṭaḥ, piyālaḥ
rajakaḥ2.10.10MasculineSingularnirṇejakaḥ
rajasvalā2.6.20FeminineSingularātreyī, malinī, puṣpavatī, ṛtumatī, strīdharmiṇī, udak, aviḥ
rākṣasaḥMasculineSingularrakṣaḥ, puṇyajanaḥ, karvuraḥ, āśaraḥ, kravyāt, yātu, yātudhānaḥ, rātricaraḥ, asrapaḥ, kauṇapaḥ, nairṛtaḥ, nikaṣātmajaḥ, rātriñcaraḥ, kravyādaḥgiant
rākṣasīFeminineSingularkṣemaḥ, duṣpatraḥ, gaṇahāsakaḥ, caṇḍā, dhanaharī
raktakaḥMasculineSingularbandhūkaḥ, bandhujīvakaḥ
rasāḥMasculinePluralkaruṇaḥ, adbhutaḥ, hāsyaḥ, bhayānakaḥ, śṛṅgāraḥ, vībhatsaḥ, vīraḥ, raudraḥone kind of acting,vigorous
rāśiḥ3.3.222MasculineSingularnimittam, padam, lakṣyam
rathakāraḥ2.10.9MasculineSingulartakṣā, ‍vardhakiḥ, tvaṣṭāḥ, kāṣṭhataṭ
rathakuṭumbinaḥ2.8.61MasculineSingulardakṣiṇasthaḥ, yantā, sūtaḥ, kṣattā, sārathiḥ, niyantā, savyeṣṭhaḥ, prājitā
ratnam2.9.94NeuterSingularhiraṇyam, ‍tapanīyam, ‍bharma, jātarūpam, rukmam, a‍ṣṭāpadaḥ, suvarṇam, hema, śātakumbham, karburam, mahārajatam, kārtasvaram, kanakam, hāṭakam, gāṅgeyam, cāmīkaram, kāñcanam, jāmbūnadam
revā1.10.32FeminineSingularnarmadā, somodbhavā, mekalakanyakānarmada(river)
riṣṭam3.3.42NeuterSingularmūlam, lagnakacaḥ
ṛkṣagandhāFeminineSingularchagalāntrī, āvegī, vṛddhadārakaḥ, juṅgaḥ
rogahārī2.6.57MasculineSingularagadaṅkāraḥ, bhiṣak, vaidyaḥ, cikitsakaḥ
rohī2.2.49MasculineSingularrohitakaḥ, plīhaśatruḥ, dāḍimapuṣpakaḥ
rohitaḥMasculineSingularlohitaḥ, raktaḥred
ṛtvijaḥ2.7.19MasculineSingularāgnīdhraḥ, yājakaḥ
rucakaḥMasculineSingularmātuluṅgakaḥ
rudhiram2.6.64NeuterSingularkṣatajam, śoṇitam, asṛk, lohitam, asram, raktam
sabhikā2.10.44MasculineSingulardyūtakārakaḥ
śaikṣāḥ2.7.13MasculineSingularprāthamakalpikāḥ
sainikaḥ2.8.62MasculineSingularsenārakṣaḥ
sajjanam2.8.33NeuterSingularuparakṣaṇam
śakrapādapaḥ2.2.53MasculineSingulardevadāru, bhadradāru, drukilimam, pītadāru, dāru, pūtikāṣṭham, pāribhadrakaḥ
sakṛt3.3.250MasculineSingularpratyakṣam, tulyam
śāktīkaḥ2.8.70MasculineSingularśaktihetikaḥ
śakuntaḥ3.3.64MasculineSingularhāstipakaḥ, sūtaḥ
sālaḥ2.2.44MasculineSingularsasyasaṃvaraḥ, sarjaḥ, kārṣyaḥ, aśvakarṇakaḥ
samagram3.1.66MasculineSingularpūrṇam, akhilam, kṛtsnam, sarvam, anūnakam, sakalam, nikhilam, aśeṣam, samam, akhaṇḍam, niḥśeṣam, samastam, viśvam
śaṃbhuḥMasculineSingularkapardī, kapālabhṛt, virūpākṣaḥ, sarvajñaḥ, haraḥ, tryambakaḥ, andhakaripuḥ, vyomakeśaḥ, sthāṇuḥ, ahirbudhnyaḥ, paśupatiḥ, mahānaṭaḥ, maheśvaraḥ, īśānaḥ, bhūteśaḥ, giriśaḥ, kṛttivāsāḥ, ugraḥ, śitikaṇṭhaḥ, mahādevaḥ, kṛśānuretāḥ, nīlalohitaḥ, bhargaḥ, gaṅgādharaḥ, vṛṣadhvajaḥ, bhīmaḥ, umāpatiḥ, īśaḥ, gajāriḥ, śūlī, śarvaḥ, candraśekharaḥ, girīśaḥ, mṛtyuñjayaḥ, prathamādhipaḥ, śrīkaṇṭhaḥ, vāmadevaḥ, trilocanaḥ, dhūrjaṭiḥ, smaraharaḥ, tripurāntakaḥ, kratudhvaṃsī, bhavaḥ, rudraḥ, aṣṭamūrtiḥ, śivaḥ, īśvaraḥ, śaṅkaraḥ, khaṇḍaparaśuḥ, mṛḍaḥ, pinākī(51)shiva, god
śamī2.2.52FeminineSingularsaktuphalā, śivā
samīraṇaḥMasculineSingularmaruvakaḥ, prasthapuṣpaḥ, phaṇijjakaḥ, jambīraḥ
saṃnaddhaḥ2.8.67MasculineSingularvarmitaḥ, sajjaḥ, daṃśitaḥ, vyūḍhakaṅkaṭaḥ
sampattiḥ2.8.82FeminineSingularśrīḥ, lakṣmīḥ, saṃpat
saṃsiddhiḥ1.7.37FeminineSingularnisargaḥ, prakṛtiḥ, svarūpam, svabhāvaḥthe natural state
samudgakaḥ1.2.140MasculineSingularsaṃpuṭakaḥ
samudraḥ1.10.1MasculineSingularsāgaraḥ, udadhiḥ, pārāvāraḥ, apāṃpatiḥ, ratnākaraḥ, sarasvān, udanvān, akūpāraḥ, yādaḥpatiḥ, arṇavaḥ, sindhuḥ, saritpatiḥ, abdhiḥ, jalanidhiḥthe sea or ocean
sāmudram2.9.42NeuterSingularakṣīvam, vaśiram
samūhaḥ2.5.41MasculineSingularvyūhaḥ, vrajaḥ, nikaraḥ, saṅghātaḥ, samudayaḥ, gaṇaḥ, nikurambam, sandohaḥ, stomaḥ, vrātaḥ, sañcayaḥ, samavāyaḥ, saṃhatiḥ, kadambakam, nivahaḥ, visaraḥ, oghaḥ, vāraḥ, samudāyaḥ, kṣayaḥ, vṛndam
śamyā2.9.14FeminineSingularyugakīlakaḥ
śaṇasūtramNeuterSingularpavitrakampackthread
saṅkaraḥ2.2.18MasculineSingularavakaraḥ
saṅkīrṇaḥ3.3.63MasculineSingularpakṣī, bhāsaḥ
saptalāFeminineSingularvimalā, sātalā, bhūriphenā, carmakaṣā
saptaparṇaḥMasculineSingularviśālatvak, śāradaḥ, viṣamacchadaḥ
saraghā2.5.29FeminineSingularmadhumakṣikā
śāraṅgaḥ2.5.19MasculineSingularstokakaḥ, cātakaḥ
sārasaḥ2.5.24MasculineSingularcakraḥ, cakravākaḥ, puṣkarāhvaḥ
sarasvataḥ3.3.64MasculineSingularpāṇiḥ, nakṣatraḥ
śarkarā3.3.183FeminineSingularāmalakī, upamātā, kṣitiḥ
sarpaḥ1.8.6-8MasculineSingulardvirasanaḥ, kumbhīnasaḥ, bhogadharaḥ, bhujaṅgaḥ, āśīviṣaḥ, vyālaḥ, gūḍhapāt, phaṇī, dandaśūkaḥ, pannagaḥ, pavanāśanaḥ, gokarṇaḥ, phaṇadharaḥ, pṛdākuḥ, ahiḥ, viṣadharaḥ, sarīsṛpaḥ, cakṣuḥśravā, darvīkaraḥ, bileśayaḥ, bhogī, lelihānaḥ, kañcukī, hariḥ, bhujagaḥ, bhujaṅgamaḥ, cak, kuṇḍalī, kākodaraḥ, dīrghapṛṣṭhaḥ, uragaḥ, jihvagaḥa snake or serpent
sarṣapaḥ2.9.18MasculineSingulartantubhaḥ, kadambakaḥ
sarvajñaḥ1.1.13MasculineSingularmārajit, tathāgataḥ, sugataḥ, śrīghanaḥ, advayavādī, jinaḥ, bhagavān, dharmarājaḥ, muniḥ, munīndraḥ, daśabalaḥ, lokajit, samantabhadraḥ, buddhaḥ, śāstā, vināyakaḥ, ṣaḍabhijñaḥa gina or buddha
śastramārjikaḥ2.10.7MasculineSingularasidhāvakaḥ
sātisāraḥ2.6.60MasculineSingularatisārakaḥ
śatruḥ2.8.10MasculineSingularārātiḥ, śātravaḥ, ahitaḥ, durhṛd, sapatnaḥ, paraḥ, dasyuḥ, vipakṣaḥ, dveṣaṇaḥ, vairī, pratyarthī, abhighātī, amitraḥ, dviṭ, dviṣan, ripuḥ
satyam1.2.23MasculineSingulartathyam, ṛtam, samyaktruth
śauṇḍikaḥ2.10.10MasculineSingularmaṇḍahārakaḥ
sauvarcalam2.9.110NeuterSingulartvakkṣīrī
sauvarcalam2.9.43NeuterSingularakṣam, rucakam
śeluḥ2.4.34MasculineSingularśleṣmātakaḥ, śītaḥ, uddālaḥ, bahuvārakaḥ
senā2.8.79FeminineSingularsainyam, camūḥ, ‍vāhinī, anīkam, balam, anīkanī, dhvajinī, cakram, ‍varūthinī, pṛtanā
siṃhaḥ2.5.1MasculineSingularmṛgadviṭ, puṇḍarīkaḥ, mṛgaripuḥ, kesarī, mṛgendraḥ, citrakāyaḥ, mṛgāśanaḥ, kaṇṭhīravaḥ, haryakṣaḥ, pañcanakhaḥ, mṛgadṛṣṭiḥ, hariḥ, pañcāsyaḥ
śiraḥ2.6.96NeuterSingularśīrṣam, mūrdhan, mastakaḥ, uttamāṅgam
śiśvidānaḥ3.1.44MasculineSingularakṛṣṇakarmā
śivā2.2.5FeminineSingularjambukaḥ, kroṣṭā, mṛgradhūrtakaḥ, pheravaḥ, vañcalaḥ, gomāyuḥ, pheruḥ, sṛgālaḥ, bhūrimāyaḥ
śivamallīFeminineSingularpāśupataḥ, ekāṣṭhīlaḥ, vakaḥ, vasuḥ
skandadeśaḥ2.9.64MasculineSingular‍galakambalaḥ
ślokaḥ3.3.2MasculineSingularpaṭaham, ānakaḥ
śobhāñjanaḥMasculineSingulartīkṣṇagandhakaḥ, akṣīvaḥ, mocakaḥ, śigruḥ
sopaplavaḥ1.4.10MasculineSingularuparaktaḥeclipsed sun or moon
spaśaḥ3.3.222MasculineSingularkṣudraḥ, karṣakaḥ, kṛtāntaḥ
spaṣṭam3.1.80MasculineSingularpravyaktam, ulbaṇam, sphuṭam
stambhaḥ3.3.142MasculineSingularkarakaḥ, mahārajanam
śubhacchā2.9.77MasculineSingularuraṇaḥ, ūrṇāyuḥ, meṣaḥ, vṛṣṇiḥ, eḍakaḥ, uramraḥ
śuklaḥ1.5.12MasculineSingulardhavalaḥ, sitaḥ, śyetaḥ, śuciḥ, valakṣaḥ, avadātaḥ, viśadaḥ, śubhraḥ, arjunaḥ, gauraḥ, pāṇḍaraḥ, śvetaḥwhite
śuktiḥFeminineSingularnakham, śaṅkhaḥ, khuraḥ, koladalam
śulvaḥ2.10.27NeuterSingularrajjuḥ, baṭī, guṇaḥ, varāṭakam
śunakaḥ2.10.22MasculineSingularmṛgadaṃśakaḥ, bhaṣakaḥ, śvā, kauleyakaḥ, sārameyaḥ, kukkuraḥ
śūnyam3.1.57MasculineSingularvaśikam, tuccham, riktakam
sūraḥ1.3.28-30MasculineSingularsahasrāṃśuḥ, raviḥ, chāyānāthaḥ, jagaccakṣuḥ, pradyotanaḥ, lokabāndhavaḥ, aryamā, dhāmanidhiḥ, divākaraḥ, braghnaḥ, bhāsvān, haridaśvaḥ, arkaḥ, aruṇaḥ, taraṇiḥ, virocanaḥ, tviṣāṃpatiḥ, haṃsaḥ, savitā, tejasāṃrāśiḥ, karmasākṣī, trayītanuḥ, khadyotaḥ, sūryaḥ, bhagaḥ, dvādaśātmā, abjinīpatiḥ, ahaskaraḥ, vibhākaraḥ, saptāśvaḥ, vikartanaḥ, mihiraḥ, dyumaṇiḥ, citrabhānuḥ, grahapatiḥ, bhānuḥ, tapanaḥ, padmākṣaḥ, tamisrahā, lokabandhuḥ, dinamaṇiḥ, inaḥ, ādityaḥ, aṃśumālī, bhāskaraḥ, prabhākaraḥ, vivasvān, uṣṇaraśmiḥ, mārtaṇḍaḥ, pūṣā, mitraḥ, vibhāvasuḥ, aharpatiḥ(53)the sun
svairiṇī2.6.11FeminineSingular‍pāṃśulā, carṣaṇī, bandhakī, asatī, kulaṭā, itvarī, ‍puṃścalī
svam3.3.219MasculineSingularṣaṇḍhaḥ, napuṃsakam
svāmī3.1.8MasculineSingularprabhuḥ, adhibhūḥ, īśvaraḥ, adhipaḥ, netā, īśitā, parivṛḍhaḥ, nāyakaḥ, patiḥ
svarṇakāraḥ2.10.8MasculineSingularnāḍindhamaḥ, kalādaḥ, rūkmakārakaḥ
śyāmā2.2.55FeminineSingulargovandanī, priyakaḥ, viśvaksenā, priyaṅguḥ, latā, kārambhā, phalā, gundrā, mahilāhvayā, gandhaphalī, phalinī
tālaparṇīFeminineSingulardaityā, gandhakuṭī, murā, gandhinī
tāmrakam2.9.98NeuterSingularaśmasāraḥ, śastrakam, tīkṣṇam, piṇḍam, kālāyasam, ayaḥ
tantraḥ3.3.193NeuterSingularrājakaśerū
tāraḥ3.3.174MasculineSingularmakheṣuyūpakhaṇḍaḥ
tātaḥ2.6.28MasculineSingularjanakaḥ, pitā
tatparaḥ3.1.7MasculineSingularprasitaḥ, āsaktaḥ
tilakaḥMasculineSingularkṣurakaḥ, śrīmān
tilakaḥ2.6.49MasculineSingulartilakālakaḥ
tilakam2.6.124NeuterSingularcitrakam, viśeṣakam, tamālapatram
tilaparṇī1.2.133FeminineSingularrañjanam, raktacandanam, kucandanam, patrāṅgam
tindukaḥ2.4.38MasculineSingularkālaskandhaḥ, śitisārakaḥ, sphūrjakaḥ
tiniśaḥ2.4.26MasculineSingularnemiḥ, rathadruḥ, atimuktakaḥ, vañjulaḥ, citrakṛt, syandanaḥ
tiṣyaphalā2.2.57MasculineSingularāmalakī, amṛtā, vayasthā
trātam3.1.105MasculineSingularguptam, trāṇam, rakṣitam, avitam, gopāyitam
trikūṭaḥMasculineSingulartrikakut
tuṇḍikerīFeminineSingularraktaphalā, bimbikā, pīluparṇī
tunnaḥMasculineSingularkuṇiḥ, kacchaḥ, kāntalakaḥ, nandivṛkṣaḥ, kuberakaḥ
turuṣkaḥ1.2.129MasculineSingularpiṇḍakaḥ, sihlaḥ, yāvanaḥ
tuṣaḥ2.9.23MasculineSingulardhānyatvak
tvakpatramNeuterSingulartvacam, cocam, varāṅgakam, utkaṭam, bhṛṅgam
ucchritaḥ3.3.91MasculineSingularsambaddhārthaḥ, hitam, śaktisthaḥ
uddhṛtaḥ3.1.89MasculineSingularsamudaktaḥ
ūdhaḥ2.9.74NeuterSingular‍śivakaḥ
udyānam3.3.124NeuterSingularupakaraṇam, māraṇam, anuvrajyā, mṛtasaṃskāraḥ, gatiḥ, dravyopapādanam, nirvartanam
ulūkaḥ2.5.16MasculineSingularpecakaḥ, divāndhaḥ, kauśikaḥ, ghūkaḥ, divābhītaḥ, vāyasārātiḥ, niśāṭanaḥ
umā1.1.44FeminineSingularkātyāyanī, haimavatī, bhavānī, sarvamaṅgalā, durgā, ambikā, girijā, cāmuṇḍā, gaurī, īśvarī, rudrāṇī, aparṇā, mṛḍānī, āryā, menakātmajā, carmamuṇḍā, kālī, śivā, śarvāṇī, pārvatī, caṇḍikā, dākṣāyaṇī, karmamoṭī, carcikābhavaani
unduruḥ2.2.13MasculineSingularākhuḥ, adhogantā, khanakaḥ, vṛkaḥ, puṃdhvajaḥ, mūṣakaḥ, unduraḥ
unmattaḥMasculineSingularkanakāhvayaḥ, mātulaḥ, madanaḥ, kitavaḥ, dhūrtaḥ, dhattūraḥ
upādhyāyaḥ2.7.7MasculineSingularadhyāpakaḥ
upahvaram3.3.191NeuterSingularhīrakaḥ, paviḥ
upakāryāFeminineSingularupakārikā
uraḥ2.6.79NeuterSingularvakṣaḥ, vatsam
uśīramMasculineSingularlaghulayam, amṛṇālam, abhayam, iṣṭakāpatham, lāmajjakam, sevyam, avadāham, jalāśayam, naladam
uṣṇīṣaḥ3.3.228MasculineSingularpuṃbhāvaḥ, puṃbhāvakriyā
uta3.3.251MasculineSingularprakāśaḥ, ādiḥ, samāptiḥ, hetuḥ, prakaraṇam
utthānam3.3.125NeuterSingularakṣiloma, kiñjalkaḥ, tantvādyaṃśaḥ
vāhinī3.3.119FeminineSingularkratuḥ, vistāraḥ, tucchakaḥ
vaitālikaḥ2.8.98MasculineSingularbodhakaraḥ
vaitanikaḥ2.10.15MasculineSingularkarmakaraḥ, bhṛtakaḥ, bhṛtibhuk
valajaḥ3.3.37NeuterSingularnityam, svakam
vaṃśaḥMasculineSingulartejanaḥ, yavaphalaḥ, tvacisāraḥ, maskaraḥ, śataparvā, karmāraḥ, veṇuḥ, tṛṇadhvajaḥ, tvaksāraḥ
vaṃśakam2.6.127NeuterSingularrājārham, loham, kri, mijam, joṅgakam, aguru
vāṇijyam2.9.80NeuterSingularvasnaḥ, avakrayaḥ
vanīyakaḥ3.1.48MasculineSingularyācakaḥ, arthī, yācānakaḥ, mārgaṇaḥ
varadaḥ3.1.5MasculineSingularsamardhakaḥ
varaṇaḥMasculineSingularsetuḥ, tiktaśākaḥ, kumārakaḥ, varuṇaḥ
varārohā2.6.4FeminineSingularuttamā, varavarṇinī, mattakāśinī
varīyān3.3.243MasculineSingularnāgadantakam, dvāram, āpīḍam, kvātharasaḥ
varṣam3.3.232MasculineSingularadhikṛtaḥ, pratyakṣam
varṣopalaḥMasculineSingularkarakāhail
varvaṇā2.5.29FeminineSingularnīlā, makṣikā
vāśikāFeminineSingularaṭarūpaḥ, siṃhāsyaḥ, vāsyaḥ, vaidyamātā, vājidantakaḥ, siṃhī, vṛṣaḥ
vāsitā3.3.82FeminineSingularhetuḥ, lakṣma
vāvadūkaḥ3.1.33MasculineSingularvāgmī, ativak, vācoyuktipaṭuḥ
velljam2.9.36NeuterSingularkṛṣṇam, ūṣaṇam, dharmapattanam, marīcam, kolakam
vibhītakaḥ2.2.57MasculineSingulartuṣaḥ, karṣaphalaḥ, bhūtāvāsaḥ, kalidrumaḥ, akṣaḥ
vidhiḥ3.3.106MasculineSingularvidhiḥ, prakāraḥ
vidvān2.7.5MasculineSingulardhīraḥ, prājñaḥ, kaviḥ, kṛtī, vicakṣaṇaḥ, doṣajñaḥ, kovidaḥ, manīṣī, saṃkhyāvān, dhīmān, kṛṣṭiḥ, dūradarśī, san, budhaḥ, jñaḥ, paṇḍitaḥ, sūriḥ, labdhavarṇaḥ, dīrghadarśī, vipaścit, sudhīḥ
vīghram3.1.54MasculineSingularvimalātmakam
vījakośaḥ1.10.43MasculineSingularvarāṭakaḥthe seed of the lotus
vikramaḥ2.8.107MasculineSingularatiśaktitā
vikretā2.9.80MasculineSingularkrāyakaḥ
vīṇāFeminineSingularvipañcakī, vallakīa lute
vināśonmukham3.1.90MasculineSingularpakvam
vīravṛkṣaḥ2.2.42MasculineSingularuruṣkaraḥ, agnimukhī, bhallātakī
viśalyāFeminineSingularagniśikhā, anantā, phalinī, śakrapuṣpī
viśalyā3.3.163FeminineSingularharmyādeḥprakoṣṭhaḥ, kañcī, madhyebhabandhanam
viśāradaḥ3.3.102MasculineSingularyajñitaroḥśākhā, upasūryakaḥ
viṣṇuḥ1.1.18-21MasculineSingularadhokṣajaḥ, vidhuḥ, yajñapuruṣaḥ, viśvarūpaḥ, vaikuṇṭhaḥ, hṛṣīkeśaḥ, svabhūḥ, govindaḥ, acyutaḥ, janārdanaḥ, cakrapāṇiḥ, madhuripuḥ, devakīnandanaḥ, puruṣottamaḥ, kaṃsārātiḥ, kaiṭabhajit, purāṇapuruṣaḥ, jalaśāyī, muramardanaḥ, kṛṣṇaḥ, dāmodaraḥ, mādhavaḥ, puṇḍarīkākṣaḥ, pītāmbaraḥ, viśvaksenaḥ, indrāvarajaḥ, padmanābhaḥ, trivikramaḥ, śrīpatiḥ, balidhvaṃsī, viśvambharaḥ, śrīvatsalāñchanaḥ, narakāntakaḥ, mukundaḥ, nārāyaṇaḥ, viṣṭaraśravāḥ, keśavaḥ, daityāriḥ, garuḍadhvajaḥ, śārṅgī, upendraḥ, caturbhujaḥ, vāsudevaḥ, śauriḥ, vanamālī(45)vishnu, the god
visphoṭaḥ2.6.53NeuterSingularpiṭakaḥ
visrambhaḥ3.3.143MasculineSingularadhyakṣaḥ
vitunnakaḥNeuterSingulartālī, śivā, tāmlakī, jhaṭā, amalā, ajjhaṭā
vitunnamNeuterSingularsuniṣaṇṇakam
vivadhaḥ3.3.103MasculineSingulardoṣotpādaḥ, prakṛtyādivinaśvaraḥ(vyākaraṇe), mukhyānuyāyīśiśuḥ, prakṛtasyānuvartanam
vivarṇaḥ2.10.16MasculineSingularjālmaḥ, ‍‍pṛthagjanaḥ, ‍pāmaraḥ, itaraḥ, apasadaḥ, ‍prākṛtaḥ, ‍kṣullakaḥ, nihīnaḥ, nīcaḥ
vrajaḥ3.3.36MasculineSingularsamakṣmāṃśaḥ, raṇaḥ
vṛddhasaṃghaḥ2.6.40MasculineSingularvārddhakam
vṛddhiḥFeminineSingularyogyam, ṛddhiḥ, siddhiḥ, lakṣmīḥ
vṛkadhūpaḥ1.2.129MasculineSingularkṛtrimadhūpakaḥ
vṛścikaḥ3.3.7MasculineSingularsihlakam, tilakalkam
vṛścīkaḥ2.2.15MasculineSingularśūkakīṭaḥ
vyāḍāyudhamNeuterSingularcakrakārakam, vyāghranakham, karajam
vyādhaḥ2.10.19MasculineSingularmṛgavadhājīvaḥ, mṛgayuḥ, lubdhakaḥ
vyāghrapucchaḥ2.2.50MasculineSingularvyaḍambakaḥ, pañcāṅgulaḥ, rucakaḥ, gandharvahastakaḥ, varddhamānaḥ, cañcuḥ, erubūkaḥ, maṇḍaḥ, citrakaḥ, eraṇḍaḥ
vyājaḥMasculineSingularapadeśaḥ, lakṣyamdisguise
vyajanam1.2.140NeuterSingulartālavṛntakam
vyaktaḥ3.3.69MasculineSingularyamaḥ, siddhāntaḥ, daivam, akuśalakarma
vyālagrāhī1.8.11MasculineSingularahituṇḍakaḥa snake charmer
vyasanārtaḥ3.1.42MasculineSingularuparaktaḥ
vyuṣṭiḥ3.3.44FeminineSingulardakṣaḥ, amandaḥ, agadaḥ
yajñaḥ2.7.15MasculineSingularkratuḥ, savaḥ, adhvaraḥ, yāgaḥ, saptatantuḥ, makhaḥ
yakṛt2.6.67NeuterSingularkālakhaṇḍam
yāsaḥMasculineSingulardurālabhā, kacchurā, dhanvayāsaḥ, samudrāntā, rodanī, duḥsparśaḥ, anantā, kunāśakaḥ, yavāsaḥ
yaśaḥpaṭahaḥMasculineSingularḍhaka doble drum
yātrā3.3.183FeminineSingularsaraghā, kaṇṭakārikā, krūraḥ, vyaṅgā, adhanaḥ, naṭī, alpaḥ, veśyā
yavaḥ2.9.16MasculineSingularsitaśakaḥ
yavakṣāraḥ2.9.109MasculineSingularsauvarcalam, rucakam, ‍kāpotaḥ, ‍sukhavarcakaḥ
yavyam2.9.7MasculineSingularyavakyam, ‍ṣaṣṭikyam
yogyamNeuterSingularṛddhiḥ, siddhiḥ, lakṣmīḥ
lakṣmīḥ1.1.27FeminineSingularbhārgavī, , haripriyā, padmā, kṣīrasāgarakanyakā, ramā, lokamātā, śrīḥ, padmālayā, lokajananī, kṣīrodatanayā, indirā, kamalālaxmi, goddess of wealth
kaumodakīFeminineSingularone kind of weapon of krishna
nandakaḥMasculineSingularone kind of weapon of krishna
vināyakaḥMasculineSingulargaṇādhipaḥ, ekadantaḥ, herambaḥ, lambodaraḥ, vighnarājaḥ, gajānanaḥ, dvaimāturaḥganesh
nalakūvaraḥMasculineSingularson of kuber
alakāFeminineSingularcity of kuber
cakravālamNeuterSingularmaṇḍalamthe sensible horizon
nakṣatramNeuterSingularbham, tārā, tārakā, uḍuḥ, ṛkṣamstar
invakāḥ1.3.23FemininePluralname of the naksatra mrigashirsha
aṃgārakaḥ1.3.25MasculineSingularmahīsutaḥ, kujaḥ, bhaumaḥ, lohitāṅgaḥmars
prakāśaḥ1.3.34MasculineSingulardyotaḥ, ātapaḥsun-shine
pakṣatiḥFeminineSingularpratipatthe first day of half month
pakṣiṇīFeminineSingulara night and two days
pakṣāntauMasculineDualpañcadaśyaulast day of the half month
pakṣaḥ1.4.12MasculineSingulara fort night
vyaktiḥ1.5.1FeminineSingularpṛthagātmatāindividual
anakṣaramMasculineSingularavācyamunfit to be uttered
ānakaḥMasculineSingularpaṭahaḥa large kettle drum
kolambakaḥMasculineSingularthe body of a lute
nartakī1.7.8FeminineSingularlāsikāa female dancer
bhrakuṃsaḥMasculineSingularbhrukuṃsaḥ, bhrūkuṃsaḥa male dancer in woman's appearl
bhaṭṭārakaḥMasculineSingulardevaḥa king
vyañjakaḥMasculineSingularabhinayaḥgesture
ācchuritakamNeuterSingulara horse laugh
bhrakuṭiḥFeminineSingularbhrukuṭiḥ, bhrūkuṭiḥa frown
andhakāraḥMasculineSingulartamisram, timiram, tamaḥ, dhvāntamperforated, or full of holes
nārakaḥMasculineSingularnarakaḥ, nirayaḥ, durgatiḥhell
narakabhedāḥ1.9.1MasculinePluraldifferent types of hell
alakṣmīḥ1.9.2FeminineSingularnirṛtiḥmisfortune or misery
vakramNeuterPluralpuṭabhedaḥa winding decent of water
kūpakaḥMasculineSingularvidārakaḥa temporarry well
niyāmakaḥMasculineSingularpotavāhaḥthe crew
kūpakaḥ1.10.12MasculineSingularguṇavṛkṣakaḥthe mast
gaḍakaḥ1.10.17MasculineSingularśakulārbhakaḥsheat fish
nakraḥMasculineSingularkumbhīraḥcrocodile
raktapā1.10.22FeminineSingularjalaukasaḥ, jalaukāa leech
hallakam1.10.36NeuterSingularraktasandhyakamred lotus
raktotpalam1.10.41NeuterSingularkokanadamred lotus
kiñjalakaḥMasculineSingularkesaraḥa filament
vījakośaḥ1.10.43MasculineSingularvarāṭakaḥthe seed of the lotus
śṛṅgāṭakamNeuterSingularcatuṣpatham
upakāryāFeminineSingularupakārikā
pakṣadvāramNeuterSingularpakakaḥ
hastimakhaḥMasculineSingular
pakkaṇaḥ2.2.20MasculineSingularśavarālayaḥ
kaṭakaḥMasculineSingular
devakhātamNeuterSingularbilam, guhā, gahvaram
dantakaḥMasculinePlural
upatyakāFeminineSingular
adhityakā2.3.7FeminineSingular
prakāṇḍaḥ2.4.10MasculineSingularskandhaḥ
tvak2.4.12FeminineSingularvalkam, valkalam
kṣārakaḥMasculineSingularjālakam
gutstakaḥMasculineSingularstabakaḥ
makarandaḥMasculineSingularpuṣparasaḥ
madhūlakaḥMasculineSingular
plakṣaḥMasculineSingularjaṭī, parkaṭī
sahakāraḥ2.4.33MasculineSingular
svādukaṇṭakaḥ2.4.37MasculineSingularsruvāvṛkṣaḥ, granthilaḥ, vyāghrapāt, vikaṅkataḥ
tilakaḥMasculineSingularkṣurakaḥ, śrīmān
pītasālakaḥ2.2.43MasculineSingularbandhūkapuṣpaḥ, priyakaḥ, jīvakaḥ, sarjakaḥ, asanaḥ
prakīryaḥ2.2.48MasculineSingularpūtikarajaḥ, pūtikaḥ, kalimārakaḥ
piṇḍītakaḥ2.2.52MasculineSingularmaruvakaḥ, śvasanaḥ, karahāṭakaḥ, śalyaḥ, madanaḥ
śakrapādapaḥ2.2.53MasculineSingulardevadāru, bhadradāru, drukilimam, pītadāru, dāru, pūtikāṣṭham, pāribhadrakaḥ
vibhītakaḥ2.2.57MasculineSingulartuṣaḥ, karṣaphalaḥ, bhūtāvāsaḥ, kalidrumaḥ, akṣaḥ
lakucaḥ2.2.60MasculineSingularlikucaḥ, ḍihuḥ
karakaḥ2.2.64MasculineSingulardāḍimaḥ
raktakaḥMasculineSingularbandhūkaḥ, bandhujīvakaḥ
kurabakaḥMasculineSingular
kuruṇṭakaḥMasculineSingular
saireyakaḥMasculineSingularjhiṇṭī
kurabakaḥMasculineSingular
kuraṇṭakaḥMasculineSingularsahacarī
mātulaputrakaḥMasculineSingular
rucakaḥMasculineSingularmātuluṅgakaḥ
gajabhakṣyāFeminineSingularsuvahā, hlādinī, surabhī, rasā, maheraṇā, kundurukī, sallakī
upakuñcikāFeminineSingulartruṭiḥ, tutthā, koraṅgī, tripuṭā
vitunnakaḥNeuterSingulartālī, śivā, tāmlakī, jhaṭā, amalā, ajjhaṭā
āḍhakīFeminineSingularkākṣī, mṛtsnā, tuvarikā, mṛttālakam, surāṣṭrajam
tvakpatramNeuterSingulartvacam, cocam, varāṅgakam, utkaṭam, bhṛṅgam
karcūrakaḥMasculineSingulardrāviḍakaḥ, kālpakaḥ, vedhamukhyakaḥ
makūlakaḥMasculineSingularnikumbhaḥ, dantikā, pratyakśreṇī, udumbaraparṇī
vātakaḥMasculineSingularaparājitā, śataparṇī, śītalaḥ
viṣvaksenapriyāFeminineSingularbadarā, gṛṣṭiḥ, vārāhī
kulakamNeuterSingularpaṭolaḥ, tiktakaḥ, paṭuḥ
kūṣmāṇḍakaḥMasculineSingularkarkāruḥ
upodakāFeminineSingular
mūlakamNeuterSingular
bhadramustakaḥMasculineSingulargundrā
kīcakaḥMasculineSingular
mālātṛṇakamNeuterSingularbhūstṛṇam
tarakṣuḥ2.5.2MasculineSingularmṛgādanaḥ
gaṇḍakaḥ2.2.5MasculineSingularkhaḍgaḥ, khaḍgī
śatapatrakaḥ2.5.18MasculineSingulardārvāghāṭaḥ
caṭakaḥ2.5.20MasculineSingularkalaviṅkaḥ
caṭakā2.5.20FeminineSingular
caṭakairaḥ2.5.20MasculineSingular
caṭakā2.5.20FeminineSingular
droṇakākaḥMasculineSingularkākolaḥ
bakaḥ2.5.24MasculineSingularkahvaḥ
lakṣmaṇā2.5.28FeminineSingular
vanamakṣikā2.5.29FeminineSingulardaṃśaḥ
candrakaḥ2.5.33MasculineSingularmecakaḥ
pakṣatiḥ2.5.38FeminineSingularpakṣamūlam
sak2.6.12FeminineSingularāliḥ, vayasyā
bāndhakineyaḥ2.6.26MasculineSingularbandhulaḥ, asatīsutaḥ, ‍kaulaṭeraḥ, ‍kaulaṭeyaḥ
golakaḥ2..6.36MasculineSingular
tilakaḥ2.6.49MasculineSingulartilakālakaḥ
durnāmakam2.6.54NeuterSingulararśaḥ
vātakī2.6.60MasculineSingularvātarogī
tvak2.6.63FeminineSingularasṛgdharā
tilakam2.6.66NeuterSingularkloma
yakṛt2.6.67NeuterSingularkālakhaṇḍam
śakṛt2.6.68NeuterSingularpurīṣam, gūtham, varcaskam, uccāraḥ, viṣṭhā, avaskaraḥ, viṭ, śamalam
sakthi2.6.74NeuterSingularūruḥ
śroṇiphalakam2.6.75NeuterSingularkaṭaḥ
kūpakaḥ2.6.76MasculineDualkukundaram
prakoṣṭhaḥ2.6.81MasculineSingular
tārakā2.6.93FeminineSingularkanīnikā
alakaḥ2.6.97MasculineSingularcūrṇakuntalaḥ
bhramarakaḥ2.6.97MasculineSingular
kākapakṣaḥ2.6.97MasculineSingularśikhaṇḍakaḥ
graiveyakam2.6.105NeuterSingularkaṇṭhabhūṣā
nakṣatramālā2.6.106FeminineSingular
āvāpakaḥ2.6.108MasculineSingularpārihāryaḥ, kaṭakaḥ, valayaḥ
aṅgalīyakaḥ2.6.108MasculineSingularūrmikā
sucelakaḥ2.6.117MasculineSingularpaṭaḥ
sthūlaśāṭakaḥ2.6.117MasculineSingularvarāśiḥ
tilakam2.6.124NeuterSingularcitrakam, viśeṣakam, tamālapatram
jāyakam2.6.126NeuterSingularkālīyakam, kālānusāryam
vaṃśakam2.6.127NeuterSingularrājārham, loham, kri, mijam, joṅgakam, aguru
yakṣadhūpaḥ2.6.128MasculineSingularsarjarasaḥ, rālaḥ, sarvarasaḥ, bahurūpaḥ
kolakam1.2.130NeuterSingularkakkolakam, kośaphalam
yakakardamaḥ1.2.134MasculineSingular
garbhakaḥ1.2.136MasculineSingular
prabhaṣṭakam1.2.136NeuterSingular
lalāmakam1.2.136NeuterSingular
vaikakakam1.2.137NeuterSingular
samudgakaḥ1.2.140MasculineSingularsaṃpuṭakaḥ
upakramaḥ2.7.15MasculineSingular
puṇyakam2.7.41NeuterSingular
snātakaḥ2.7.47MasculineSingularāplutaḥ
cakravartī2.8.2MasculineSingularsarvabhau‍maḥ
rājakam2.8.3NeuterSingular
rakṣivargaḥ2.8.6MasculineSingularanīkasthaḥ
adhyakṣaḥ2.8.6MasculineSingularadhikṛtaḥ
kanakādhyakṣaḥ2.8.7MasculineSingularbhaurikaḥ
rūpyādhyakṣaḥ2.8.7MasculineSingularnaiṣkikaḥ
sevakaḥ2.8.9MasculineSingulararthī, anujīvī
sakhyam2.8.12NeuterSingularsāptapadīnam
lekhakaḥ2.8.15MasculineSingularakṣaracaṇaḥ, akṣaracuñcuḥ, lipiṃkaraḥ
śaktiḥ2.8.17FeminineSingular
aṣaḍakṣīṇaḥ2.8.21MasculineSingular
yautakam2.8.29NeuterSingularsudāyaḥ, haraṇam
nṛpalakṣma2.8.32NeuterSingular
pūrṇakumbhaḥ2.8.32MasculineSingularbhadrakumbhaḥ
madakalaḥ2.8.36MasculineSingularmadotkaṭaḥ
padmakam2.8.40NeuterSingularbindujālakam
śakaṭaḥ2.8.52MasculineSingularanaḥ
cakram2.8.56NeuterSingularrathāṅgam
vainītakam2.8.60MasculineSingular
rathakuṭumbinaḥ2.8.61MasculineSingulardakṣiṇasthaḥ, yantā, sūtaḥ, kṣattā, sārathiḥ, niyantā, savyeṣṭhaḥ, prājitā
śīrṣakam2.8.65NeuterSingularśīrṣaṇyam, śirastram
lastakaḥ2.8.86MasculineSingulardhanurmadhyam
sthānapañcakam2.8.86NeuterSingular
lakṣyam2.8.87NeuterSingularla‍kṣam, śaravyam
pakṣaḥ2.8.88MasculineSingular‍vājaḥ
phalakaḥ2.8.91MasculineSingularphalam, carmaḥ
pracakram2.8.97NeuterSingularcalitam
stutipāṭhakaḥ2.8.99MasculineSingularbandī
saṃśaptakaḥ2.8.99MasculineSingular
kusīdakaḥ2.9.6MasculineSingularvārdhuṣikaḥ, vṛddhyājīvaḥ, vādrdhuṣiḥ
karṣakaḥ2.9.6MasculineSingular‍kṛṣikaḥ, ‍kṛṣīvalaḥ, kṣetrājīvaḥ
kaidārakam2.9.12NeuterSingular‍kaidāryam, kṣaitram, kaidārikam
satīnakaḥ2.9.16MasculineSingularkalāyaḥ, hareṇuḥ, khaṇḍikaḥ
āvakaḥ2.9.19MasculineSingularkulmāṣaḥ
sūpakāraḥ2.9.28MasculineSingularballavaḥ
vardhamānakaḥ2.9.32MasculineSingularśarāvaḥ
ruhastakaḥ2.9.34MasculineSingulartardūḥ
jīrakaḥ2.9.37MasculineSingularkaṇā, jaraṇaḥ, ajājī
ādrakam2.9.38NeuterSingularśṛṅgaveram
raumakam2.9.43NeuterSingularvasukam
tilakam2.9.43NeuterSingular
āpakvam2.9.47NeuterSingular‍pauliḥ, abhyūṣaḥ
takram2.9.55NeuterSingular
aukṣakam2.9.60NeuterSingular‍gavyā
tarṇakaḥ2.9.62MasculineSingular
droṇakṣīrā2.9.73FeminineSingular
vaidehakaḥ2.9.79MasculineSingularvikrayikaḥ
māṣakaḥ2.9.86MasculineSingularakṣaḥ
marakata2.9.93NeuterSingularśoṇaratnam, padmarāgaḥ
lohitakaḥ2.9.93MasculineSingular
tāmrakam2.9.98NeuterSingularaśmasāraḥ, śastrakam, tīkṣṇam, piṇḍam, kālāyasam, ayaḥ
abhrakam2.9.101NeuterSingularsauvīram, kāpotāñjanam, yāmunam
cakṣuṣyā2.9.103FeminineSingularpuṣpakam, ku‍sumāñjanam, puṣpaketu
meṣakambalam2.9.108MasculineSingular‍śaśaloma
yavakṣāraḥ2.9.109MasculineSingularsauvarcalam, rucakam, ‍kāpotaḥ, ‍sukhavarcakaḥ
bhūtakeśaḥ2.9.112MasculineSingularraktacandanam
vaidehakaḥ2.10.3MasculineSingular
rathakāraḥ2.10.4MasculineSingular
kulakaḥ2.10.5MasculineSingularkulaśreṣṭhī
kumbhakāraḥ2.10.6MasculineSingularkulālaḥ
citrakaraḥ2.10.7MasculineSingularraṅgājīvaḥ
carmakāraḥ2.10.7MasculineSingularpādūkṛt
lohakāraḥ2.10.7MasculineSingularvyokāraḥ
svarṇakāraḥ2.10.8MasculineSingularnāḍindhamaḥ, kalādaḥ, rūkmakārakaḥ
kuṭṭakaḥ2.10.8MasculineSingularśaulvikaḥ
rathakāraḥ2.10.9MasculineSingulartakṣā, ‍vardhakiḥ, tvaṣṭāḥ, kāṣṭhataṭ
anadhīnakaḥ2.10.9MasculineSingularkauṭatakṣaḥ
rajakaḥ2.10.10MasculineSingularnirṇejakaḥ
jīvāntakaḥ2.10.14MasculineSingularśākunikaḥ
śunakaḥ2.10.22MasculineSingularmṛgadaṃśakaḥ, bhaṣakaḥ, śvā, kauleyakaḥ, sārameyaḥ, kukkuraḥ
kuraṅgakaḥ2.10.24MasculineSingular
caurakaḥ2.10.24MasculineSingularparāskandī, taskaraḥ, aikāgārikaḥ, ‍‌pratirodhī, dasyuḥ, malimlucaḥ, ‍‍‍pāṭaccaraḥ, moṣakaḥ, stenaḥ
vītasaṃstūpakaraṇam2.10.26MasculineSingular
piṭakaḥ2.10.30MasculineSingular‍‍‍peṭakaḥ, peṭā, mañjūṣā
mādhavakaḥ2.10.41MasculineSingularmadhvāsavaḥ, ma‍dhu, mādhvikam
caṣakaḥ2.10.43MasculineSingularpānapātram
sarakaḥ2.10.43MasculineSingularanutarṣaṇam
pāśakaḥ2.10.45MasculineSingularakṣaḥ, devanaḥ
dakṣaṇīyaḥ3.1.3MasculineSingulardakṣiṇyaḥ, dakṣiṇārhaḥ
parīkṣakaḥ3.1.5MasculineSingularkāraṇikaḥ
dakṣiṇaḥ3.1.6MasculineSingularsaralaḥ, udāraḥ
lakṣmīvataḥ3.1.13MasculineSingularśrīmān, lakśmaṇaḥ, śīlaḥ
karmakṣamaḥ3.1.16MasculineSingularalaṅkarmīṇaḥ
karmakaraḥ3.1.17MasculineSingularbharaṇyabhuk
karmakāraḥ3.1.17MasculineSingular
bhakakaḥ3.1.19MasculineSingularghasmaraḥ, admaraḥ
vilakṣaḥ3.1.25MasculineSingularvismayānvitaḥ
abhivādakaḥ3.1.26MasculineSingularvandāruḥ
svapnak3.1.31MasculineSingularśayāluḥ, nidrāluḥ
vak3.1.33MasculineSingularvadaḥ, vadāvadaḥ
śaklaḥ3.1.33MasculineSingularpriyaṃvadaḥ
vanīyakaḥ3.1.48MasculineSingularyācakaḥ, arthī, yācānakaḥ, mārgaṇaḥ
saṃsaktaḥ3.1.67MasculineSingularavyavahitam, apaṭāntaram
pratyakṣam3.1.78MasculineSingularaindriyakam
apratyakṣam3.1.78MasculineSingularatīndriyam
bhinnārthakaḥ3.1.81MasculineSingularanyataraḥ, ekaḥ, tvaḥ, anyaḥ, itaraḥ
anāyasakṛtam3.1.94MasculineSingularphāṇṭam
niṣpakvam3.1.94MasculineSingularkathitam
pakvam3.1.95MasculineSingularpariṇatam
tyaktam3.1.108MasculineSingularvidhutam, samujjhitam, dhūtam, utsṛṣṭam, hīnam
bhakṣitaḥMasculineSingularglastam, annam, khāditam, liptam, bhuktam, grastam, abhyavahṛtam, gilitam, carvitam, aśitam, jagdham, psātam, pratyasitam
vaśakriyā3.2.4FeminineSingularsaṃvananam
mūlakarma3.2.4NeuterSingularkārmaṇam
rakṣṇaḥ03.04.2008FeminineSingulartrāṇaḥ
prakramaḥ2.4.26MasculineSingularabhyādānam, udghātaḥ, ārambhaḥ, upakramaḥ
melakaḥ2.4.29MasculineSingularsaṅgaḥ, saṅgamaḥ
mānuṣyakam2.4.42NeuterSingularbhuvanam, janaḥ
sāhasrakārīṣam2.4.42NeuterSingularkroṣṭā, varuṇaḥ
sāyakaḥ3.3.2MasculineSingularutsaṅgaḥ, cihnaḥ
takakaḥ3.3.4MasculineSingularkariṇaḥpucchamūlopāntam, ulūkaḥ
pecakaḥ3.3.6MasculineSingularekadeśaḥ, pratikūlaḥ
karakaḥ3.3.6MasculineSingularbhūnimbaḥ, kaṭphalam, bhūstṛṇam
vināyakaḥ3.3.6MasculineSingularjyotsnikā, ghoṣaḥ
kośātakī3.3.8FeminineSingulartāpaḥ, śaṅkā, ruk
kṣullakaḥ3.3.10MasculineSingularkapiḥ, kroṣṭā, śvānaḥ
vartakaḥ3.3.11MasculineSingularpīḍā
dīpakaḥ3.3.11MasculineSingularanvayaḥ, śīlaḥ
śakalam3.3.13NeuterSingularmeghajālam
vṛndārakaḥ3.3.16MasculineSingularsūcyagram, kṣudraśatruḥ, romaharṣaḥ
kaṭakaḥ3.3.18MasculineSingularvyāghraḥ
kaṇṭakaḥ3.3.18MasculineSingularvṛndaḥ
nāyakaḥ3.3.19MasculineSingulargrāmaḥ, phalakaḥ
lubdhakaḥ3.3.19MasculineSingularpuṣpareṇuḥ
peṭakaḥ3.3.20MasculineSingularstrīdhanam
kheṭakaḥ3.3.20MasculineSingularbhāvaḥ, vṛndaḥ
vārdhakam3.3.21MasculineSingulartviṭ, karaḥ, jvālā
dārakaḥ3.3.22MasculineSingularnidhiḥ, lalāṭāsthi, kambu
nīlakaṇṭhaḥ3.3.46MasculineSingularatiyuvā, alpaḥ
śakuntaḥ3.3.64MasculineSingularhāstipakaḥ, sūtaḥ
dhūmaketuḥ3.3.65MasculineSingulardhātā, poṣṭā
avyaktaḥ3.3.68MasculineSingularprakaraṇam, prakāraḥ, kārtsnyam, vārtā
vyaktaḥ3.3.69MasculineSingularyamaḥ, siddhāntaḥ, daivam, akuśalakarma
śaktiḥ3.3.73FeminineSingulardānam, avasānam
pakṣatiḥ3.3.79FeminineSingularyoṣit, janitātyarthānurāgāyoṣit
prakṛtiḥ3.3.79FeminineSingularkṣitivyudāsaḥ
raktam3.3.86MasculineSingularanavadhiḥ
kakudaḥ3.3.99MasculineSingulargosevitam, gopadamānam
viśvakarmā3.3.116MasculineSingularprabhā, sūryaḥ
pakṣma3.3.128NeuterSingulardhīḥ, paramātmā
lakṣma3.3.131NeuterSingularsalilam, kānanam
kakṣyā3.3.166FeminineSingularātmavān, arthātanapetaḥ
prakāraḥ3.3.170MasculineSingularabdaḥ, strīstanaḥ
cakram3.3.190NeuterSingularrahaḥ, antikam
prakāśaḥ3.3.226MasculineSingularkākaḥ, matsyaḥ
pakṣaḥ3.3.228MasculineSingularvārtā, karīṣāgniḥ, kulyā
nyakṣam3.3.233MasculineSingulartarkaṇaḥ, varṣam
adhyakṣaḥ3.3.233MasculineSingularsāraṅgaḥ
sakṛt3.3.250MasculineSingularpratyakṣam, tulyam
ghātakī3.5.7FeminineSingular
āḍhakī3.5.7FeminineSingular
sidhrakā3.5.8FeminineSingular
nakhaḥ3.5.12MasculineSingular
vaṭakaḥ3.5.17MasculineSingular
rallakaḥ3.5.17MasculineSingular
kuḍaṅgakaḥ3.5.17MasculineSingular
lakṣā3.5.24MasculineSingular
rakṣaḥsabham3.5.27NeuterSingular
upakramaḥ3.5.28MasculineSingular
kopakramam3.5.28NeuterSingular
toṭakam3.5.30NeuterSingular
kaṇṭakam3.5.32MasculineSingular
modakaḥ3.5.33MasculineSingular
taṇḍakaḥ3.5.33MasculineSingular
śāṭakaḥ3.5.33MasculineSingular
pātakaḥ3.5.33MasculineSingular
carakam3.5.33MasculineSingular
āmakam3.5.33MasculineSingular
varāṭakaḥ3.5.38Ubhaya-lingaSingular
varṇakaḥ3.5.38Ubhaya-lingaSingular
Monier-Williams Search
31987 results for ak
Devanagari
BrahmiEXPERIMENTAL
ak cl.1 P. akati-, to move tortuously (like a snake) ; Cf. ag- and añc-. View this entry on the original dictionary page scan.
akathe suffix aka- (akac-). View this entry on the original dictionary page scan.
akan. unhappiness, pain, trouble View this entry on the original dictionary page scan.
akan. sin View this entry on the original dictionary page scan.
akabaram. (emperor) Akbar, View this entry on the original dictionary page scan.
akabbara m. (emperor) Akbar, View this entry on the original dictionary page scan.
akacamfn. hairless, bald View this entry on the original dictionary page scan.
akacamfn. see ut--, ūrdhva--, vi-- View this entry on the original dictionary page scan.
akacam. Name of ketu-, the dragon's tail or descending node (having a headless trunk) View this entry on the original dictionary page scan.
akaḍaman. a kind of Tantrik diagram. View this entry on the original dictionary page scan.
akaḍamacakran. idem or 'n. a kind of Tantrik diagram.' View this entry on the original dictionary page scan.
akalamfn. not in parts, entire View this entry on the original dictionary page scan.
akalamfn. not skilled in the arts (kalās-). View this entry on the original dictionary page scan.
akālam. a wrong or bad time View this entry on the original dictionary page scan.
akāla(also) night, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
akālamfn. unseasonable View this entry on the original dictionary page scan.
akālahīnamind. without losing time, immediately. View this entry on the original dictionary page scan.
akālaja mfn. born at a wrong time, unseasonable. View this entry on the original dictionary page scan.
akālajaladodaya m. unseasonable rising of clouds or mist. View this entry on the original dictionary page scan.
akālajāta mfn. born at a wrong time, unseasonable. View this entry on the original dictionary page scan.
akālakan. food eaten at irregular times, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
akālakaumudīf. an irregular festival, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
akālakṣepamind. without delay View this entry on the original dictionary page scan.
akālakuṣmāṇḍam. a pumpkin produced out of season
akālakuṣmāṇḍam. a useless birth. View this entry on the original dictionary page scan.
akālakusuman. a flower blossoming out of season. View this entry on the original dictionary page scan.
akālameghodayam. unseasonable rising of clouds or mist. View this entry on the original dictionary page scan.
akalaṅkamfn. without stains or spots View this entry on the original dictionary page scan.
akalaṅkamfn. Name of a jaina-. View this entry on the original dictionary page scan.
akālasahamfn. unable to bide one's time. View this entry on the original dictionary page scan.
akālatasind. unseasonably. View this entry on the original dictionary page scan.
akālavelāf. wrong or unseasonable time. View this entry on the original dictionary page scan.
akāleind. unseasonably. View this entry on the original dictionary page scan.
akalimfn. not quarrelling View this entry on the original dictionary page scan.
akālikamind. immediately View this entry on the original dictionary page scan.
akalitamfn. incalculable, immeasurable, View this entry on the original dictionary page scan.
akalkamfn. free from impurity View this entry on the original dictionary page scan.
akalkāf. moonlight View this entry on the original dictionary page scan.
akalkanaor a-kalkala- mfn. not deceitful, honourable, () View this entry on the original dictionary page scan.
akalkatāf. honesty View this entry on the original dictionary page scan.
akalmaṣamf(ā-)n. spotless. View this entry on the original dictionary page scan.
akalmaṣam. Name (also title or epithet) of the fourth Manu, View this entry on the original dictionary page scan.
akalmāṣamf(ī-)n. spotless, View this entry on the original dictionary page scan.
akalmāṣam. Name of a son of the fourth manu- View this entry on the original dictionary page scan.
akālotpannamfn. born at a wrong time, unseasonable. View this entry on the original dictionary page scan.
akalpamf(ā-)n. not subject to rules, uncontrolled View this entry on the original dictionary page scan.
akalpamf(ā-)n. not admitting (any comparison pratim/ānam-) View this entry on the original dictionary page scan.
akalpamf(ā-)n. unable to (locative case or infinitive mood or in compound) View this entry on the original dictionary page scan.
akalpitamfn. not manufactured, not artificial, not pretended View this entry on the original dictionary page scan.
akalpitamfn. natural, genuine. View this entry on the original dictionary page scan.
akalyamf(ā-)n. ill, sick View this entry on the original dictionary page scan.
akalyanot to be guessed, View this entry on the original dictionary page scan.
akalyamf(ā-)n. true (?) View this entry on the original dictionary page scan.
akālyamfn. unseasonable. View this entry on the original dictionary page scan.
akalyāṇamfn. not handsome View this entry on the original dictionary page scan.
akalyāṇamfn. inauspicious View this entry on the original dictionary page scan.
akalyāṇan. adversity. View this entry on the original dictionary page scan.
akāmamf(ā-)n. without desire or wish View this entry on the original dictionary page scan.
akāmamf(ā-)n. unintentional, reluctant View this entry on the original dictionary page scan.
akāmamf(ā-)n. (in grammar) the saṃdhi- which causes the dropping of a final r- before a succeeding r-. View this entry on the original dictionary page scan.
akāmahata(/a-kāma--) mfn. unaffected with desire, calm View this entry on the original dictionary page scan.
akāmakarśana(/a-kāma--) mfn. not disappointing desires View this entry on the original dictionary page scan.
akāmasaṃjñapanan. unintentional killing of a victim before a sacrifice, View this entry on the original dictionary page scan.
akāmatāf. freedom from desire, etc. View this entry on the original dictionary page scan.
akāmatasind. unintentionally, unwillingly. View this entry on the original dictionary page scan.
akāminmfn. equals a-kām/a-. View this entry on the original dictionary page scan.
akampanam. Name of a prince View this entry on the original dictionary page scan.
akampanam. of a rākṣasa-. View this entry on the original dictionary page scan.
akampitamfn. unshaken, firm View this entry on the original dictionary page scan.
akampitam. Name of one of the 11 chief pupils (gaṇadhara-or gaṇādhipa-) of mahāvīra- (the last tīrtha-kara-). View this entry on the original dictionary page scan.
akampyamfn. not to be shaken. View this entry on the original dictionary page scan.
akāṇamf(ā-)n. not one eyed, not monoculous and View this entry on the original dictionary page scan.
akaṇakamfn. (rice) without red particles adhering to the husks, View this entry on the original dictionary page scan.
akāṇḍamfn. without a trunk View this entry on the original dictionary page scan.
akāṇḍamfn. causeless, unexpected View this entry on the original dictionary page scan.
akāṇḍapātajātamfn. dying as soon as born. View this entry on the original dictionary page scan.
akāṇḍaśūlan. sudden, acute pain. View this entry on the original dictionary page scan.
akāṇḍeind. causelessly, unexpectedly. View this entry on the original dictionary page scan.
akaniṣṭham. plural of whom none is the youngest (id est younger than the others) View this entry on the original dictionary page scan.
akaniṣṭham. a class of Buddhist deities. View this entry on the original dictionary page scan.
akaniṣṭhagam. a buddha- View this entry on the original dictionary page scan.
akaniṣṭhapam. a Buddhist king View this entry on the original dictionary page scan.
akaṇṭakamfn. thornless, free from troubles or difficulties or enemies. View this entry on the original dictionary page scan.
akaṇṭhamfn. having no neck View this entry on the original dictionary page scan.
akaṇṭhamfn. having no voice, hoarse. View this entry on the original dictionary page scan.
akanyāf. not a virgin View this entry on the original dictionary page scan.
akapīvatm. Name of a ṛṣi-. View this entry on the original dictionary page scan.
akaramfn. handless, maimed View this entry on the original dictionary page scan.
akaramfn. exempt from tax or duty, privileged View this entry on the original dictionary page scan.
akaramfn. not acting View this entry on the original dictionary page scan.
akarāf. Emblic Myrobalan, Phyllanthus Emblica. View this entry on the original dictionary page scan.
akāram. the letter or sound a-. View this entry on the original dictionary page scan.
akaraṇan. absence of action. View this entry on the original dictionary page scan.
akāraṇamfn. causeless View this entry on the original dictionary page scan.
akāraṇan. absence of a cause View this entry on the original dictionary page scan.
akāraṇamind. causelessly. View this entry on the original dictionary page scan.
akāraṇātind. causelessly. View this entry on the original dictionary page scan.
akāraṇeind. causelessly. View this entry on the original dictionary page scan.
akāraṇenaind. causelessly. View this entry on the original dictionary page scan.
akaraṇif. non-accomplishment, failure, disappointment (used in imprecations e.g. tasyākaraṇir evāstu-bad luck to him!) View this entry on the original dictionary page scan.
akaraṇīyamfn. not to be done. View this entry on the original dictionary page scan.
akāraṇotpannamfn. produced spontaneously. View this entry on the original dictionary page scan.
akārinmfn. inactive, not performing, (gaRa grahādi-, q.v) View this entry on the original dictionary page scan.
akariṣyatmfn. not intending to do, View this entry on the original dictionary page scan.
akarkaśamfn. not hard, tender. View this entry on the original dictionary page scan.
akarmabhogam. enjoyment of freedom from action. View this entry on the original dictionary page scan.
akarmakamfn. (in grammar) intransitive. View this entry on the original dictionary page scan.
akarmanmfn. not working View this entry on the original dictionary page scan.
akarmanmfn. not performing good works, wicked View this entry on the original dictionary page scan.
akarmanmfn. inefficient View this entry on the original dictionary page scan.
akarmanmfn. (in grammar) intransitive View this entry on the original dictionary page scan.
akarmann. absence of work View this entry on the original dictionary page scan.
akarmann. observances View this entry on the original dictionary page scan.
akarmann. improper work, crime. View this entry on the original dictionary page scan.
akarmānvitamfn. unoccupied View this entry on the original dictionary page scan.
akarmānvitamfn. disqualified. View this entry on the original dictionary page scan.
akarmaṇyamfn. improper to be done View this entry on the original dictionary page scan.
akarmaṇyamfn. unfit for work View this entry on the original dictionary page scan.
akarmaṇyamfn. inefficient. View this entry on the original dictionary page scan.
akarmikāf. idle, View this entry on the original dictionary page scan.
akarṇamf(ā-)n. having diminutive ears View this entry on the original dictionary page scan.
akarṇamf(ā-)n. without ears, deaf View this entry on the original dictionary page scan.
akarṇamf(ā-)n. without helm or rudder View this entry on the original dictionary page scan.
akarṇamf(ā-)n. without karṇa-. View this entry on the original dictionary page scan.
akarṇadhāramfn. without a helmsman, destitute of a pilot. View this entry on the original dictionary page scan.
akarṇakamfn. without ears View this entry on the original dictionary page scan.
akārṇaveṣṭakikamf(ī-)n. not fit for ear-rings, not looking well with ear-rings See karṇa-veṣṭaka-. View this entry on the original dictionary page scan.
akarṇīyamfn. not to be heard, View this entry on the original dictionary page scan.
akarṇyamfn. not fit for the ears View this entry on the original dictionary page scan.
akārṣṇyan. absence of blackness. View this entry on the original dictionary page scan.
akartanam. a dwarf View this entry on the original dictionary page scan.
akartṛm. not an agent, N. applied to the puruṣa- (in sāṃkhya- philosophy) View this entry on the original dictionary page scan.
akartṛm. not active (in grammar) View this entry on the original dictionary page scan.
akartṛtvan. state of non-agency.
akaruṇamfn. merciless, relentless. View this entry on the original dictionary page scan.
akaruṇatvan. harshness, cruelty. View this entry on the original dictionary page scan.
akāryamfn. not to be done, improper View this entry on the original dictionary page scan.
akāryan. a criminal action. View this entry on the original dictionary page scan.
akāryakārinmfn. an evil-doer View this entry on the original dictionary page scan.
akāryakārinmfn. neglecting duty. View this entry on the original dictionary page scan.
akāsāram. Name of a teacher View this entry on the original dictionary page scan.
akasmātind. without a why or a wherefore, accidentally, suddenly. View this entry on the original dictionary page scan.
akasyavidmfn. not attending to anything, View this entry on the original dictionary page scan.
akātaramfn. not dejected. View this entry on the original dictionary page scan.
akathahan. a kind of diagram. View this entry on the original dictionary page scan.
akaṭhoramfn. not hard, weak. View this entry on the original dictionary page scan.
akathyamfn. unspeakable View this entry on the original dictionary page scan.
akathyamfn. unutterable, unmentionable. View this entry on the original dictionary page scan.
akatthanamfn. unboastful. View this entry on the original dictionary page scan.
akaṭukamfn. not acrid, not impetuous View this entry on the original dictionary page scan.
akaṭukamfn. unwearied, indefatigable. View this entry on the original dictionary page scan.
akaṭuphalam. a kind of plant. View this entry on the original dictionary page scan.
akauśalan. unskilfulness View this entry on the original dictionary page scan.
akauśalan. see ākauśala-. View this entry on the original dictionary page scan.
akavamfn. (fr. 1. ku- q.v), not contemptible, not stingy View this entry on the original dictionary page scan.
akavacamfn. having no coat of mail View this entry on the original dictionary page scan.
akāvaṅkan. water (= aṅkā- ṅk/a-), View this entry on the original dictionary page scan.
akavara m. (emperor) Akbar, View this entry on the original dictionary page scan.
akavārimf(ī-)n. not selfish, not stingy ([ explains by a-kava-ari-,"not contemptible as an enemy, or to his enemies, not having weak enemies"]) . View this entry on the original dictionary page scan.
akavimfn. unwise View this entry on the original dictionary page scan.
akāyamfn. bodiless, incorporeal View this entry on the original dictionary page scan.
akāyikāf. a kind of game, View this entry on the original dictionary page scan.
akeśamf(ā- ī- )n. hairless. View this entry on the original dictionary page scan.
aketanamfn. houseless. View this entry on the original dictionary page scan.
aketumfn. shapeless, unrecognisable View this entry on the original dictionary page scan.
aketumfn. ("unconscious") View this entry on the original dictionary page scan.
akhādyamfn. uneatable. View this entry on the original dictionary page scan.
akhanatmfn. not digging View this entry on the original dictionary page scan.
akhaṇḍamfn. not fragmentary, entire, whole View this entry on the original dictionary page scan.
akhaṇḍan. time View this entry on the original dictionary page scan.
akhaṇḍan. (a-khaṇḍā dvā-daśī-), the twelfth day of the first half of the month mārgaśīrṣa-.
akhaṇḍakalamfn. full (as the moon), View this entry on the original dictionary page scan.
akhaṇḍamaṇḍalamfn. possessing the whole country, View this entry on the original dictionary page scan.
akhaṇḍanan. not breaking, leaving entire View this entry on the original dictionary page scan.
akhaṇḍanan. non-refutation, admission View this entry on the original dictionary page scan.
akhaṇḍanam. time View this entry on the original dictionary page scan.
akhaṇḍitamfn. unbroken, undivided, unimpaired View this entry on the original dictionary page scan.
akhaṇḍitamfn. unrefuted. View this entry on the original dictionary page scan.
akhaṇḍitartu(ṛtu-) mfn. "not breaking the season", bearing seasonable fruits. View this entry on the original dictionary page scan.
akhaṇḍopadhim. a quality not to be defined by words, View this entry on the original dictionary page scan.
akharvamfn. not shortened or mutilated View this entry on the original dictionary page scan.
akharvamfn. not small, important View this entry on the original dictionary page scan.
akharvamfn. also a-kharvan- View this entry on the original dictionary page scan.
akharvāf. Name of a plant View this entry on the original dictionary page scan.
akharvan(?), mfn. unmutilated, unimpaired, View this entry on the original dictionary page scan.
akhātamfn. unburied View this entry on the original dictionary page scan.
akhātamn. a natural pond or lake, a pool before a temple View this entry on the original dictionary page scan.
akhaṭṭam. Buchanania Latifolia. View this entry on the original dictionary page scan.
akhaṭṭim. childish whim View this entry on the original dictionary page scan.
akhedinmfn. not wearisome, unwearied. View this entry on the original dictionary page scan.
akheditvan. continuous flow (of speech), one of the vāg-guṇas- of mahāvīra- View this entry on the original dictionary page scan.
akheṭikaor ākheṭika- m. a dog trained to the chase. View this entry on the original dictionary page scan.
akhidramf(ā-)n. not weak View this entry on the original dictionary page scan.
akhidrayāman(/akhidra--) mfn. unwearied in course View this entry on the original dictionary page scan.
akhilamf(ā-)n. without a gap, complete, whole View this entry on the original dictionary page scan.
akhilātmanm. the universal Spirit, brahma-. View this entry on the original dictionary page scan.
akhilenaind. completely. View this entry on the original dictionary page scan.
akhilīkṛ -kṛtya- ind.p. not having annihilated or rendered powerless View this entry on the original dictionary page scan.
akhinnamfn. unwearied, View this entry on the original dictionary page scan.
akhkhalaind. an exclamation of joy on View this entry on the original dictionary page scan.
akhkhalīkṛtyā Vedic or Veda ind.p. (1. kṛ-), uttering the exclamation akhkhala- View this entry on the original dictionary page scan.
akhyātamfn. not famous, unknown. View this entry on the original dictionary page scan.
akhyātif. infamy, bad repute, disgrace. View this entry on the original dictionary page scan.
akhyātikaramfn. causing infamy, disgraceful. View this entry on the original dictionary page scan.
akilinamfn. (for a-- klinna-) not moist or wet, View this entry on the original dictionary page scan.
akilviṣamfn. sinless View this entry on the original dictionary page scan.
akiṃcidmfn. not able to do anything, insignificant View this entry on the original dictionary page scan.
akiṃcidn. nothing, View this entry on the original dictionary page scan.
akiñcanamfn. without anything, utterly destitute View this entry on the original dictionary page scan.
akiñcanamfn. disinterested View this entry on the original dictionary page scan.
akiñcanan. that which is worth nothing. View this entry on the original dictionary page scan.
akiñcanatāf. voluntary poverty (as practised by jaina- ascetics). View this entry on the original dictionary page scan.
akiñcanatvan. voluntary poverty (as practised by jaina- ascetics). View this entry on the original dictionary page scan.
akiñcanimanm. utter destitution, (gaRa pṛthu-ādi- q.v) View this entry on the original dictionary page scan.
akīrtif. ill-fame, disgrace. View this entry on the original dictionary page scan.
akīrtikaramfn. causing disgrace, disparaging, insulting. View this entry on the original dictionary page scan.
akitavam. no gambler View this entry on the original dictionary page scan.
akf. (Voc. akka- ) a mother (used contemptuously) View this entry on the original dictionary page scan.
akf. Name of a woman; [supposed to be a term of foreign origin confer, compare Latin Acca.] View this entry on the original dictionary page scan.
akf. a procuress, View this entry on the original dictionary page scan.
akkādevīf. Name (also title or epithet) of a queen, View this entry on the original dictionary page scan.
aklamam. freedom from fatigue. View this entry on the original dictionary page scan.
akledyamfn. not to be wetted. View this entry on the original dictionary page scan.
akleśam. freedom from trouble View this entry on the original dictionary page scan.
aklība mfn. not impotent, manly, View this entry on the original dictionary page scan.
aklikāf. the Indigo plant View this entry on the original dictionary page scan.
aklinnavartmann. Name of a disease of the eyes View this entry on the original dictionary page scan.
akliṣṭamfn. untroubled View this entry on the original dictionary page scan.
akliṣṭamfn. undisturbed View this entry on the original dictionary page scan.
akliṣṭamfn. unwearied. View this entry on the original dictionary page scan.
akliṣṭakārinmfn. unwearied in action. View this entry on the original dictionary page scan.
akliṣṭakarman mfn. unwearied in action. View this entry on the original dictionary page scan.
akliṣṭavratamfn. unwearied in keeping religious vows. View this entry on the original dictionary page scan.
aknopanamfn. not moistening drying View this entry on the original dictionary page scan.
akopam. Name of a minister of king daśaratha- View this entry on the original dictionary page scan.
akopanamfn. not irascible. View this entry on the original dictionary page scan.
akopyamfn. (from pāli- akuppa-) not to be disregarded, View this entry on the original dictionary page scan.
akoṭam. "without a bend", the Areca or Betel-nut palm View this entry on the original dictionary page scan.
akovidamfn. unwise, ignorant. View this entry on the original dictionary page scan.
akramfn. ( kṛ-), inactive View this entry on the original dictionary page scan.
akram. a banner View this entry on the original dictionary page scan.
akram. a wall, fence (prākāra-), according to durga- on View this entry on the original dictionary page scan.
akra2 (according to to some also) a horse, View this entry on the original dictionary page scan.
akramamfn. not happening successively, happening at once View this entry on the original dictionary page scan.
akramam. want of order, confusion. View this entry on the original dictionary page scan.
akramamind. not by degrees, simultaneously, View this entry on the original dictionary page scan.
akramaśasind. idem or 'ind. not by degrees, simultaneously, ', View this entry on the original dictionary page scan.
akramoḍhāf. a woman married out of the regular order (as the younger sister before the elder etc.), View this entry on the original dictionary page scan.
akranditamfn. not pressed (as tila-), View this entry on the original dictionary page scan.
akrāntamfn. unpassed, unsurpassed, unconquered, not doubled View this entry on the original dictionary page scan.
akrāntāf. the Egg plant.
akratumfn. destitute of energy or power ["of sacrifices" ] View this entry on the original dictionary page scan.
akratumfn. foolish View this entry on the original dictionary page scan.
akratumfn. free from desire View this entry on the original dictionary page scan.
akravihastamfn. not having bloody hands ["not having niggardly hands, not close-fisted" ] View this entry on the original dictionary page scan.
akravyādmfn. not consuming flesh (Name of an agni-) View this entry on the original dictionary page scan.
akravyādmfn. not carnivorous View this entry on the original dictionary page scan.
akravyādamfn. not carnivorous View this entry on the original dictionary page scan.
akṛcchramn. absence of difficulty View this entry on the original dictionary page scan.
akṛcchramn. freedom from trouble. View this entry on the original dictionary page scan.
akṛcchrinmfn. free from difficulty or trouble. View this entry on the original dictionary page scan.
akrīḍatmfn. not playing View this entry on the original dictionary page scan.
akrītamfn. not bought, View this entry on the original dictionary page scan.
akriyamfn. without works View this entry on the original dictionary page scan.
akriyamfn. inactive View this entry on the original dictionary page scan.
akriyamfn. abstaining from religious rites View this entry on the original dictionary page scan.
akriyamfn. impious View this entry on the original dictionary page scan.
akriyāf. inactivity View this entry on the original dictionary page scan.
akriyāf. neglect of duty. View this entry on the original dictionary page scan.
akṛmiparisṛptamfn. not crawled over by worms, View this entry on the original dictionary page scan.
akrodham. suppression of anger View this entry on the original dictionary page scan.
akrodhamfn. free from anger. View this entry on the original dictionary page scan.
akrodha () mfn. not impotent, manly, View this entry on the original dictionary page scan.
akrodhamayamfn. free from anger View this entry on the original dictionary page scan.
akrodhanamfn. free from anger View this entry on the original dictionary page scan.
akrodhanam. Name of a prince, son of ayutāyu- View this entry on the original dictionary page scan.
akṛpamfn. merciless, unkind. View this entry on the original dictionary page scan.
akṛpaṇamfn. not miserly. View this entry on the original dictionary page scan.
akṛśamfn. not emaciated View this entry on the original dictionary page scan.
akṛśamfn. unimpaired. View this entry on the original dictionary page scan.
akṛśakīrtimfn. of undiminished glory, View this entry on the original dictionary page scan.
akṛśalakṣmīmfn. enjoying full prosperity. View this entry on the original dictionary page scan.
akṛśāśvamfn. Name of a king of ayodhyā- View this entry on the original dictionary page scan.
akṛṣīvalamf(ā-)n. not agricultural View this entry on the original dictionary page scan.
akṛṣṇakarmanmfn. free from black deeds, guiltless View this entry on the original dictionary page scan.
akṛṣṭamfn. unploughed, untilled View this entry on the original dictionary page scan.
akṛṣṭanot prolonged or drawled (in pronunciation), View this entry on the original dictionary page scan.
akṛṣṭamfn. not drawn View this entry on the original dictionary page scan.
akṛṣṭan. unploughed land View this entry on the original dictionary page scan.
akṛṣṭam. plural Name of a kind of ṛṣi-s View this entry on the original dictionary page scan.
akṛṣṭapacyamfn. ripening in unploughed land, growing wild View this entry on the original dictionary page scan.
akṛṣṭapacyamfn. (said of the earth) giving fruits without having been ploughed View this entry on the original dictionary page scan.
akṛtamf(ā-)n. undone, not committed View this entry on the original dictionary page scan.
akṛtamf(ā-)n. not made, uncreated View this entry on the original dictionary page scan.
akṛtamf(ā-)n. unprepared, in comp.ete View this entry on the original dictionary page scan.
akṛtamf(ā-)n. one who has done no works View this entry on the original dictionary page scan.
akṛtan. an act never before committed View this entry on the original dictionary page scan.
akṛtāf. a daughter who has not been made putrikā-, or a sharer in the privileges of a son View this entry on the original dictionary page scan.
akṛtabuddhimfn. having an unformed mind View this entry on the original dictionary page scan.
akṛtabuddhitvan. ignorance. View this entry on the original dictionary page scan.
akṛtacūḍamfn. untonsured, View this entry on the original dictionary page scan.
akṛtajñamfn. not acknowledging benefits, ungrateful. View this entry on the original dictionary page scan.
akṛtajñatāf. ingratitude. View this entry on the original dictionary page scan.
akṛtakāramind. in a way not done before View this entry on the original dictionary page scan.
akṛtakārya(), mfn. one who has not done his duty View this entry on the original dictionary page scan.
akṛtakṛtya (), mfn. one who has not done his duty View this entry on the original dictionary page scan.
akṛtārthamfn. having one's object unaccomplished, unsuccessful. View this entry on the original dictionary page scan.
akṛtaśmaśāna(/akṛta--), mfn. one who has not established a burning-ground, View this entry on the original dictionary page scan.
akṛtāstramfn. unpractised in arms View this entry on the original dictionary page scan.
akṛtātmanmfn. having an unformed mind
akṛtātmanmfn. not yet identified with the supreme Spirit. View this entry on the original dictionary page scan.
akṛtavraṇam. Name of a commentator on the purāṇa-s View this entry on the original dictionary page scan.
akṛtavraṇam. of a companion of rāma- jāmadagnya- View this entry on the original dictionary page scan.
akṛtavraṇam. of a teacher. View this entry on the original dictionary page scan.
akṛtinmfn. unfit for work, not clever. View this entry on the original dictionary page scan.
akṛtitvan. unfitness for work. View this entry on the original dictionary page scan.
akṛtrimamf(ā-)n. inartificial. View this entry on the original dictionary page scan.
akṛtsnamf(ā-)n. incomplete. View this entry on the original dictionary page scan.
akṛttamfn. uncut, unimpaired. View this entry on the original dictionary page scan.
akṛttarucmfn. possessing unimpaired splendour View this entry on the original dictionary page scan.
akṛtyamfn. not to be done, criminal View this entry on the original dictionary page scan.
akṛtyan. crime. View this entry on the original dictionary page scan.
akṛtyakārinmfn. evil-doer View this entry on the original dictionary page scan.
akrudhyatmfn. not being angry, View this entry on the original dictionary page scan.
akrūramfn. not cruel, gentle View this entry on the original dictionary page scan.
akrūram. Name of kṛṣṇa-'s paternal uncle View this entry on the original dictionary page scan.
akrūramfn. not impotent, manly, View this entry on the original dictionary page scan.
ak (perhaps a kind of old Desiderative of1. -) cl.1.5. akṣati-, akṣṇoti- ( ; future akṣiṣyati-or akṣyati- ; Aorist ākṣīt-,3. dual number ākṣiṣṭām-or āṣṭām- ; perf. ānakṣa-[ commentator or commentary ] , but A1. parasmE-pada [with the Vedic weak stem ākṣ- see perf. āś-uḥ-3. plural etc. fr.1. -] ākṣāṇ/a-),; to reach ; to pass through, penetrate, pervade, embrace ; to accumulate (to form the cube?) : Causal akṣayati-, ācikṣat-, to cause to pervade : Desiderative acikṣiṣati- or acikṣati- View this entry on the original dictionary page scan.
ak akṣṇute-, akṣṇuyāt-, (also) to mark (especially cattle on the ear) View this entry on the original dictionary page scan.
akṣam. an axle, axis (in this sense also n. ) View this entry on the original dictionary page scan.
akṣam. a wheel, car, cart View this entry on the original dictionary page scan.
akṣam. the beam of a balance or string which holds the pivot of the beam View this entry on the original dictionary page scan.
akṣam. a snake View this entry on the original dictionary page scan.
akṣam. terrestrial latitude (see -karṇa-, -bhā-, -bhāga-) View this entry on the original dictionary page scan.
akṣam. the collar-bone View this entry on the original dictionary page scan.
akṣam. the temporal bone View this entry on the original dictionary page scan.
akṣam. Name of a measure (= 104 aṅgula-); ([ confer, compare Latin axis; Greek ; Old German ahsa; modern German Achse; Lithuanian assis.]) View this entry on the original dictionary page scan.
akṣa1 (also) a chariot, View this entry on the original dictionary page scan.
akṣam. (1. - ) a die for gambling View this entry on the original dictionary page scan.
akṣam. a cube View this entry on the original dictionary page scan.
akṣam. a seed of which rosaries are made (see indrākṣa-, rudrākṣa-) View this entry on the original dictionary page scan.
akṣam. the Eleocarpus Ganitrus, producing that seed View this entry on the original dictionary page scan.
akṣam. a weight called karṣa-, equal to 16 māṣa-s View this entry on the original dictionary page scan.
akṣam. Beleric Myrobalan (Terminalia Belerica), the seed of which is used as a die View this entry on the original dictionary page scan.
akṣam. a Name of the number 5 View this entry on the original dictionary page scan.
akṣan. sochal salt View this entry on the original dictionary page scan.
akṣan. blue vitriol (from its cube-like crystals) View this entry on the original dictionary page scan.
akṣan. an organ of sense View this entry on the original dictionary page scan.
akṣan. sensual perception View this entry on the original dictionary page scan.
akṣam. the soul View this entry on the original dictionary page scan.
akṣam. knowledge, religious knowledge View this entry on the original dictionary page scan.
akṣam. a lawsuit View this entry on the original dictionary page scan.
akṣam. a person born blind View this entry on the original dictionary page scan.
akṣam. Name of garuḍa- View this entry on the original dictionary page scan.
akṣam. of a son of rāvaṇa- View this entry on the original dictionary page scan.
akṣam. of a son of nara-, etc. View this entry on the original dictionary page scan.
akṣa etc. See column 3. View this entry on the original dictionary page scan.
akṣan. [only in fine compositi or 'at the end of a compound' (f(ī-).)for akṣi-], the eye. View this entry on the original dictionary page scan.
akṣabhāf. shadow of latitude. View this entry on the original dictionary page scan.
akṣabhāgam. degree of latitude. View this entry on the original dictionary page scan.
akṣabhāram. a cart-load. View this entry on the original dictionary page scan.
akṣabhūmif. gambling-place. View this entry on the original dictionary page scan.
akṣacaraṇa m. (probably)"having his eyes fixed in abstraction on his feet" , Name of the philosopher gautama- View this entry on the original dictionary page scan.
akṣacaraṇam. see ākṣapāda-. View this entry on the original dictionary page scan.
akṣadarśaka m. a judge id est one who sees lawsuits. View this entry on the original dictionary page scan.
akṣadāyam. handing over the dice in gambling ([moving a piece on a board ]) View this entry on the original dictionary page scan.
akṣadevanan. gambling, dice-playing. View this entry on the original dictionary page scan.
akṣadevin m. a gambler, a dice-player. View this entry on the original dictionary page scan.
akṣadharamfn. holding dice View this entry on the original dictionary page scan.
akṣadharam. Trophis Aspera (See śākhoṭa-). View this entry on the original dictionary page scan.
akṣadharmam. the laws or rules of gambling, View this entry on the original dictionary page scan.
akṣadhurf. the pin at the end of an axle, pole attached to an axle. View this entry on the original dictionary page scan.
akṣadhurāf. an axle-pin, View this entry on the original dictionary page scan.
akṣadhūrtam. "dice-rogue", gambler View this entry on the original dictionary page scan.
akṣadhūrtilam. a draft-ox View this entry on the original dictionary page scan.
akṣadṛkkarmann. operation or calculation for latitude. View this entry on the original dictionary page scan.
akṣadṛśm. a judge id est one who sees lawsuits. View this entry on the original dictionary page scan.
akṣadrugdha(akṣ/a--) mfn. hated by (unlucky at) dice, or injuring with dice (a sharper) View this entry on the original dictionary page scan.
akṣadvāran. the cavity in the axle of a car on View this entry on the original dictionary page scan.
akṣadyūm. a gambler, a dice-player. View this entry on the original dictionary page scan.
akṣadyūtan. gambling View this entry on the original dictionary page scan.
akṣadyūtan. see ākṣadyūtika-. View this entry on the original dictionary page scan.
akṣadyūtādia gaRa of View this entry on the original dictionary page scan.
akṣaglaham. gambling, playing at dice View this entry on the original dictionary page scan.
akṣāgran. end of an axle, or of the pole of a car View this entry on the original dictionary page scan.
akṣāgran. an axle. View this entry on the original dictionary page scan.
akṣāgrakīla m. a linch-pin View this entry on the original dictionary page scan.
akṣāgrakīlam. the pin fastening the yoke to the pole. View this entry on the original dictionary page scan.
akṣāgrakīlakam. a linch-pin View this entry on the original dictionary page scan.
akṣāgrakīlakam. the pin fastening the yoke to the pole. View this entry on the original dictionary page scan.
akṣahṛdayan. innermost nature of dice, perfect skill in gambling. View this entry on the original dictionary page scan.
akṣahṛdayajñamfn. perfectly skilled in gambling. View this entry on the original dictionary page scan.
akṣaitrajñyan. spiritual ignorance View this entry on the original dictionary page scan.
akṣaitrajñyan. See ākṣ-. View this entry on the original dictionary page scan.
akṣajam. a diamond View this entry on the original dictionary page scan.
akṣajam. a thunderbolt View this entry on the original dictionary page scan.
akṣajam. Name of viṣṇu-. View this entry on the original dictionary page scan.
akṣajam. a thunderbolt View this entry on the original dictionary page scan.
akṣajam. N. viṣṇu- View this entry on the original dictionary page scan.
akakam. Dalbergia Oujeinensis View this entry on the original dictionary page scan.
akakamn. the collar-bone View this entry on the original dictionary page scan.
akakāma(akṣ/a--) mfn. fond of dice View this entry on the original dictionary page scan.
akakarṇam. the hypotenuse, especially of the triangle formed with the gnomon of a dial and its shadow View this entry on the original dictionary page scan.
akakarṇam. (in astronomy) argument of the latitude. View this entry on the original dictionary page scan.
akakīf. Name of a creeping plant. View this entry on the original dictionary page scan.
akakitavam. a gambler View this entry on the original dictionary page scan.
akakṣapaṇam. Name of a gambler View this entry on the original dictionary page scan.
akakuśalamfn. skilled in dice. View this entry on the original dictionary page scan.
akṣamamf(ā-)n. unable to endure, impatient View this entry on the original dictionary page scan.
akṣamamf(ā-)n. incompetent (with locative case , infinitive mood or in fine compositi or 'at the end of a compound'), envious View this entry on the original dictionary page scan.
akṣamaunfit, improper, View this entry on the original dictionary page scan.
akṣamā f. impatience, envy View this entry on the original dictionary page scan.
akṣamā f. incompetence, inability (with infinitive mood) View this entry on the original dictionary page scan.
akṣamāf. (in dramatic language) sensitiveness, irritability, View this entry on the original dictionary page scan.
akṣamadam. passion for dice. View this entry on the original dictionary page scan.
akṣamālāf. a string or rosary of beads, especially of Eleocarpus seeds View this entry on the original dictionary page scan.
akṣamālāf. Name of arundhatī-, wife of vasiṣṭha- (from her wearing a rosary) View this entry on the original dictionary page scan.
akṣamālāf. Name of the mother of vatsa-. View this entry on the original dictionary page scan.
akṣamālikāf. a rosary, View this entry on the original dictionary page scan.
akṣamālinmfn. wearing a rosary of seeds View this entry on the original dictionary page scan.
akṣamālinmfn. Name of śiva- View this entry on the original dictionary page scan.
akṣamatāf. impatience, envy View this entry on the original dictionary page scan.
akṣamatāf. incompetence, inability (with infinitive mood) View this entry on the original dictionary page scan.
akṣamātran. anything as big as dice View this entry on the original dictionary page scan.
akṣamātran. the twinkling of an eye, a moment (see 4. akṣa-) View this entry on the original dictionary page scan.
akṣaminmfn. intolerant, cruel, View this entry on the original dictionary page scan.
akṣāṃsam. a degree of latitude. View this entry on the original dictionary page scan.
akṣanSee akṣi-. View this entry on the original dictionary page scan.
akṣann. substituted for akṣi-,"the eye", in the weakest cases, ([ confer, compare Gothic augan]) View this entry on the original dictionary page scan.
akṣann. an organ of sense View this entry on the original dictionary page scan.
akṣaṇamfn. inopportune. View this entry on the original dictionary page scan.
akṣānahmfn. (the vowel lengthened as in upā-n/ah-,etc.) tied to the axle of a car View this entry on the original dictionary page scan.
akṣānahmfn. (horse ;trace attached to the horse's collar ) View this entry on the original dictionary page scan.
akṣanaipuṇa n. skill in gambling. View this entry on the original dictionary page scan.
akṣanaipuṇyan. skill in gambling. View this entry on the original dictionary page scan.
akṣāntamfn. impatient, View this entry on the original dictionary page scan.
akṣāntif. impatience, jealousy, intolerance. View this entry on the original dictionary page scan.
akṣaṇvatmfn. ( kṣan-), not injuring View this entry on the original dictionary page scan.
akṣanvatmfn. having eyes View this entry on the original dictionary page scan.
akṣanvatmfn. (for 1.See column 2.)
akṣanvatsee akṣaṇ-- vat-. View this entry on the original dictionary page scan.
akṣapad m. (probably)"having his eyes fixed in abstraction on his feet" , Name of the philosopher gautama- View this entry on the original dictionary page scan.
akṣapadm. see ākṣapāda-. View this entry on the original dictionary page scan.
akṣapādam. (probably)"having his eyes fixed in abstraction on his feet" , Name of the philosopher gautama- View this entry on the original dictionary page scan.
akṣapādam. see ākṣapāda-. View this entry on the original dictionary page scan.
akṣaparājayam. defeat in gambling
akṣapariind. with exception of a single die View this entry on the original dictionary page scan.
akṣapātam. throw or cast of dice. View this entry on the original dictionary page scan.
akṣapāṭam. an arena, a wrestling ground, place of contest View this entry on the original dictionary page scan.
akṣapāṭaka m. a judge id est arranger of a lawsuit View this entry on the original dictionary page scan.
akṣapaṭalan. court of law View this entry on the original dictionary page scan.
akṣapaṭalan. depository of legal document View this entry on the original dictionary page scan.
akṣapātanan. act of casting dice. View this entry on the original dictionary page scan.
akṣapāṭikam. a judge id est arranger of a lawsuit View this entry on the original dictionary page scan.
akṣapīḍam. Chrysopogon Acicularis View this entry on the original dictionary page scan.
akṣapīḍāf. Name of a plant. View this entry on the original dictionary page scan.
akṣaprapātanan. casting glances, View this entry on the original dictionary page scan.
akṣapriyamfn. fond of dice, or (perhaps) favoured by dice. View this entry on the original dictionary page scan.
akṣaramfn. imperishable View this entry on the original dictionary page scan.
akṣaramfn. unalterable View this entry on the original dictionary page scan.
akṣaram. a sword View this entry on the original dictionary page scan.
akṣaram. śiva- View this entry on the original dictionary page scan.
akṣaram. viṣṇu- View this entry on the original dictionary page scan.
akṣarāf. See /akṣarā- below View this entry on the original dictionary page scan.
akṣaran. a syllable View this entry on the original dictionary page scan.
akṣaran. the syllable om- View this entry on the original dictionary page scan.
akṣaran. a letter ([m. ]) View this entry on the original dictionary page scan.
akṣaran. a vowel View this entry on the original dictionary page scan.
akṣaran. a sound View this entry on the original dictionary page scan.
akṣaran. a word View this entry on the original dictionary page scan.
akṣaran. an indelible mark incised on metal or stone View this entry on the original dictionary page scan.
akṣaran. Name of brahma- View this entry on the original dictionary page scan.
akṣaran. final beatitude religious austerity, sacrifice View this entry on the original dictionary page scan.
akṣaran. water
akṣaran. Achyranthes Aspera. View this entry on the original dictionary page scan.
akṣara(also) m. Name (also title or epithet) of a sāman-, View this entry on the original dictionary page scan.
akṣara(erase"Achyranthes Aspera") View this entry on the original dictionary page scan.
akṣarāf. (see a-kṣ/ara- n.above) , word, speech View this entry on the original dictionary page scan.
akṣāramfn. free from alkali or factitious salt. View this entry on the original dictionary page scan.
akṣarabhājmfn. entitled to a share in the syllables (of a prayer) View this entry on the original dictionary page scan.
akṣaracaṇa m. "clever in writing", a scribe View this entry on the original dictionary page scan.
akṣaracanam. "clever in writing", a scribe View this entry on the original dictionary page scan.
akṣaracañcu m. "clever in writing", a scribe View this entry on the original dictionary page scan.
akṣarachandasn. metre regulated by the number and quality of syllables. View this entry on the original dictionary page scan.
akṣaracuñcu m. "clever in writing", a scribe View this entry on the original dictionary page scan.
akṣaracyutakan. "supplying dropped (cyuta-) syllables ", a kind of game View this entry on the original dictionary page scan.
akṣarājam. "king of dice", the die called kali- View this entry on the original dictionary page scan.
akṣarajananīf. "letter producer", a reed or pen. View this entry on the original dictionary page scan.
akṣarajīvaka m. "one who lives by writing", a scribe. View this entry on the original dictionary page scan.
akṣarajīvika m. "one who lives by writing", a scribe. View this entry on the original dictionary page scan.
akṣarajīvinm. "one who lives by writing", a scribe. View this entry on the original dictionary page scan.
akṣarakan. a vowel. View this entry on the original dictionary page scan.
akṣarakaram. a kind of religious meditation View this entry on the original dictionary page scan.
akṣarākṣaram. a kind of religious meditation (samādhi-). View this entry on the original dictionary page scan.
akṣāralavaṇan. not factitious (id est natural) salt View this entry on the original dictionary page scan.
akṣāralavaṇamfn. not composed of artificial salt, ([ on]) View this entry on the original dictionary page scan.
akṣāralavaṇamfn. or, according to and , better"(food) not containing acrid substances nor salt"; therefore also akṣārālavaṇa- in the same sense see kṣāra-lavaṇa-. View this entry on the original dictionary page scan.
akṣāralavaṇāśinmfn. eating akṣāra-lavaṇa-. View this entry on the original dictionary page scan.
akṣāramadyamāṃsādamfn. not eating acrid substances nor (drinking) spirituous liquors nor eating meat View this entry on the original dictionary page scan.
akṣaramukham. having the mouth full of syllables, a student, scholar View this entry on the original dictionary page scan.
akṣaramuṣṭikāf. the art of communicating syllables or ideas by the fingers (one of the 64 kalā-s) View this entry on the original dictionary page scan.
akṣarāṅgan. part of a syllable (said of the anusvāra-) View this entry on the original dictionary page scan.
akṣarāntaran. another letter, transliteration, View this entry on the original dictionary page scan.
akṣaranyāsam. array of syllables or letters View this entry on the original dictionary page scan.
akṣaranyāsam. the alphabet. View this entry on the original dictionary page scan.
akṣarapaṅktimfn. containing five syllables View this entry on the original dictionary page scan.
akṣarapaṅktif. Name of a metre of four lines, each containing one dactyl and one spondee View this entry on the original dictionary page scan.
akṣarapaṅktif. also called paṅkti- or haṃsa-. View this entry on the original dictionary page scan.
akṣarasadhātun. a particular manner of singing, View this entry on the original dictionary page scan.
akṣarasamāmnāyam. alphabet View this entry on the original dictionary page scan.
akṣarasaṃghāta (in dramatic language) accidental putting together or arranging of letters or syllables, View this entry on the original dictionary page scan.
akṣarasaṃhāta(in dramatic language) accidental putting together or arranging of letters or syllables, View this entry on the original dictionary page scan.
akṣarasaṃhitā, f. the saṃhitā- of syllables, View this entry on the original dictionary page scan.
akṣarasampadf. fitness or completeness of the number of syllables, View this entry on the original dictionary page scan.
akṣarasaṃsthānan. scripture, writing View this entry on the original dictionary page scan.
akṣaraśasind. syllable by syllable View this entry on the original dictionary page scan.
akṣaraśikṣāf. alphabetic science, View this entry on the original dictionary page scan.
akṣaraśūnyamfn. inarticulate. View this entry on the original dictionary page scan.
akṣaratūlikāf. a reed or pen. View this entry on the original dictionary page scan.
akṣaravatmfn. possessing syllables, View this entry on the original dictionary page scan.
akṣaravinyāsa equals -nyāsa- View this entry on the original dictionary page scan.
akṣaresthāmfn. consisting of syllables View this entry on the original dictionary page scan.
akṣaryamf(ā-)n. corresponding to the number of syllables or letters View this entry on the original dictionary page scan.
akṣaryaṃrevatn. Name of a sāman- View this entry on the original dictionary page scan.
akṣaśabdam. the creaking of an axle, View this entry on the original dictionary page scan.
akṣasaṅgamind. so that the axle is caught or hooked by contact with some obstruction View this entry on the original dictionary page scan.
akṣaśauṇḍamfn. fond of gambling. View this entry on the original dictionary page scan.
akṣaśikṣāf. the art of gambling, View this entry on the original dictionary page scan.
akṣaśīlamfn. addicted to gambling, View this entry on the original dictionary page scan.
akṣastuṣam. Beleric Myrobalan. View this entry on the original dictionary page scan.
akṣasūktan. dice-hymn, Name of View this entry on the original dictionary page scan.
akṣasūtran. a string or rosary of Eleocarpus seeds. View this entry on the original dictionary page scan.
akṣasūtravalayinmfn. having a rosary for a bracelet, View this entry on the original dictionary page scan.
akṣatamfn. not crushed View this entry on the original dictionary page scan.
akṣatamfn. uninjured, unbroken, whole View this entry on the original dictionary page scan.
akṣatam. śiva- View this entry on the original dictionary page scan.
akṣatamn. a eunuch View this entry on the original dictionary page scan.
akṣatāf. a virgin View this entry on the original dictionary page scan.
akṣatāf. Name of a plant, karkaṭaśriṅgī- or kaṅkaḍaśriṅgī- View this entry on the original dictionary page scan.
akṣatan. and m. plural unhusked barley-corns View this entry on the original dictionary page scan.
akṣatan. Name of the descendants of surabhi- View this entry on the original dictionary page scan.
akṣatamfn. (also) unthrashed, View this entry on the original dictionary page scan.
akṣatam. n. (also) a boil or sore not produced by cutting, View this entry on the original dictionary page scan.
akṣatāmayam. disease without any external injury, View this entry on the original dictionary page scan.
akṣatattvan. science of dice View this entry on the original dictionary page scan.
akṣatattvavidmfn. skilled in it. View this entry on the original dictionary page scan.
akṣatayonif. a virgin, an unblemished maiden. View this entry on the original dictionary page scan.
akṣātivāpam. equals akṣāvāp/a- below View this entry on the original dictionary page scan.
akṣatramfn. destitute of the kṣatriya- caste, apart from the kṣatriya- caste. View this entry on the original dictionary page scan.
akṣauhiṇīf. an army consisting of ten anīkinī-s, or 21870 elephants, 21870 chariots, 65610 horse, and 109350 foot. (Since an anīkinī- consists of 27 vāhinī-s, and 27 is the cube of 3, akṣauhiṇī-may be a compound of 2. akṣa-and vāhinī-;or it may possibly be connected with 1. akṣa-,axle, car.) View this entry on the original dictionary page scan.
akṣāvalīf. a rosary. View this entry on the original dictionary page scan.
akṣavāmam. an unfair gambler. View this entry on the original dictionary page scan.
akṣavāpa equals akṣāvāp/a- below View this entry on the original dictionary page scan.
akṣāvāpam. ([ ]) (see akṣa-vāpa-and akṣātivāpa-), the keeper or superintendent of a gambling-table [Comm. equals dyūta-pati-, dyūtādhyakṣa-, akṣa-goptṛ-]. View this entry on the original dictionary page scan.
akṣāvapanan. a dice-board View this entry on the original dictionary page scan.
akṣavatmfn. having dice View this entry on the original dictionary page scan.
akṣavāṭa equals -pāṭa-. View this entry on the original dictionary page scan.
akṣavatīf. a game of dice View this entry on the original dictionary page scan.
akṣavidmfn. skilful in gambling. View this entry on the original dictionary page scan.
akṣavidmfn. versed in law View this entry on the original dictionary page scan.
akṣavṛttamfn. anything that happens in gambling. View this entry on the original dictionary page scan.
akṣayamf(ā-)n. exempt from decay, undecaying View this entry on the original dictionary page scan.
akṣayam. Name of the twentieth year in the cycle of Jupiter View this entry on the original dictionary page scan.
akṣayam. Name of a mountain View this entry on the original dictionary page scan.
akṣayāf. the seventh day of a lunar month, if it fall on Sunday or Monday View this entry on the original dictionary page scan.
akṣayāf. the fourth, if it fall on Wednesday. View this entry on the original dictionary page scan.
akṣayaguṇamfn. possessing imperishable qualities View this entry on the original dictionary page scan.
akṣayaguṇam. śiva-. View this entry on the original dictionary page scan.
akṣayalokam. the undecaying world, heaven. View this entry on the original dictionary page scan.
akṣayamatim. Name of a Buddhist. View this entry on the original dictionary page scan.
akṣayanīvīf. a permanent endowment, Buddhist View this entry on the original dictionary page scan.
akṣayapuruhūtam. śiva-. View this entry on the original dictionary page scan.
akṣayatāf. imperishableness. View this entry on the original dictionary page scan.
akṣayatṛtīyāf. Name of a festival (the third day of the bright half of vaiśākha-, which is the first day of the satya-yuga-, and secures permanency to actions then performed). View this entry on the original dictionary page scan.
akṣayatvan. imperishableness. View this entry on the original dictionary page scan.
akṣayavaṭam. "undecaying Banyan", Name (also title or epithet) of a very ancient sacred tree, . View this entry on the original dictionary page scan.
akṣayinmfn. undecaying View this entry on the original dictionary page scan.
akṣayiṇīf. Name of a river View this entry on the original dictionary page scan.
akṣayyamfn. undecaying View this entry on the original dictionary page scan.
akṣayyan. "may thy prosperity be undecaying!"(a form of blessing addressed to a vaiśya-) View this entry on the original dictionary page scan.
akṣayyamind. "may thy prosperity be undecaying!"(a form of blessing addressed to a vaiśya-) View this entry on the original dictionary page scan.
akṣayyanavamīf. the ninth day of the bright half of āśvina-. View this entry on the original dictionary page scan.
akṣayyodakan. inexhaustible water View this entry on the original dictionary page scan.
akṣetramfn. destitute of fields, uncultivated View this entry on the original dictionary page scan.
akṣetran. a bad field View this entry on the original dictionary page scan.
akṣetran. a bad geometrical figure. View this entry on the original dictionary page scan.
akṣetrajñamfn. ([ ]) not finding out the way View this entry on the original dictionary page scan.
akṣetrajñamfn. destitute of spiritual knowledge. View this entry on the original dictionary page scan.
akṣetravidmfn. ([ /akṣ- ]), not finding out the way View this entry on the original dictionary page scan.
akṣetravidmfn. destitute of spiritual knowledge. View this entry on the original dictionary page scan.
akṣetrinmfn. having no fields View this entry on the original dictionary page scan.
akṣin. (1. - ) ([instr. akṣṇā- dative case akṣṇe-,etc., fr. akṣan-,substituted for akṣi-in the weakest cases. Vedic forms are: ablative genitive case akṣṇ/as-; locative case akṣ/an-(once akṣiṇi-!); dual number Nominal verb accusative akṣ/ī- , /akṣiṇī-, /akṣyau-,and akṣyau- and ; instrumental case akṣ/ībhyām-; genitive case akṣy/os- , akṣy/os-and akṣ/os-(!) ; plural Nominal verb accusative /akṣīṇi- , akṣāṇi- ; in fine compositi or 'at the end of a compound' akṣa-is substitutedSee 4. akṣa-]), the eye View this entry on the original dictionary page scan.
akṣin. the number two View this entry on the original dictionary page scan.
akṣin. dual number the sun and moon [ confer, compare Greek , ; Latin oculos; A.S.aegh; Gothic augo; German Auge; Russian oko; Lithuanian aki-s.] View this entry on the original dictionary page scan.
akṣibam. View this entry on the original dictionary page scan.
akṣibam. See akṣība-. View this entry on the original dictionary page scan.
akṣībamfn. and akṣiba- not intoxicated, sober View this entry on the original dictionary page scan.
akṣībam. Guilandina or Hyperanthera Moringa View this entry on the original dictionary page scan.
akṣīban. sea salt View this entry on the original dictionary page scan.
akṣibandham. binding the eyes, View this entry on the original dictionary page scan.
akṣibheṣajan. medicament for the eyes, collyrium, etc. View this entry on the original dictionary page scan.
akṣibheṣajam. a tree, Red Lodh. View this entry on the original dictionary page scan.
akṣibhruvan. the eyes and eyebrows together. View this entry on the original dictionary page scan.
akṣibhūmfn. visible, perceptible, manifest View this entry on the original dictionary page scan.
akṣigatamfn. presented to the eye, visible, seen View this entry on the original dictionary page scan.
akṣigatamfn. hated View this entry on the original dictionary page scan.
akṣigolam. the eyeball. View this entry on the original dictionary page scan.
akṣijāhan. the root of the eye. View this entry on the original dictionary page scan.
akṣika m. the tree Dalbergia Oujeinensis View this entry on the original dictionary page scan.
akṣikam. See akṣaka-. View this entry on the original dictionary page scan.
akṣīkam. the tree Dalbergia Oujeinensis View this entry on the original dictionary page scan.
akṣīkam. See akṣaka-. View this entry on the original dictionary page scan.
akṣīkam. View this entry on the original dictionary page scan.
akṣīkam. See akṣika-. View this entry on the original dictionary page scan.
akṣikūṭa n. the prominent part of the forehead above the eye View this entry on the original dictionary page scan.
akṣikūṭakan. the prominent part of the forehead above the eye View this entry on the original dictionary page scan.
akṣilakṣīkṛ(P. - karoti-), to make anything an object for the eyes, look at, View this entry on the original dictionary page scan.
akṣilomann. the eyelash. View this entry on the original dictionary page scan.
akṣimatmfn. possessing eyes. View this entry on the original dictionary page scan.
akṣīṇamfn. not perishing or failing View this entry on the original dictionary page scan.
akṣīṇamfn. not waning (the moon) View this entry on the original dictionary page scan.
akṣīṇamfn. not diminishing in weight View this entry on the original dictionary page scan.
akṣīṇamfn. Name of a son of viśvāmitra- View this entry on the original dictionary page scan.
akṣiṇīf. one of the eight conditions or privileges attached to landed property View this entry on the original dictionary page scan.
akṣinikāṇamind. with half-closed eyes View this entry on the original dictionary page scan.
akṣinikāṇamind. also nikāṇam-akṣi- idem or 'ind. with half-closed eyes ' View this entry on the original dictionary page scan.
akṣinimeṣam. twinkling of an eye, a moment View this entry on the original dictionary page scan.
akṣiṇvatmfn. not injuring, . View this entry on the original dictionary page scan.
akṣipākam. inflammation of the eyes View this entry on the original dictionary page scan.
akṣipakṣmann. the eye lash. View this entry on the original dictionary page scan.
akṣipatind. as much as could fall into the eyes, a little View this entry on the original dictionary page scan.
akṣipaṭalan. coat of the eye View this entry on the original dictionary page scan.
akṣisaṃskāram. painting the eyes, View this entry on the original dictionary page scan.
akṣisaṃskāracollyrium, View this entry on the original dictionary page scan.
akṣisaṃtarjanan. (probably), Name of a mythic weapon View this entry on the original dictionary page scan.
akṣitmfn. imperishable, not lost View this entry on the original dictionary page scan.
akṣitamfn. "marked" View this entry on the original dictionary page scan.
akṣitamfn. undecayed, uninjured, undecaying View this entry on the original dictionary page scan.
akṣitan. water View this entry on the original dictionary page scan.
akṣitan. the number 100000 millions View this entry on the original dictionary page scan.
akṣitārāf. the pupil of the eye. View this entry on the original dictionary page scan.
akṣitāvasum. "possessed of undecaying wealth", Name of indra- View this entry on the original dictionary page scan.
akṣitavyamfn. "to be marked" View this entry on the original dictionary page scan.
akṣitavya confer, compare aṣṭa-- karṇa- and Greek $, View this entry on the original dictionary page scan.
akṣitif. imperishableness etc. View this entry on the original dictionary page scan.
akṣitimfn. imperishable View this entry on the original dictionary page scan.
akṣitotim. "granting permanent help", Name of indra- View this entry on the original dictionary page scan.
akṣivikūṇitan. a glance with the eye-lids partially closed. View this entry on the original dictionary page scan.
akṣīyamāṇamfn. imperishable, inexhaustible, View this entry on the original dictionary page scan.
akṣiyatmfn. not inhabiting, destitute of a dwelling, unsettled ("not decreasing in riches") View this entry on the original dictionary page scan.
akṣṇan. equals a-khaṇḍa- View this entry on the original dictionary page scan.
akṣṇayāind. instrumental case transversely (Scholiast or Commentator circuitously, like a wheel!) View this entry on the original dictionary page scan.
akṣṇayāind. wrongly View this entry on the original dictionary page scan.
akṣṇayāind. diagonally View this entry on the original dictionary page scan.
akṣṇayādeśam. an intermediate region View this entry on the original dictionary page scan.
akṣṇayādruhmfn. injuring wrongly or in a bad way View this entry on the original dictionary page scan.
akṣṇayākṛta(akṣṇay/ā--) mfn. done wrongly View this entry on the original dictionary page scan.
akṣṇayāpacchedanan. transverse division, View this entry on the original dictionary page scan.
akṣṇayārajjuf. diagonal line View this entry on the original dictionary page scan.
akṣṇayāstomīyāf. Name of an iṣṭakā- View this entry on the original dictionary page scan.
akṣṇayāvanmfn. going across View this entry on the original dictionary page scan.
akṣobhamfn. unagitated, unmoved View this entry on the original dictionary page scan.
akṣobham. the post to which an elephant is tied. View this entry on the original dictionary page scan.
akṣobhan. freedom from agitation, imperturbability. View this entry on the original dictionary page scan.
akṣobhyamfn. immovable, imperturbable View this entry on the original dictionary page scan.
akṣobhyam. Name of a buddha- of an author, an immense number, said by Buddhists to be 100 vivaras. View this entry on the original dictionary page scan.
akṣobhyāf. Name (also title or epithet) of a yoginī-, View this entry on the original dictionary page scan.
akṣobhyatīrtham. Name (also title or epithet) of a disciple of A1nanda-ti1rtha (quod vide), View this entry on the original dictionary page scan.
akṣoḍam. equals akṣoṭa- View this entry on the original dictionary page scan.
akṣoḍakam. equals akṣoṭa- View this entry on the original dictionary page scan.
akṣodhukamfn. not hungry View this entry on the original dictionary page scan.
akṣodhukamfn. not hungry, View this entry on the original dictionary page scan.
akṣoṭam. a walnut (Pistacio nut?) View this entry on the original dictionary page scan.
akṣoṭam. the tree pīlu- View this entry on the original dictionary page scan.
akṣoṭam. the tree Aleurites Triloba. Also spelt akṣoḍa- (), akṣoḍaka-, ākṣoṭa-, ākṣoḍaka-, ākhoṭa-. View this entry on the original dictionary page scan.
akṣum. a kind of net The suggests"axle of a car", making /akṣu- equals /akṣa-. View this entry on the original dictionary page scan.
akṣudhf. satiety View this entry on the original dictionary page scan.
akṣudhyamfn. not liable to hunger View this entry on the original dictionary page scan.
akṣudramfn. not small View this entry on the original dictionary page scan.
akṣudramfn. not low or vulgar View this entry on the original dictionary page scan.
akṣuṇṇamfn. unbroken, uncurtailed View this entry on the original dictionary page scan.
akṣuṇṇamfn. not trite, new View this entry on the original dictionary page scan.
akṣuṇṇamfn. permanent View this entry on the original dictionary page scan.
akṣuṇṇamfn. unconquered View this entry on the original dictionary page scan.
akṣuṇṇamfn. inexperienced, inexpert. View this entry on the original dictionary page scan.
akṣuṇṇatāf. uncurtailed condition View this entry on the original dictionary page scan.
akṣuṇṇatāf. inexperience. View this entry on the original dictionary page scan.
akṣuṇṇavedhathe act of throwing a spear so as to touch the mark lightly, View this entry on the original dictionary page scan.
akṣyāmayam. disease of the eye View this entry on the original dictionary page scan.
akṣyāmayinmfn. having a disease of the eye View this entry on the original dictionary page scan.
aktamfn. ( aj-), driven. View this entry on the original dictionary page scan.
aktamfn. ( añj-), smeared over, diffused, bedaubed, tinged, characterized. Often in fine compositi or 'at the end of a compound' (see raktākta-) View this entry on the original dictionary page scan.
aktan. oil, ointment. View this entry on the original dictionary page scan.
akf. night View this entry on the original dictionary page scan.
aktif. ointment, View this entry on the original dictionary page scan.
aktosind. at night View this entry on the original dictionary page scan.
aktum. tinge, ray, light View this entry on the original dictionary page scan.
aktum. dark tinge, darkness, night View this entry on the original dictionary page scan.
aktubhisind. at night View this entry on the original dictionary page scan.
akudhryañc /aṅ-, dhr/īcī-, /ak-(kudhri-for kudha-for kuha- equals kutra-),"going nowhere" (āk-,4) . ind. objectless, aimless View this entry on the original dictionary page scan.
akuham. no deceiver View this entry on the original dictionary page scan.
akuhakam. idem or 'm. no deceiver ' View this entry on the original dictionary page scan.
akūjamfn. noiseless, View this entry on the original dictionary page scan.
akūjanan. noiselessness, silence, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
akūjanamfn. not creaking (as the axle of a car), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
akulamfn. not of good family, low View this entry on the original dictionary page scan.
akulam. Name of śiva- View this entry on the original dictionary page scan.
akulāf. Name of pārvatī- View this entry on the original dictionary page scan.
akulāf. the 1st, 3rd, 5th, 7th, 9th, 11th, and 13th days of a half-month View this entry on the original dictionary page scan.
akulan. Name (also title or epithet) of particular lunar mansions. View this entry on the original dictionary page scan.
akula(in astronomy) Name (also title or epithet) of Sunday, Monday, Thursday, and Saturday View this entry on the original dictionary page scan.
akulakamfn. (fruit) without stone, View this entry on the original dictionary page scan.
akulatāf. lowness of family. View this entry on the original dictionary page scan.
akulīnamfn. not of good family View this entry on the original dictionary page scan.
akumāram. not a boy (said of indra-) View this entry on the original dictionary page scan.
akumbham. "no water-jar", anything singular of its kind, View this entry on the original dictionary page scan.
akuṇḍalamfn. without ear-rings, View this entry on the original dictionary page scan.
akuṇṭhamfn. not blunted, not worn out View this entry on the original dictionary page scan.
akuṇṭhamfn. vigorous, fixed View this entry on the original dictionary page scan.
akuṇṭhamfn. ever fresh, eternal. View this entry on the original dictionary page scan.
akuṇṭhadhiṣṇyan. an eternal abode, heaven. View this entry on the original dictionary page scan.
akuṇṭhitamfn. equals a-kuṇṭha-. View this entry on the original dictionary page scan.
akūpāramfn. unbounded View this entry on the original dictionary page scan.
akūpāram. the sea etc. View this entry on the original dictionary page scan.
akūpāram. tortoise etc. the mythical tortoise that upholds the world View this entry on the original dictionary page scan.
akūpāram. Name of a man View this entry on the original dictionary page scan.
akūpāram. Name of an āditya- View this entry on the original dictionary page scan.
akūpārāf. Name of an āṅgirasī- View this entry on the original dictionary page scan.
akupyan. not base metal, gold or silver View this entry on the original dictionary page scan.
akupyan. any base metal (equals kupya-See 3. a-). View this entry on the original dictionary page scan.
akupya2. n. (impersonal or used impersonally) anger must not be shown, View this entry on the original dictionary page scan.
akupyakan. gold or silver View this entry on the original dictionary page scan.
akupyatmfn. not boiling, View this entry on the original dictionary page scan.
akūrcam. "the guileless one", a buddha- View this entry on the original dictionary page scan.
akūrmapṛṣatmfn. not spotted like a turtle, View this entry on the original dictionary page scan.
akuśalamf(ā-)n. inauspicious, evil View this entry on the original dictionary page scan.
akuśalamf(ā-)n. not clever View this entry on the original dictionary page scan.
akuśalan. evil, an evil word View this entry on the original dictionary page scan.
akuśalan. (with Buddhists) demerit, sin, . View this entry on the original dictionary page scan.
akusīdaor akuśīda- mfn. taking no interest or usury, without gain. View this entry on the original dictionary page scan.
akuṣṭhipṛṣatmfn. neither leprous nor spotted, View this entry on the original dictionary page scan.
akusumamfn. flowerless. View this entry on the original dictionary page scan.
akūṭamf(ā-)n. having no prominence on the forehead View this entry on the original dictionary page scan.
akūṭamf(ā-)n. not deceitful, unerring (said of arms) View this entry on the original dictionary page scan.
akūṭamf(ā-)n. not false (said of coins) View this entry on the original dictionary page scan.
akutasind. (usually in compound), not from any quarter or cause. View this entry on the original dictionary page scan.
akutaścalam. not movable from any cause View this entry on the original dictionary page scan.
akutaścalam. Name of śiva-. View this entry on the original dictionary page scan.
akutaścanam. Name (also title or epithet) of śiva-, View this entry on the original dictionary page scan.
akutaścidind. not for any reason, unintentionally, View this entry on the original dictionary page scan.
akutaścidbhaya mfn. having no fear from any quarter, secure. View this entry on the original dictionary page scan.
akutobhaya mfn. having no fear from any quarter, secure. View this entry on the original dictionary page scan.
akutomṛtyumfn. not threatened by death from any quarter, View this entry on the original dictionary page scan.
akutraor (Ved.) View this entry on the original dictionary page scan.
akutrāind. nowhere, astray View this entry on the original dictionary page scan.
akutracabhayamfn. having no fear from any quarter, secure. View this entry on the original dictionary page scan.
akutsayatmfn. not abusing or reproaching, . View this entry on the original dictionary page scan.
akutsitamfn. unreproached. View this entry on the original dictionary page scan.
akutūhalamfn. not taking interest in (locative case), View this entry on the original dictionary page scan.
akūvāra equals a-kūpāra- above. View this entry on the original dictionary page scan.
abaddhakamfn. unmeaning, nonsensical View this entry on the original dictionary page scan.
abādhakamf(ā-)n. unimpeded View this entry on the original dictionary page scan.
abahvakṣaramfn. having not many (id est not more than two) syllables View this entry on the original dictionary page scan.
abandhakamfn. not binding View this entry on the original dictionary page scan.
abandhakam. Name of a man, and (m. plural ) his descendants, (gaRa upakādi-.) View this entry on the original dictionary page scan.
abāndhavakṛtamfn. not caused by relation or kindred View this entry on the original dictionary page scan.
abbhakṣamfn. living upon water View this entry on the original dictionary page scan.
abbhakṣam. a snake View this entry on the original dictionary page scan.
abbhakṣaṇan. living upon water (a kind of fasting) View this entry on the original dictionary page scan.
abdhinavanītakam. the moon. View this entry on the original dictionary page scan.
abhagnakāmamf(ā-)n. whose desire or wishes are not disturbed View this entry on the original dictionary page scan.
abhakṣam. not eating anything, fasting. View this entry on the original dictionary page scan.
abhakṣaṇan. not eating anything, fasting. View this entry on the original dictionary page scan.
abhakṣitamfn. not eaten. View this entry on the original dictionary page scan.
abhakṣyamfn. not to be eaten by (instrumental case or genitive case ) View this entry on the original dictionary page scan.
abhakṣyabhakṣaṇan. eating of prohibited food View this entry on the original dictionary page scan.
abhakṣyabhakṣinmfn. eating forbidden food. View this entry on the original dictionary page scan.
abhaktamfn. not received as a share View this entry on the original dictionary page scan.
abhaktamfn. not attached to, detached, unconnected with View this entry on the original dictionary page scan.
abhaktamfn. not eaten. View this entry on the original dictionary page scan.
abhaktacohandam. want of appetite. View this entry on the original dictionary page scan.
abhaktarucif. want of appetite. View this entry on the original dictionary page scan.
abhaktif. want of devotion to, want of faith. View this entry on the original dictionary page scan.
abhaktimatmfn. undevoted to, unbelieving. View this entry on the original dictionary page scan.
ābhāṇakam. ( bhaṇ-), a saying, proverb. View this entry on the original dictionary page scan.
abhastrakā f. a badly made or inferior pair of bellows (id est small), said to mean also (a woman) who has no bellows View this entry on the original dictionary page scan.
abhayadakṣiṇāf. promise or present or protection from danger View this entry on the original dictionary page scan.
abhedakamfn. not dividing, not causing any distinction View this entry on the original dictionary page scan.
abhibhāvakamfn. overpowering, surpassing commentator or commentary on View this entry on the original dictionary page scan.
abhicak -caṣṭe- (2. sg. -cakṣase- ; Vedic or Veda infinitive mood -cakṣase- ) to look at, view, perceive ; to cast a kind or gracious look upon any one ; to address ; to assail with harsh language ; to call View this entry on the original dictionary page scan.
abhicakṣaṇan. conjuring, incantation View this entry on the original dictionary page scan.
abhicakṣaṇāf. (in augury or astronomy) observation (of the sky) View this entry on the original dictionary page scan.
abhicakṣyamfn. manifest View this entry on the original dictionary page scan.
abhicārakamf(ikā-)n. enchanting, exorcising, conjuring View this entry on the original dictionary page scan.
abhicārakamf(ikā-)n. a conjurer, a magician. View this entry on the original dictionary page scan.
abhicārakalpam. Name of work on incantations (belonging to the atharva-- veda-). View this entry on the original dictionary page scan.
abhidakṣiṇamind. to or towards the right View this entry on the original dictionary page scan.
abhidhānakan. a sound, noise View this entry on the original dictionary page scan.
ābhidhānīyakan. (fr. abhi-dhānīya-), the characteristic of a noun View this entry on the original dictionary page scan.
abhidharmakośam. Name of work on the preceding. View this entry on the original dictionary page scan.
abhidharmapiṭakam. "basket of metaphysics", Name of the third section of Buddhist writings. View this entry on the original dictionary page scan.
ābhidhātakan. word, name View this entry on the original dictionary page scan.
abhidhāvakamfn. running up, hastening towards View this entry on the original dictionary page scan.
abhidhāvakamfn. assailing, an assailant. View this entry on the original dictionary page scan.
abhidhāyakamfn. naming, expressing, expressive of, denominating View this entry on the original dictionary page scan.
abhidhāyakamfn. telling, speaking. View this entry on the original dictionary page scan.
abhidhāyakatvan. the state of being expressive. View this entry on the original dictionary page scan.
abhighātakamf(ikā-)n. counteracting, removing. View this entry on the original dictionary page scan.
abhijñānaśakuntalan. title of a play of kālidāsa- id est (the nāṭaka-or play) on the subject of"token-(recognized)- śakuntalā-" View this entry on the original dictionary page scan.
abhijñāpakamfn. making known View this entry on the original dictionary page scan.
abhikarṇakūpamind. into the auditory passage, View this entry on the original dictionary page scan.
abhikrośakam. a reviler (nindaka-) View this entry on the original dictionary page scan.
abhilak Passive voice -lakṣyate-, to appear View this entry on the original dictionary page scan.
abhilakṣaṇan. the act of marking (with signs) View this entry on the original dictionary page scan.
abhilakṣitamfn. fixed or indicated by (as by special signs) View this entry on the original dictionary page scan.
abhilakṣitamfn. determined for, selected as View this entry on the original dictionary page scan.
abhilakṣitamfn. indicated, pointed out View this entry on the original dictionary page scan.
abhilakṣitamfn. appearing, visible View this entry on the original dictionary page scan.
abhilakṣitamfn. (an--or na- negative) unseen, unperceived View this entry on the original dictionary page scan.
abhilakṣyamfn. to be fixed or indicated by, distinguishable through (in compound) View this entry on the original dictionary page scan.
abhilakṣyamind. towards a mark or aim View this entry on the original dictionary page scan.
abhilakṣyīkṛtya ind.p. (1. kṛ-), aiming at a mark, directing towards. View this entry on the original dictionary page scan.
abhilāṣakamfn. wishing, desiring (with accusative) View this entry on the original dictionary page scan.
abhimarśaka(or less correctly abhi-marṣaka- ) mfn. touching, coming in contact with. View this entry on the original dictionary page scan.
abhimrakSee abhi-mṛkṣ-. View this entry on the original dictionary page scan.
ābhimukhyakaraṇan. addressing a person, on . View this entry on the original dictionary page scan.
abhinak -n/akṣati- (perf 3. pl. -nanakṣ/uḥ-; parasmE-pada P. -n/akṣat- A1. -n/akṣamāṇa-) to approach, come to, arrive at View this entry on the original dictionary page scan.
abhinavakālidāsam. the modern kālidāsa-, id est mādhavācārya-. View this entry on the original dictionary page scan.
abhinilīyamānakamfn. ( -), (a bird) lying down in its nest in the presence of (a spectator) View this entry on the original dictionary page scan.
abhiniviṣṭakamfn. (probably) stale, flat, View this entry on the original dictionary page scan.
abhinnakālamfn. occurring at the same time, View this entry on the original dictionary page scan.
abhinnaparikarmāṣṭakan. the eight processes in working whole numbers. View this entry on the original dictionary page scan.
abhinnatarakamfn. (Comparative degree) not at all different View this entry on the original dictionary page scan.
abhipracak(Vedic or Veda infinitive mood -c/akṣe-) to see View this entry on the original dictionary page scan.
abhipradakṣiṇamind. to the right (exempli gratia, 'for example' with1. kṛ-,to circumambulate keeping the object on the right) View this entry on the original dictionary page scan.
abhiprakampCaus. -kampayati-, to stir, allure View this entry on the original dictionary page scan.
abhiprakāś -kāśate-, to become visible (cakṣuṣā-,"to the eye") View this entry on the original dictionary page scan.
abhiprakramP. -krāmati-, to go up to (accusative) View this entry on the original dictionary page scan.
abhiprakramyamfn. to be stepped upon or walked on View this entry on the original dictionary page scan.
abhiprakṣal -kṣālayati-, to clean thoroughly, polish up (as a jewel) View this entry on the original dictionary page scan.
abhiprakṣarto stream towards (accusative) View this entry on the original dictionary page scan.
abhiprakṣaritamfn. poured out View this entry on the original dictionary page scan.
abhipraṇak( nakṣ-), (perf. A1. -nanakṣ/e-) to overpower View this entry on the original dictionary page scan.
ābhīraka mf(ī-)n. belonging to the ābhīra- people View this entry on the original dictionary page scan.
ābhīrakam. the ābhīra- people. View this entry on the original dictionary page scan.
abhirakP. A1. -r/akṣati-, te- (parasmE-pada -r/akṣamāṇa- ) to guard, protect, preserve ; "to govern or command" (see abhi-rakṣita-). View this entry on the original dictionary page scan.
abhirakṣāf. protection View this entry on the original dictionary page scan.
abhirakṣaṇan. guarding, protection View this entry on the original dictionary page scan.
abhirakṣitamfn. protected, preserved, guarded View this entry on the original dictionary page scan.
abhirakṣitamfn. governed, commanded View this entry on the original dictionary page scan.
abhirakṣitṛmfn. one who preserves, a protector of (genitive case) View this entry on the original dictionary page scan.
abhirakṣyamfn. to be protected View this entry on the original dictionary page scan.
abhiraktamfn. devoted to View this entry on the original dictionary page scan.
abhirūpakamfn. equals abhi-rūpa- View this entry on the original dictionary page scan.
abhirūpakamfn. (gaRa śreṇy-ādi-and śramaṇādi- q.v) View this entry on the original dictionary page scan.
ābhirūpakan. (fr. abhirupa-), suitableness View this entry on the original dictionary page scan.
ābhirūpakan. beauty gaRa manojñādi- View this entry on the original dictionary page scan.
abhiṣaktamfn. possessed by evil spirits View this entry on the original dictionary page scan.
abhiṣaktamfn. humiliated, defeated View this entry on the original dictionary page scan.
abhiṣaktamfn. reviled, cursed. View this entry on the original dictionary page scan.
abhisaṃdhipūrvakamind. with some intention, purposely View this entry on the original dictionary page scan.
abhisaṃraktamfn. ( rañj-), intensely attached to (in compound) View this entry on the original dictionary page scan.
abhiśaṃsakamfn. accusing View this entry on the original dictionary page scan.
abhiśaṃsakamfn. insulting View this entry on the original dictionary page scan.
abhisandhakamfn. in fine compositi or 'at the end of a compound' deceiving ["calumniating"commentator or commentary ] View this entry on the original dictionary page scan.
abhiśastakamfn. accused, defamed View this entry on the original dictionary page scan.
abhiśastakamfn. caused by imprecation (as a disease) View this entry on the original dictionary page scan.
abhiṣāvakam. the priest (or any one) who expresses the soma- juice View this entry on the original dictionary page scan.
abhisāvakaetc. See abhi-ṣu-. View this entry on the original dictionary page scan.
abhisāvakīyaNom. P. yati-, to long for a sāvaka- (q.v) commentator or commentary View this entry on the original dictionary page scan.
abhivādakamfn. a saluter, saluting commentator or commentary on
abhivādakamfn. having the intention to salute, N. (see abhi-vandaka-) View this entry on the original dictionary page scan.
abhivādakamfn. civil, polite View this entry on the original dictionary page scan.
abhivandakamfn. having the intention to salute View this entry on the original dictionary page scan.
abhivicak -caṣṭe-, to look towards View this entry on the original dictionary page scan.
abhivyaktamfn. manifest, evident, distinct etc. View this entry on the original dictionary page scan.
abhivyaktamind. manifestly View this entry on the original dictionary page scan.
abhivyaktif. manifestation, distinction View this entry on the original dictionary page scan.
abhivyañjakamfn. revealing, manifesting. View this entry on the original dictionary page scan.
abhivyañjakamfn. indicative, showing. View this entry on the original dictionary page scan.
abhivyāpakamfn. (in grammar) extending to (accusative;as a rule) , including, comprehending. View this entry on the original dictionary page scan.
abhrakan. talc, mica View this entry on the original dictionary page scan.
abhrakabhasmann. calx of talc View this entry on the original dictionary page scan.
abhrakasattvan. steel View this entry on the original dictionary page scan.
abhrakhaṇḍam. n. a portion of a cloud, View this entry on the original dictionary page scan.
abhrakūṭam. n. the top of a cloud, View this entry on the original dictionary page scan.
abhraphullakam. an actor, View this entry on the original dictionary page scan.
abhrapiśācakam. "sky-demon", Name of rāhu- (the descending node personified) View this entry on the original dictionary page scan.
abhrāvakāśika([ ]) ([ ]) mfn. having the clouds for shelter, open to the sky (as an ascetic). View this entry on the original dictionary page scan.
abhrāvakāśikāśin([ ]) mfn. having the clouds for shelter, open to the sky (as an ascetic). View this entry on the original dictionary page scan.
abhṛtakamfn. idem or 'mfn. not receiving hire, not paid ' View this entry on the original dictionary page scan.
abhugnakukṣitāf. the having the loins not bent (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
ābhugnasakthamf(ī-)n. crooked-thighed, View this entry on the original dictionary page scan.
abhyācak(imperfect tense -ācaṣṭa-) to look at (accusative) ; to speak View this entry on the original dictionary page scan.
abhyaktamfn. oiled, anointed View this entry on the original dictionary page scan.
abhyaktamfn. decorated View this entry on the original dictionary page scan.
abhyañjakamfn. (in fine compositi or 'at the end of a compound') rubbing (the feet) with unctuous substances View this entry on the original dictionary page scan.
abhyantaradoṣakṛtmfn. "doing a wrong to one's own land", raising a sedition or mutiny View this entry on the original dictionary page scan.
abhyantarakam. an intimate friend View this entry on the original dictionary page scan.
abhyantarakalāf. plural the secret arts or the arts of coquetry View this entry on the original dictionary page scan.
abhyapakram -kram-, -krāmati-, to go away towards (accusative) ; (Aorist subjunctive 2. sg. -/apakramīs-) to come up to
abhyāsaktamfn. ( sañj-), closely linked together (as days by beginning a day with the same ceremony which has been performed at the end of the preceding day) commentator or commentary on View this entry on the original dictionary page scan.
abhyasūyakamfn. indignant View this entry on the original dictionary page scan.
abhyavakarṣaṇan. ( kṛṣ-), extraction, drawing out View this entry on the original dictionary page scan.
abhyavakāśam. ( kāś-), an open space. View this entry on the original dictionary page scan.
ābhyavakāśikamfn. (fr. abhy-avakāśa-), living in the open air View this entry on the original dictionary page scan.
abhyavakīrṇamfn. covered View this entry on the original dictionary page scan.
abhyavak(Passive voice 3. plural -kīryante-) to throw or cast on, pour on, cover View this entry on the original dictionary page scan.
abhyavakrandto call out towards (accusative) View this entry on the original dictionary page scan.
abhyucchritakaramfn. with uplifted proboscis View this entry on the original dictionary page scan.
abhyupalak(perf. Passive voice p. -lakṣita-) to perceive, notice View this entry on the original dictionary page scan.
abhyūṣakhādikāf. "eating of abhyūṣa--grains", Name of a play View this entry on the original dictionary page scan.
abījakamfn. unsown View this entry on the original dictionary page scan.
ābilakandam. a species of bulbous plant View this entry on the original dictionary page scan.
abrahmacaryakan. incontinence View this entry on the original dictionary page scan.
abuddhipūrvakamfn. not preceded by intelligence View this entry on the original dictionary page scan.
abuddhipūrvakamfn. beginning with non-intelligence View this entry on the original dictionary page scan.
abuddhipūrvakamind. ignorantly. View this entry on the original dictionary page scan.
acakramfn. having no wheels View this entry on the original dictionary page scan.
acakramfn. not wanting wheels id est moving by itself View this entry on the original dictionary page scan.
acakravartasee cakra-- vṛtta-. View this entry on the original dictionary page scan.
ācakrimfn. changing one thing (accusative) into another (accusative) View this entry on the original dictionary page scan.
ācakriSee ā-- 1. kṛ-. View this entry on the original dictionary page scan.
acakṛvasmfn. not guilty of a kṛtyā- (quod vide), View this entry on the original dictionary page scan.
ācakA1. -caṣṭe- (Potential 2. sg. -cakṣīthās-; perf. -cacakṣe-) to look at, inspect ; to tell, relate, make a communication about (accusative), announce, declare, make known, confess etc. ; to acquaint, introduce to (accusative) ; to address any one (accusative) ; to call, name etc. ; to signify View this entry on the original dictionary page scan.
ācakṣasmfn. eloquent (= vāgmin-), View this entry on the original dictionary page scan.
acakṣurviṣayamfn. not or no longer within reach of the eyes, invisible. View this entry on the original dictionary page scan.
acakṣusn. a bad eye, no eye View this entry on the original dictionary page scan.
acakṣusmfn. blind. View this entry on the original dictionary page scan.
ācakṣusmfn. learned commentator or commentary View this entry on the original dictionary page scan.
acakṣuṣkamfn. destitute of eyes View this entry on the original dictionary page scan.
acakṣuṣkamfn. blind. View this entry on the original dictionary page scan.
acakṣuṣṭvan. blindness. View this entry on the original dictionary page scan.
acalakīlāf. the earth. View this entry on the original dictionary page scan.
ācāmakamfn. one who sips water View this entry on the original dictionary page scan.
ācamanakan. a vessel for ā-camana- View this entry on the original dictionary page scan.
ācāmanakam. equals ācam- above View this entry on the original dictionary page scan.
ācamanīyakan. water used for ā-camana- View this entry on the original dictionary page scan.
ācandratārakamind. as long as there are moon and stars View this entry on the original dictionary page scan.
ācāntodakamfn. one who has sipped water (and purified his month) View this entry on the original dictionary page scan.
ācāracakrinm. plural Name of a vaiṣṇava- sect. View this entry on the original dictionary page scan.
acarmakamfn. having no skin View this entry on the original dictionary page scan.
ācāryakan. ( commentator or commentary) the office or profession of a teacher
ācāryakaetc. See View this entry on the original dictionary page scan.
ācāryakaraṇan. acting as teacher View this entry on the original dictionary page scan.
ācayakamfn. equals acaye kuśala-, (gaRa ākarṣādi-, q.v) View this entry on the original dictionary page scan.
ācchādakamfn. concealing, hiding (on ) View this entry on the original dictionary page scan.
ācchādakamfn. protecting, defending View this entry on the original dictionary page scan.
ācchādakatvan. hiding View this entry on the original dictionary page scan.
acchānakto go towards, approach View this entry on the original dictionary page scan.
acchidrakāṇḍan. Name of a chapter of the taittirīya-- brāhmaṇa-. View this entry on the original dictionary page scan.
ācchuritakan. a scratch with a fingernail View this entry on the original dictionary page scan.
ācchuritakan. a horse-laugh View this entry on the original dictionary page scan.
acintyakarmanmfn. performing inconceivable actions. View this entry on the original dictionary page scan.
acyutacakravartinm. Name (also title or epithet) of the author of a commentator or commentary on the Da1ya-bha1ga, . View this entry on the original dictionary page scan.
acyutajallakinm. Name of a commentator of the amara-koṣa-. View this entry on the original dictionary page scan.
acyutakṣitm. "having solid ground", Name of soma- View this entry on the original dictionary page scan.
adabdhacakṣusmfn. one whose eyes do not fail, View this entry on the original dictionary page scan.
adakamfn. chiefly in fine compositi or 'at the end of a compound' , eating. View this entry on the original dictionary page scan.
aḍakavatīf. Name of a fabulous palace on meru- View this entry on the original dictionary page scan.
aḍakavatīf. also of a city. View this entry on the original dictionary page scan.
adakṣamfn. not dexterous, unskilful, awkward. View this entry on the original dictionary page scan.
adakṣiṇamfn. not dexterous, not handy, not right, left View this entry on the original dictionary page scan.
adakṣiṇamfn. inexperienced, simple-minded, not giving or bringing in a dakṣiṇā- or present to the priest
adakṣiṇatvan. awkwardness View this entry on the original dictionary page scan.
adakṣiṇatvan. not bringing in a dakṣiṇā-. View this entry on the original dictionary page scan.
adakṣiṇīyamfn. not entitled to a dakṣiṇā- View this entry on the original dictionary page scan.
adakṣiṇyamfn. not fit to be used as a dakṣiṇā- View this entry on the original dictionary page scan.
adantaka([ ]) ([ ]) mfn. toothless. View this entry on the original dictionary page scan.
adantaka([ ]) mfn. toothless. View this entry on the original dictionary page scan.
āḍārakam. (varia lectio aṇḍār-) Name of a man, (gaRa upakādi- q.v) View this entry on the original dictionary page scan.
adarakam. Name of a man. View this entry on the original dictionary page scan.
ādarśakamfn. (Comm. on ) belonging to the country ādarśa- View this entry on the original dictionary page scan.
ādarśakam. a mirror View this entry on the original dictionary page scan.
adbhutabhīmakarmanmfn. performing wonderful and fearful works. View this entry on the original dictionary page scan.
adbhutakarmanmfn. performing wonderful works, exhibiting wonderful workmanship. View this entry on the original dictionary page scan.
adbhutakratu(/adbhuta--) mfn. possessing wonderful intelligence View this entry on the original dictionary page scan.
adbhutakṛṣṇarāja(or kr2-?), Name (also title or epithet) of a chief, View this entry on the original dictionary page scan.
adbhutottarakāṇḍan. Name of work , an appendix to or imitation of the rāmāyaṇa-. View this entry on the original dictionary page scan.
addhyālohakarṇamfn. having ears quite red see adhirūḍha-k/arna-. View this entry on the original dictionary page scan.
ādeśakam. one who commands, a guide View this entry on the original dictionary page scan.
adeśakālan. wrong place and time. View this entry on the original dictionary page scan.
ādeśakārinmfn. obeying orders. View this entry on the original dictionary page scan.
ādevakamf(ī-)n. ( div-), one who sports or plays View this entry on the original dictionary page scan.
adevakamf(ā-)n. not referring to or intended for any deity View this entry on the original dictionary page scan.
āḍhakamn. (gaRa ardharcādi- q.v; in fine compositi or 'at the end of a compound' f(ī-). commentator or commentary) a measure of grain (= 1/4 droṇa- = 4 prastha-s = 16 kudavas = 64 pala-s = 256 karṣa-s = 4096 māṣa-s;= nearly 7 lbs. 11 ozs. avoirdupois;in Bengal = two mans or 164 lbs. avds.) View this entry on the original dictionary page scan.
āḍhakajambukamfn. View this entry on the original dictionary page scan.
adhakhananan. undermining. View this entry on the original dictionary page scan.
āḍhakīf. the pulse Cajanus Indicus Spreng. View this entry on the original dictionary page scan.
āḍhakīf. a kind of fragrant earth View this entry on the original dictionary page scan.
āḍhakikamf(ī-)n. holding or containing an āḍhaka-, sown with an āḍhaka- of seed (as a field), etc. View this entry on the original dictionary page scan.
āḍhakīnamf(ā-)n. idem or 'mf(ī-)n. holding or containing an āḍhaka-, sown with an āḍhaka- of seed (as a field), etc. ' View this entry on the original dictionary page scan.
adhakriyāf. (equals apamāna-), disgrace, humiliation. View this entry on the original dictionary page scan.
adhakṛṣṇājinamind. under the black skin View this entry on the original dictionary page scan.
adhamabhṛtakam. a servant of the lowest class, a porter. View this entry on the original dictionary page scan.
ādhānakārikāf. Name of work View this entry on the original dictionary page scan.
ādhāracakran. Name of a mystical circle on the posterior part of the body View this entry on the original dictionary page scan.
ādhāraka in fine compositi or 'at the end of a compound' a substratum View this entry on the original dictionary page scan.
adharakaṇṭham. n. the lower neck, lower part of the throat View this entry on the original dictionary page scan.
ādhārakārikāf. Name of a kārikā-. View this entry on the original dictionary page scan.
adharakāyam. the lower part of the body. View this entry on the original dictionary page scan.
adhāraṇakamfn. unable to support, unremunerative. View this entry on the original dictionary page scan.
adhararucakan. lovely lips, View this entry on the original dictionary page scan.
adharauṣṭharucakan. lovely lips, View this entry on the original dictionary page scan.
adhastāllakṣmanmfn. having a mark at the lower part (of the body) View this entry on the original dictionary page scan.
ādhāyakamf(ikā-)n. ([ ]) in fine compositi or 'at the end of a compound' bestowing, giving View this entry on the original dictionary page scan.
ādhāyakamf(ikā-)n. causing, effecting View this entry on the original dictionary page scan.
ādhāyakatvan. the state of giving etc. View this entry on the original dictionary page scan.
adhikakṣayakārinmfn. causing excessive waste. View this entry on the original dictionary page scan.
adhikārakamfn. introductory, View this entry on the original dictionary page scan.
adhikaraṇabhojakam. a judge. View this entry on the original dictionary page scan.
adhikaraṇalekhakam. a clerk at a hall of justice, View this entry on the original dictionary page scan.
adhikarmakaram. See adhi-- 1 kṛ- below. View this entry on the original dictionary page scan.
adhikarmakara m. an overseer, superintendent. View this entry on the original dictionary page scan.
adhikarmakṛt t- m. See adhi-- 1 kṛ- below. View this entry on the original dictionary page scan.
adhikarmakṛtm. an overseer, superintendent. View this entry on the original dictionary page scan.
adhikarmakṛtam. person appointed to superintend an establishment. View this entry on the original dictionary page scan.
āḍhīlaka varia lectio for āṭīl- q.v View this entry on the original dictionary page scan.
adhīlohakarṇamfn. equals addhyāloha-k/arna- q.v View this entry on the original dictionary page scan.
adhimakhamind. in regard to a sacrifice, View this entry on the original dictionary page scan.
adhimāṃsakam. proud flesh or cancer (especially in the eyes or the back part of the gums). View this entry on the original dictionary page scan.
adhimātrakāruṇikam. "exceedingly merciful", Name of a mahā-brāhmaṇa- View this entry on the original dictionary page scan.
adhirūḍhakam. a parasitical plant, View this entry on the original dictionary page scan.
adhiṣavaṇaphalakan. dual number Name (also title or epithet) of two boards used in pressing the soma-, View this entry on the original dictionary page scan.
adhiṣṭhāyakamfn. governing, superintending, guarding. View this entry on the original dictionary page scan.
adhityakāf. (fr. adhi-tya-,a derivation of adhi-; see ), land on the upper part of a mountain, table land View this entry on the original dictionary page scan.
adhivājyakulādyam. Name of a country View this entry on the original dictionary page scan.
adhivakṣasind. on the breast, View this entry on the original dictionary page scan.
adhivaktṛm. an advocate, protector, comforter View this entry on the original dictionary page scan.
adhoakṣamfn. being below (or not coming up to) the axle View this entry on the original dictionary page scan.
adhobhaktan. a dose of medicine to be taken after eating. View this entry on the original dictionary page scan.
adhoraktapittan. discharge of blood from the anus and the urethra. View this entry on the original dictionary page scan.
adhūmakamfn. smokeless. View this entry on the original dictionary page scan.
adhvarakalpamfn. equivalent to a sacrifice called adhvara-, View this entry on the original dictionary page scan.
adhvarakalpāf. Name of an optional sacrifice (kāmyeṣṭi-). View this entry on the original dictionary page scan.
adhvarakāṇḍan. Name of the book in the śatapatha-brāhmaṇa- which refers to adhvara-s. View this entry on the original dictionary page scan.
adhvarakarmann. performance of the adhvara- or any act connected with it View this entry on the original dictionary page scan.
adhvarakṛtm. performing an adhvara- View this entry on the original dictionary page scan.
āḍhyakan. wealth, (gaRa manojñādi-.) View this entry on the original dictionary page scan.
adhyakṣamf(ā-)n. perceptible to the senses, observable View this entry on the original dictionary page scan.
adhyakṣamf(ā-)n. exercising supervision View this entry on the original dictionary page scan.
adhyakṣam. an eye-witness View this entry on the original dictionary page scan.
adhyakṣam. an inspector, superintendent View this entry on the original dictionary page scan.
adhyakṣam. the plant Mimusops Kauki (kṣīrikā-). View this entry on the original dictionary page scan.
adhyakṣaramind. on the subject of syllables View this entry on the original dictionary page scan.
adhyakṣaramind. above all syllables (as the mystic om-). View this entry on the original dictionary page scan.
ādhyakṣyan. (fr. adhy-akṣa-), superintendence View this entry on the original dictionary page scan.
adhyaktamfn. ( añj-), equipped, prepared. View this entry on the original dictionary page scan.
āḍhyakulīnamfn. descended from a rich family View this entry on the original dictionary page scan.
ādhyāpakam. a teacher, a religious preceptor (= adhyāpaka- q.v) View this entry on the original dictionary page scan.
adhyāpakamfn. a teacher (especially of sacred knowledge). View this entry on the original dictionary page scan.
adhyāpakaetc. See adhī-. View this entry on the original dictionary page scan.
adhyāpakoditam. styled a teacher. View this entry on the original dictionary page scan.
adhyardhakamfn. amounting to or worth one and a half. View this entry on the original dictionary page scan.
adhyardhakākiṇīkamfn. amounting to or worth one and a half kākiṇī-. View this entry on the original dictionary page scan.
adhyardhakaṃsam. n. one and a half kaṃsa- View this entry on the original dictionary page scan.
adhyardhakaṃsamf(ī-)n. amounting to or worth one and a half kaṃsa-. View this entry on the original dictionary page scan.
adhyardhakārṣāpaṇa mfn. amounting to or worth one and a half kārṣāpaṇa-. View this entry on the original dictionary page scan.
adhyardhakārṣāpaṇikamfn. amounting to or worth one and a half kārṣāpaṇa-. View this entry on the original dictionary page scan.
adhyardhakhārīkamfn. amounting to or worth one and a half khārī-. View this entry on the original dictionary page scan.
adhyātmottarakāṇḍan. the last book of the adhyātma-rāmāyaṇa-. View this entry on the original dictionary page scan.
āḍibakamfn. (the combat) fought by the birds āḍi- and baka- (into which vasiṣṭha- and viśvāmitra- had been transformed respectively) View this entry on the original dictionary page scan.
āḍībakamfn. equals āḍi-baka- q.v View this entry on the original dictionary page scan.
ādidīpakan. Name of a figure in rhetoric (the verb standing at the beginning of the sentence) View this entry on the original dictionary page scan.
ādikeśavāṣṭakan. Name (also title or epithet) of a stotra- View this entry on the original dictionary page scan.
ādīpakamfn. () setting on fire View this entry on the original dictionary page scan.
ādīpakam. an incendiary View this entry on the original dictionary page scan.
ādiśaktif. the primeval power, Name of māyā- View this entry on the original dictionary page scan.
ādityabhakf. equals -parṇikā- View this entry on the original dictionary page scan.
ādityakāntāf. Polanisia Icosandra (a creeping plant with gold-coloured flowers, growing near the water) View this entry on the original dictionary page scan.
ādityakeśavam. Name of an image of viṣṇu-. View this entry on the original dictionary page scan.
ādityaketum. Name of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
ādityakīlakam. a particular phenomenon in the sky, , Scholiast or Commentator View this entry on the original dictionary page scan.
ādityaśaktim. Name (also title or epithet) of a chief, View this entry on the original dictionary page scan.
ādivaktṛm. the first propounder of a doctrine, , Introduction View this entry on the original dictionary page scan.
adṛptakratu(/adṛpta--) mfn. sober-minded View this entry on the original dictionary page scan.
adṛṣṭakāmam. passionate attachment to an object that has never been seen. View this entry on the original dictionary page scan.
adṛṣṭakarmanmfn. one who has not seen practice. View this entry on the original dictionary page scan.
adṛśyakaraṇan. act of rendering invisible View this entry on the original dictionary page scan.
adṛśyakaraṇan. Name of a part of a treatise on magic. View this entry on the original dictionary page scan.
adurmakhamfn. not reluctant, unremitting, cheerful View this entry on the original dictionary page scan.
advaitamakarandam. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ādyakālakamf(ikā-)n. relating only to this day, View this entry on the original dictionary page scan.
ādyakavim. "the first poet", Name of vālmīki- (see ādi-kavi-above) View this entry on the original dictionary page scan.
ādyakavim. see View this entry on the original dictionary page scan.
ādyamāṣakam. Name of a weight equal to five guñjā-s View this entry on the original dictionary page scan.
ādyantayamakan. "homophony in the beginning and end of a stanza", Name of a figure in poetry (occurring in etc.) View this entry on the original dictionary page scan.
adyotakamfn. not expressing or denoting, Sch. View this entry on the original dictionary page scan.
āgamakalpadrumam. Name (also title or epithet) of work (confer, compare -208) View this entry on the original dictionary page scan.
āgamakaumudīf. Name (also title or epithet) of work (confer, compare -208) View this entry on the original dictionary page scan.
āgamakṛsaram. kṛsara- as offered at the arrival (of a guest) View this entry on the original dictionary page scan.
āgamaprakāśam. Name (also title or epithet) of work (confer, compare -208) View this entry on the original dictionary page scan.
agārāvakāśam. ground fit for (building) a house, View this entry on the original dictionary page scan.
āgatakṣobhamfn. confounded, perplexed. View this entry on the original dictionary page scan.
aghakṛtmfn. doing evil or harm, an evil-doer View this entry on the original dictionary page scan.
aghanāsakamfn. sin destroying, expiatory View this entry on the original dictionary page scan.
aghanāsakam. "an expiator", Name of viṣṇu-. View this entry on the original dictionary page scan.
aghāsakamfn. without food or provisions. View this entry on the original dictionary page scan.
āghātakālam. a critical or dangerous time, View this entry on the original dictionary page scan.
āghaṭṭakam. "causing friction", the plant Desmochaeta Atropurpurea View this entry on the original dictionary page scan.
aghodakan. (probably) the daily bath during the period of uncleanness, View this entry on the original dictionary page scan.
aghoracakṣus(/aghora--) mfn. not having an evil eye View this entry on the original dictionary page scan.
agnicakran. the sphere or range of fire, View this entry on the original dictionary page scan.
agnidāyakam. equals -da- q.v View this entry on the original dictionary page scan.
āgnīdhrakam. Name of one of the seven ṛṣi-s in the twelfth manvantara- View this entry on the original dictionary page scan.
agninakṣatran. the third lunar mansion the Pleiades (kṛttikā-) View this entry on the original dictionary page scan.
agninyakta(n/i-- ny-), mfn. mingled with agni- (id est having agni- incidentally mentioned), View this entry on the original dictionary page scan.
agnipakvamfn. cooked on the fire View this entry on the original dictionary page scan.
agnirahasyakāṇḍan. Name (also title or epithet) of the 10th (or 12th) book of the View this entry on the original dictionary page scan.
agnirakṣaṇan. maintenance of the sacred domestic fire. View this entry on the original dictionary page scan.
agniśakaṭīf. "fire-vehicle", a portable furnace, View this entry on the original dictionary page scan.
agnisakham. "friend of fire", the wind View this entry on the original dictionary page scan.
agniśaktif. the force of digestion, View this entry on the original dictionary page scan.
agnīṣomīyaikādasakapālam. cake sacred to agni- and soma- See above. View this entry on the original dictionary page scan.
agnivardhaka mfn. promoting digestion, stomachic. View this entry on the original dictionary page scan.
agnyātmakamf(ikā-)n. having agni-'s nature. View this entry on the original dictionary page scan.
āgrahāyaṇakamfn. to be paid (as a debt) on the day of full moon of the month agrahāyaṇa- View this entry on the original dictionary page scan.
agrāhyakamfn. not to be perceived, impalpable View this entry on the original dictionary page scan.
agrajātaka m. a brahman- View this entry on the original dictionary page scan.
agrakaram. the fore part of the hand, finger View this entry on the original dictionary page scan.
agrakaram. first ray View this entry on the original dictionary page scan.
agrakāyam. the fore part of the body. View this entry on the original dictionary page scan.
agranakham. tip of a nail View this entry on the original dictionary page scan.
agranakham. see nakhāgra-. View this entry on the original dictionary page scan.
agraśrāvakam. (and f(ikā-))"chief disciple", Name (also title or epithet) of some followers of buddha-, View this entry on the original dictionary page scan.
agravaktran. Name of a surgical instrument View this entry on the original dictionary page scan.
āgrayaṇakan. oblation consisting of the first-fruits View this entry on the original dictionary page scan.
āgrayaṇakan. (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
āhakam. a peculiar disease of the nose, inflammation of the Schneiderian membrane. View this entry on the original dictionary page scan.
ahakamSee ah/am-.
ahakam diminutive for ah/am-,"I" View this entry on the original dictionary page scan.
āhalak([ ]) and āh/alam- ([ ]) ind. a smacking sound. View this entry on the original dictionary page scan.
āhananaprakāramfn. fit for beating View this entry on the original dictionary page scan.
āhārakamfn. bringing near, procuring, fetching commentator or commentary on (see kṛtāhāra-ka-.) View this entry on the original dictionary page scan.
āharakaraṭā(id est ā-hara karaṭa! ity-ucyate yasyāṃ kriyāyāṃ sā-), View this entry on the original dictionary page scan.
āhatalakṣaṇamfn. one whose marks or characteristics are mentioned, famed, reputed View this entry on the original dictionary page scan.
āhavakāmyāf. desire of war. View this entry on the original dictionary page scan.
āhavanīyakam. equals āhavan/īya- above. View this entry on the original dictionary page scan.
ahicakran. a certain Tantric diagram. View this entry on the original dictionary page scan.
ahicchattrakan. a mushroom View this entry on the original dictionary page scan.
ahicumbakam. Name of a man, and ahicumbakāyani ahicumbakāyani- m. a descendant of his View this entry on the original dictionary page scan.
ahicumbakāyanim. ahicumbaka
ahimakaram. "having hot rays", the sun
ahimakiraṇam. idem or 'm. "having hot rays", the sun ' View this entry on the original dictionary page scan.
ahimārakam. (equals asi-meda- q.v) the plant Vachellia Farnesiana View this entry on the original dictionary page scan.
ahimedakam. idem or ' m. idem or 'm. (equals asi-meda- q.v) the plant Vachellia Farnesiana ' ' View this entry on the original dictionary page scan.
ahiṃsakamfn. not hurting, harmless, innocuous View this entry on the original dictionary page scan.
ahīnakarmanmfn. "not devoted to inferior or vile work"(or"not neglecting one's regular actions") View this entry on the original dictionary page scan.
ahinakulikāf. the natural enmity between a snake and an ichneumon View this entry on the original dictionary page scan.
āhiṇḍakam. and āhiṇḍika- a man of mixed origin (the son of a niṣāda- father and a vaidehī- mother ;employed as a watchman outside gaols etc. commentator or commentary on ) View this entry on the original dictionary page scan.
āhiṇḍakam. a traveller [in Prakrit] View this entry on the original dictionary page scan.
ahiputrakam. a kind of boat View this entry on the original dictionary page scan.
ahitakārinmfn. adverse, inimical, noxious View this entry on the original dictionary page scan.
āhitaklamamfn. overcome with fatigue, exhausted. View this entry on the original dictionary page scan.
āhitalakṣaṇamfn. noted or known for good qualities (equals ā-hatal- q.v) View this entry on the original dictionary page scan.
āhitalakṣaṇamfn. one who has laid down his banner View this entry on the original dictionary page scan.
āhlādakamfn. causing delight, refreshing, reviving View this entry on the original dictionary page scan.
āhlādakaramfn. causing or conferring delight View this entry on the original dictionary page scan.
āhlādakārinmfn. idem or 'mfn. causing or conferring delight ' View this entry on the original dictionary page scan.
āhnikadīpakam. Name of work View this entry on the original dictionary page scan.
āhṛtayajñakratu(/āhṛta--) mfn. intending to accomplish a prepared sacrifice View this entry on the original dictionary page scan.
āhutīṣṭakāf. plural a kind of brick View this entry on the original dictionary page scan.
āhutiṣṭakāf. (for 2. ā-huti-See ā-hve-.) View this entry on the original dictionary page scan.
āhvarakam. plural Name of a school View this entry on the original dictionary page scan.
āhvārakam. plural idem or 'm. plural Name of a school ' View this entry on the original dictionary page scan.
āhvarakanthan. Name of a town of the uśīnara-s on View this entry on the original dictionary page scan.
āhvāyakam. a messenger, courier View this entry on the original dictionary page scan.
aiḍakamf(ī-)n. idem or 'mfn. (fr. eḍa-), coming from the sheep eḍa- ' View this entry on the original dictionary page scan.
aiḍakam. a species of sheep View this entry on the original dictionary page scan.
aiḍakautsan. Name of certain sāman-s. View this entry on the original dictionary page scan.
aiḍakāvan. Name of certain sāman-s. View this entry on the original dictionary page scan.
aiḍakrauñcan. Name of certain sāman-s. View this entry on the original dictionary page scan.
aikakālyan. (fr. eka-kāla-), unity of time View this entry on the original dictionary page scan.
aikakarmyan. (fr. eka-karman-), unity of action View this entry on the original dictionary page scan.
ailabakāramfn. making a noise, roaring (said of rudra-'s dogs) View this entry on the original dictionary page scan.
ailakamfn. coming from the sheep called eḍaka- View this entry on the original dictionary page scan.
aindrāgnakulāyam. a particular ekāha- (q.v) View this entry on the original dictionary page scan.
aindrāyaṇakamfn. belonging or relating to aindrāyaṇa- gaRa arīhaṇādi- View this entry on the original dictionary page scan.
aindriyakamfn. relating to the senses, sensual View this entry on the original dictionary page scan.
aindriyakatvan. the state of relating to senses commentator or commentary on View this entry on the original dictionary page scan.
ainvakan. Name of a sāman- View this entry on the original dictionary page scan.
airāvatakam. Name of a mountain View this entry on the original dictionary page scan.
airāvatakan. the fruit of Artocarpus Lacucha View this entry on the original dictionary page scan.
aiṣṭakamfn. (fr. iṣṭakā-), made of bricks (as a house) View this entry on the original dictionary page scan.
aiṣṭakan. the sacrificial bricks collectively View this entry on the original dictionary page scan.
aiṣṭakan. putting up the bricks View this entry on the original dictionary page scan.
aiṣukāribhaktamfn. inhabited by aiṣukāri-s (as a country) View this entry on the original dictionary page scan.
aiśvarakāraṇikam. a theist of the nyāya- school, View this entry on the original dictionary page scan.
aiśvaryakādambinīf. Name (also title or epithet) of a poem in praise of kṛṣṇa- by vidyā-bhūṣaṇa-. View this entry on the original dictionary page scan.
aitareyakan. the aitareya-brāhmaṇa-. View this entry on the original dictionary page scan.
aitareyāraṇyakan. Name of the āraṇyaka- composed by aitareya- (consisting of five books or āraṇyaka-s, the second and third books of which form the upaniṣad-). View this entry on the original dictionary page scan.
ajabhakṣam. "goat's food", the plant varvūra-. View this entry on the original dictionary page scan.
ajaiḍakan. goats and rams, (gaRa gavāśvādi-, q.v) View this entry on the original dictionary page scan.
ajakam. Name of a descendant of purūravas- View this entry on the original dictionary page scan.
ajakam. of a king of magadha- View this entry on the original dictionary page scan.
ajakāf. a young she-goat View this entry on the original dictionary page scan.
ājakan. a flock of goats View this entry on the original dictionary page scan.
ajakājātan. the above disease. View this entry on the original dictionary page scan.
ājakāram. śiva-'s bull View this entry on the original dictionary page scan.
ajakarṇam. a goat's ear View this entry on the original dictionary page scan.
ajakarṇam. the tree Terminalia Alata Tomentosa. View this entry on the original dictionary page scan.
ajakarṇakam. the Sal-tree, Shorea Robusta. View this entry on the original dictionary page scan.
ājakaroṇam. View this entry on the original dictionary page scan.
ajakavam. śiva-'s bow View this entry on the original dictionary page scan.
ajakāvamfn. Name of a sacrificial vessel dedicated to mitra- and varuṇa- and (according to the commentator or commentary) having an ornament similar to the fleshy protuberance called ajā-gala-stana- q.v View this entry on the original dictionary page scan.
ajakāvamn. a species of venomous vermin, centipede or scorpion View this entry on the original dictionary page scan.
ajakāvamn. śiva-'s bow View this entry on the original dictionary page scan.
ājakeśinm. plural Name (also title or epithet) of a family, View this entry on the original dictionary page scan.
ājakrandakamfn. belonging to the aja-kranda- people View this entry on the original dictionary page scan.
ājakrandakaetc. See āja-. View this entry on the original dictionary page scan.
ājakrandim. a descendant of an ājakrandaka- man or prince View this entry on the original dictionary page scan.
ajakṣīran. goat's milk View this entry on the original dictionary page scan.
ajakṣīran. see View this entry on the original dictionary page scan.
ajakūlāf. Name of a town of the bodhi-s. View this entry on the original dictionary page scan.
ājamīḍhakamfn. belonging or referring to ajamīḍha- View this entry on the original dictionary page scan.
ajanāmakam. "named aja- or viṣṇu-", a mineral substance. View this entry on the original dictionary page scan.
ajāpālakamfn. tending goats View this entry on the original dictionary page scan.
ajāpālakam. a goat-herd. View this entry on the original dictionary page scan.
ajarakamn. indigestion. View this entry on the original dictionary page scan.
ajātakakudm. a young bull whose hump is yet undeveloped View this entry on the original dictionary page scan.
ajātapakṣamfn. having undeveloped wings. View this entry on the original dictionary page scan.
ājavāhakamfn. fr. aja-vāha- q.v , (gaRa kacchādi- q.v) View this entry on the original dictionary page scan.
ajihvakaf. jihvaka
ajitakakambalam. Name of one of the six chief heretical teachers (mentioned in Buddhist texts as contemporaries of buddha-). View this entry on the original dictionary page scan.
ājīvakam. equals vika- below View this entry on the original dictionary page scan.
ājñābhaṅgakaramfn. not executing an order. ([ ]) View this entry on the original dictionary page scan.
ājñābhaṅgakārinmfn. not executing an order. ([ ]) View this entry on the original dictionary page scan.
ājñācakran. a mystical circle or diagram (one of the six described by the ) View this entry on the original dictionary page scan.
ajñakā f. an ignorant woman View this entry on the original dictionary page scan.
ajñānakṛtamfn. done inadvertently. View this entry on the original dictionary page scan.
ājñāpakamf(ikā-)n. giving orders, commanding (varia lectio -jñāpaka-). View this entry on the original dictionary page scan.
ajñātakamfn. unknown, (gaRa yāvādi- q.v) View this entry on the original dictionary page scan.
ājñātakauṇḍinyam. Name of one of the first five pupils of śākyamuni-. View this entry on the original dictionary page scan.
ajñātaketa(/ajñāta--) mfn. having unknown or secret designs View this entry on the original dictionary page scan.
ajñātakulaśilamfn. whose lineage and character are unknown, View this entry on the original dictionary page scan.
ajñātayakṣmam. an unknown or hidden disease View this entry on the original dictionary page scan.
ākalpakam. (equals utkaṇṭhā-or utkalikā-) remembering with regret, missing View this entry on the original dictionary page scan.
ākalpakam. (equals mud-) joy View this entry on the original dictionary page scan.
ākalpakam. (equals moka-) loss of sense or perception View this entry on the original dictionary page scan.
ākalpakam. (equals tamas-) darkness View this entry on the original dictionary page scan.
ākalpakam. (equals granthi-) a knot or joint View this entry on the original dictionary page scan.
ākāravarṇasuślakṣṇamfn. delicate in shape and colour. View this entry on the original dictionary page scan.
ākarṇakam. n. (and f(ikā-)) the sheath of a knife, View this entry on the original dictionary page scan.
ākarṣakamfn. equals ākarṣe kuśala- View this entry on the original dictionary page scan.
ākarṣakam. a magnet View this entry on the original dictionary page scan.
ākarṣakārikāf. Name of a plant View this entry on the original dictionary page scan.
ākarṣakrīḍāf. Name of a play View this entry on the original dictionary page scan.
ākāśabaddhalakṣam. (in theatrical language) fixing the gaze on some object out of sight of the audience View this entry on the original dictionary page scan.
ākāśacakran. the region of ether, View this entry on the original dictionary page scan.
ākaṣaka mfn. vv.ll. for ā-karṣaka- and rṣika-, q.v sub voce, i.e. the word in the Sanskrit order ā-kṛṣ-. View this entry on the original dictionary page scan.
ākāśakakṣāf. "girdle of the sky", the horizon View this entry on the original dictionary page scan.
ākāśarakṣinm. a watchman on the outer battlements View this entry on the original dictionary page scan.
ākāśodakan. equals ākāśa-salila- q.v View this entry on the original dictionary page scan.
ākhaṇḍalakakubhf. "indra-'s quarter", the east, View this entry on the original dictionary page scan.
ākhanikabakam. "a stork in relation to a mouse", (metaphorically) a man who behaves as an oppressor towards a weak person, (gaRa pātresamitādi-and yuktārohy-ādi- q.v)
ākheṭakam. equals ā-kheṭa- View this entry on the original dictionary page scan.
ākheṭakam. a hunter View this entry on the original dictionary page scan.
ākheṭakāṭavīf. a hunting-forest View this entry on the original dictionary page scan.
ākheṭaśīrṣaka varia lectio for ākhoṭa-ś- q.v View this entry on the original dictionary page scan.
ākhoṭakatīrthan. Name of a tīrtha-, View this entry on the original dictionary page scan.
ākhoṭaśīrṣakan. a kind of pavement View this entry on the original dictionary page scan.
ākhyānakan. a short narrative View this entry on the original dictionary page scan.
ākhyānakīf. Name of a metre (being a combination of the indravajrā- and upendravajrā-). View this entry on the original dictionary page scan.
ākhyāpakamfn. making known View this entry on the original dictionary page scan.
ākīṭapataṃgapipīlakamind. down to worms (and) flying insects (and) ants, View this entry on the original dictionary page scan.
ākrāntanāyakāf. (in theatrical language) whose lover is won or kept in obedience View this entry on the original dictionary page scan.
ākrośakamfn. abusing View this entry on the original dictionary page scan.
ākṣakīf. a kind of spirituous liquor prepared from the seeds of Terminalia Bellerica View this entry on the original dictionary page scan.
ākṣepakamfn. pointing to, hinting at View this entry on the original dictionary page scan.
ākṣepakamfn. reviling View this entry on the original dictionary page scan.
ākṣepakam. convulsion, spasm View this entry on the original dictionary page scan.
ākṣeparūpakan. a simile, in which the object compared is only hinted at View this entry on the original dictionary page scan.
ākṣoḍakam. equals akṣoṭa- q.v View this entry on the original dictionary page scan.
āktakha(kta--) mfn. in whose nave the hole is smeared View this entry on the original dictionary page scan.
ākulakṛtmfn. "making confused", the plant Anthemis Pyrethrum (See ākalla-) View this entry on the original dictionary page scan.
alakamn. (in fine compositi or 'at the end of a compound' f(ā-).) a curl, lock etc. View this entry on the original dictionary page scan.
alakam. (equals alarka- q.v) a mad dog View this entry on the original dictionary page scan.
alakam. plural Name of a people View this entry on the original dictionary page scan.
alakam. of the Inhabitants of kubera-'s residence alakā- View this entry on the original dictionary page scan.
alakāf. (gaRa kṣipakādi- q.v) a girl from eight to ten years of age View this entry on the original dictionary page scan.
alakam. Name of the capital of kubera- (situated on a peak of the himālaya- inhabited also by śiva-) View this entry on the original dictionary page scan.
alakam. Name of a town in niṣadha- View this entry on the original dictionary page scan.
alakādhipa ([ ]) m. "lord of alakā-", a Name of kubera- View this entry on the original dictionary page scan.
alakādhipati([ ]) m. "lord of alakā-", a Name of kubera- View this entry on the original dictionary page scan.
alakamind. in vain, for nothing View this entry on the original dictionary page scan.
alakanandāf. a young girl from eight to ten years old View this entry on the original dictionary page scan.
alakanandāf. Name of a river that runs from the himālaya- mountains and falls into the gaṅgā- View this entry on the original dictionary page scan.
alakāntam. the end of a curl a ringlet. View this entry on the original dictionary page scan.
alakaprabhāf. the capital of kubera- View this entry on the original dictionary page scan.
alakapriyam. the plant Terminalia Tomentosa View this entry on the original dictionary page scan.
alakasaṃhatif. rows of curls. View this entry on the original dictionary page scan.
alakeśvaram. "lord of alakā-", a Name of kubera- View this entry on the original dictionary page scan.
alakhānam. Name of a king of gurjara- View this entry on the original dictionary page scan.
ālakA1. -lakṣayate-, to descry, behold, see View this entry on the original dictionary page scan.
alakṣaṇan. ( lakṣ-), a bad, inauspicious sign View this entry on the original dictionary page scan.
alakṣaṇamf(ā-)n. having no signs or marks, without characteristic , having no good marks, inauspicious, unfortunate View this entry on the original dictionary page scan.
ālakṣaṇan. perceiving, beholding, observing. View this entry on the original dictionary page scan.
alakṣaṇakamfn. undefinable, incomparable (said of buddha-), View this entry on the original dictionary page scan.
ālakṣimf(ī-)n. beholding, seeing, (gaRa gaurādi- ) View this entry on the original dictionary page scan.
alakṣitamfn. unseen, unperceived, unobserved View this entry on the original dictionary page scan.
alakṣitamfn. un-characterized having no particular mark View this entry on the original dictionary page scan.
ālakṣitamfn. beheld, descried, perceived View this entry on the original dictionary page scan.
ālakṣitan. Name (also title or epithet) of a wood, Bombay edition). View this entry on the original dictionary page scan.
alakṣitāntakamfn. suddenly dead View this entry on the original dictionary page scan.
alakṣitopasthitamfn. one who has approached unobserved. View this entry on the original dictionary page scan.
alakṣmanmfn. inauspicious, View this entry on the original dictionary page scan.
alakṣmīf. evil fortune, bad luck, distress, poverty View this entry on the original dictionary page scan.
alakṣmī(mfn.) causing misfortune View this entry on the original dictionary page scan.
alakṣyamfn. invisible, unobserved etc., unmarked, not indicated View this entry on the original dictionary page scan.
alakṣyamfn. having no particular marks, insignificant in appearance (See -janma--below) View this entry on the original dictionary page scan.
alakṣyam. Name of a mantra- spoken to exorcise a weapon View this entry on the original dictionary page scan.
ālakṣyamfn. to be observed, visible, apparent View this entry on the original dictionary page scan.
ālakṣya ind.p. having observed or beheld, beholding, observing View this entry on the original dictionary page scan.
ālakṣyamfn. scarcely visible, just visible View this entry on the original dictionary page scan.
alakṣyagatimfn. moving invisibly. View this entry on the original dictionary page scan.
alakṣyajanmatāf. being of insignificant birth or origin View this entry on the original dictionary page scan.
alakṣyaliṅgamfn. disguised, incognito. View this entry on the original dictionary page scan.
alaktam. (said to be for arakta-), red juice or lac (obtained from the red resin of certain trees and from the cochineal's red sap) View this entry on the original dictionary page scan.
alaktakam. rarely n. idem or 'm. the alakta- juice ' View this entry on the original dictionary page scan.
alaktarasam. the alakta- juice View this entry on the original dictionary page scan.
alaṃkārakam. ornament View this entry on the original dictionary page scan.
alaṃkārakārikāf. work on rhetoric View this entry on the original dictionary page scan.
alaṃkārakaustubham. work on rhetoric View this entry on the original dictionary page scan.
ālaptakamfn. talkative, affable, View this entry on the original dictionary page scan.
alasakam. tympanitis, flatulence (intumescence of the abdomen, with constipation and wind) View this entry on the original dictionary page scan.
alātacakravat(ind.) View this entry on the original dictionary page scan.
alavālakam. equals ālavāla- q.v View this entry on the original dictionary page scan.
alepakamfn. stainless. View this entry on the original dictionary page scan.
alīkasuptakan. pretended sleep
alimakam. a bee View this entry on the original dictionary page scan.
alimakam. the Indian cuckoo View this entry on the original dictionary page scan.
alimakam. a frog View this entry on the original dictionary page scan.
alimakam. the plant Bassia Latifolia View this entry on the original dictionary page scan.
alimakam. the filaments of the lotus View this entry on the original dictionary page scan.
alimbakam. equals alimaka-. View this entry on the original dictionary page scan.
alimpaka m. equals alimaka-. View this entry on the original dictionary page scan.
ālīnakan. tin, (from its close adherence to other metals ?) View this entry on the original dictionary page scan.
alindakam. a terrace before a house-door View this entry on the original dictionary page scan.
alipakam. (= 1 ali-above) a bee View this entry on the original dictionary page scan.
alipakam. the Indian cuckoo View this entry on the original dictionary page scan.
alipakam. a dog View this entry on the original dictionary page scan.
āllakeyasee hṛtsv-- āśaya-. View this entry on the original dictionary page scan.
ālocakamfn. causing to see View this entry on the original dictionary page scan.
ālokakam. a spectator View this entry on the original dictionary page scan.
ālokakaramfn. spreading or causing light View this entry on the original dictionary page scan.
ālokakaram. a particular samādhi-, View this entry on the original dictionary page scan.
alomaka([ ]) or a-l/amaka- ([ ]) mf(Ved. makā-,class. mikā-[ ;but also ] commentator or commentary) n. hairless. View this entry on the original dictionary page scan.
alpadakṣiṇamfn. defective in presents (as a ceremony) View this entry on the original dictionary page scan.
alpakamf(ikā-)n. small, minute, trifling etc. View this entry on the original dictionary page scan.
alpakam. the plants Hedysarum Alhagi and Premna Herbacea View this entry on the original dictionary page scan.
alpakamind. little View this entry on the original dictionary page scan.
alpakaṇṭhamfn. having a feeble voice, View this entry on the original dictionary page scan.
alpakāryan. small matter. View this entry on the original dictionary page scan.
alpakātind. shortly after View this entry on the original dictionary page scan.
alpakātind. (also) nearly, almost, View this entry on the original dictionary page scan.
alpakāyamfn. thin, emaciated, View this entry on the original dictionary page scan.
alpakāyatva(n.) View this entry on the original dictionary page scan.
alpakeśīf. Name of a plant (or perhaps the root of sweet flag) View this entry on the original dictionary page scan.
alpakrītamfn. bought for little money, cheap. View this entry on the original dictionary page scan.
alpapramāṇakam. common cucumber (Cucumis Sativus) View this entry on the original dictionary page scan.
alpapuṣpakam. "small-flowered", the tilaka- tree, View this entry on the original dictionary page scan.
alpapuṣpakāf. the small Banana, View this entry on the original dictionary page scan.
alpaśaktimfn. of little strength, weak, feeble View this entry on the original dictionary page scan.
alpiṣṭhakīrtimfn. of very little reputation View this entry on the original dictionary page scan.
amajjakamfn. having no marrow View this entry on the original dictionary page scan.
āmakamfn. raw, uncooked, etc. View this entry on the original dictionary page scan.
āmakumbham. a water-jar of unbaked clay. View this entry on the original dictionary page scan.
āmalakamf(ī-). (gaRa gaurādi- ) Emblic Myrobalan, Emblica Officinalis Gaertn. View this entry on the original dictionary page scan.
āmalakan. the fruit of the Emblic Myrobalan etc. View this entry on the original dictionary page scan.
āmalakam. another plant, Gendarussa Vulgaris View this entry on the original dictionary page scan.
āmalakī confer, compare View this entry on the original dictionary page scan.
āmalakīpattran. Pinus Webbiana. View this entry on the original dictionary page scan.
āmalakīpattraphalan. the fruit of the Emblic Myrobalan View this entry on the original dictionary page scan.
amalapakṣavihaṃgamam. a swan, View this entry on the original dictionary page scan.
amalātakaor a malānaka- n. (a mlāna- q.v) globe amaranth (Gomphraena Globosa), (see amilātaka-.) View this entry on the original dictionary page scan.
amāṃsabhakṣamfn. not eating flesh View this entry on the original dictionary page scan.
amāṃsakamfn. without flesh View this entry on the original dictionary page scan.
āmaṇḍakan. the castor-oil plant, Ricinus Communis (see amaṇḍa-and maṇḍa-.) View this entry on the original dictionary page scan.
amantrakamf(ikā-)n. unaccompanied by Vedic verses View this entry on the original dictionary page scan.
amantrakan. no Vedic verse or formula View this entry on the original dictionary page scan.
amārakamfn. not killing on View this entry on the original dictionary page scan.
amarakaṇṭakan. "peak of the immortals", Name of part of the vindhya- range (near the source of the śoṇā- and narmadā-). View this entry on the original dictionary page scan.
amarakoṣam. Name of the Sanskrit dictionary of amara- or amara-siṃha-. View this entry on the original dictionary page scan.
amarakoṣakaumudīf. title of a commentary on amara-siṃha-'s dictionary. View this entry on the original dictionary page scan.
amarakoṭam. "fortress of immortals", Name of the capital of a Rajput state. View this entry on the original dictionary page scan.
āmaraktam. dysentery. View this entry on the original dictionary page scan.
amaraprakhya mfn. like an immortal. View this entry on the original dictionary page scan.
amarapuṣpakam. the plants Saccharum Spontaneum, Pandanus Odoratissimus and Magnifera Indica. View this entry on the original dictionary page scan.
amaraśaktim. Name of a king View this entry on the original dictionary page scan.
āmardakam. Name of kālabhairava-. View this entry on the original dictionary page scan.
āmardakatirthanātham. Name (also title or epithet) of a śaiva- ascetic, View this entry on the original dictionary page scan.
amaruśatakan. the hundred verses of amaru-.
amastakamfn. headless. View this entry on the original dictionary page scan.
amātāputrādhyāpakam. amātāputra
amatipūrvakamfn. unconscious, unintentional. View this entry on the original dictionary page scan.
amatrakan. a drinking vessel, vessel View this entry on the original dictionary page scan.
amāvāsyakamfn. (equals -vāsya-) born in an amā-vāsy/ā- night View this entry on the original dictionary page scan.
ambakan. śiva-'s eye (see try-ambaka-) View this entry on the original dictionary page scan.
ambakan. an eye View this entry on the original dictionary page scan.
ambakan. copper View this entry on the original dictionary page scan.
ambakam. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
ambarakhaṇḍam. n. a rag (and"a cloud"), View this entry on the original dictionary page scan.
āmbarīṣaputrakamfn. belonging to or inhabited by the ambarīṣa-putra-s, (gaRa rājanyādi- ) View this entry on the original dictionary page scan.
ambaṣṭhakīf. Clypea Hernandifolia View this entry on the original dictionary page scan.
ambhojakhaṇḍan. a group of lotus flowers View this entry on the original dictionary page scan.
ambubhakṣyamfn. subsisting on water, View this entry on the original dictionary page scan.
ambudhakāminīf. "ocean-lover", a river, View this entry on the original dictionary page scan.
ambukaṇṭaka m. the short-nosed alligator View this entry on the original dictionary page scan.
ambupakṣinm. aquatic bird View this entry on the original dictionary page scan.
amedhyakuṇapāśinmfn. feeding on carrion. View this entry on the original dictionary page scan.
āmeṣṭakamfn. made of raw bricks, . View this entry on the original dictionary page scan.
amilātaka equals a-malataka- q.v View this entry on the original dictionary page scan.
amīmāṃsakamfn. uncritical, View this entry on the original dictionary page scan.
amitakratu(/amita--) mfn. of unbounded energy View this entry on the original dictionary page scan.
amitrakarmann. an unfriendly act, View this entry on the original dictionary page scan.
amitrakarṣaṇa(), mfn. harassing enemies. View this entry on the original dictionary page scan.
amitrakarṣin(), mfn. harassing enemies. View this entry on the original dictionary page scan.
amitrakhādamfn. "devouring his enemies", Name of indra- View this entry on the original dictionary page scan.
amlakam. the plant Artocarpus Lakuca View this entry on the original dictionary page scan.
amlakāṇḍan. Name of a plant. View this entry on the original dictionary page scan.
amlakavaṭakam. a sort of cake View this entry on the original dictionary page scan.
amlakeśaram. citron tree. View this entry on the original dictionary page scan.
amlanāyakam. sorrel. View this entry on the original dictionary page scan.
amlapañcaka n. a collection of five kinds of sour vegetables and fruits. View this entry on the original dictionary page scan.
amlatiktakaṣāyamfn. astringent (and) bitter (and) sour View this entry on the original dictionary page scan.
amlatiktakaṣāyam. astringent (and) sour (and) bitter taste, View this entry on the original dictionary page scan.
amlavāṭakam. hog-plum (Spondias Magnifera). View this entry on the original dictionary page scan.
amoghakiraṇan. plural "the unerring rays"Name of the rays, immediately after sunrise and before sunset View this entry on the original dictionary page scan.
amotāputrakam. a child protected at home [a weaver's boy ] View this entry on the original dictionary page scan.
āmragandhakam. Name of a plant View this entry on the original dictionary page scan.
āmrakavim. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
āmrakūṭam. Name of a mountain View this entry on the original dictionary page scan.
āmraphalaprapānakan. a cooling drink made of mangoes, View this entry on the original dictionary page scan.
amrātakam. equals āmrāt- q.v View this entry on the original dictionary page scan.
āmrātakam. the hog-plum, Spondias Mangifera View this entry on the original dictionary page scan.
āmrātakam. inspissated mango juice View this entry on the original dictionary page scan.
āmrātakam. Name of a mountain View this entry on the original dictionary page scan.
āmrātakeśvaran. Name of a liṅga-. View this entry on the original dictionary page scan.
āmrātakīf. a kind of climbing plant View this entry on the original dictionary page scan.
āmravāṭaka m. the hog-plum, Spondias Mangifera View this entry on the original dictionary page scan.
āmreḍitayamakan. a yamaka- (in which every pāda- ends with a word repeated twice). View this entry on the original dictionary page scan.
amṛtaharītakīf. Name of a medicament. View this entry on the original dictionary page scan.
amṛtakan. the nectar of immortality. View this entry on the original dictionary page scan.
amṛtakara m. "nectar-rayed", the moon View this entry on the original dictionary page scan.
amṛtakeśavam. Name of a temple (built by amṛtaprabhā-) View this entry on the original dictionary page scan.
amṛtakiraṇam. "nectar-rayed", the moon View this entry on the original dictionary page scan.
amṛtakṣāran. sal ammoniac View this entry on the original dictionary page scan.
amṛtakuṇḍan. the vessel containing the amṛta- or nectar. View this entry on the original dictionary page scan.
amṛtapakṣam. the immortal wing (of sacrificial fire) View this entry on the original dictionary page scan.
amṛtapakṣamfn. (equals h/iraṇya-pakṣa- q.v) having golden wings View this entry on the original dictionary page scan.
amṛteṣṭakāf. a burnt or baked (and therefore imperishable) brick (used for the sacrificial altar) View this entry on the original dictionary page scan.
aṃśakamf(ikā-)n. (in fine compositi or 'at the end of a compound') forming part. View this entry on the original dictionary page scan.
aṃśakam. a share View this entry on the original dictionary page scan.
aṃśakam. degree of latitude or longitude View this entry on the original dictionary page scan.
aṃśakam. a co-heir View this entry on the original dictionary page scan.
aṃśakan. a day View this entry on the original dictionary page scan.
aṃśakalpanāf. allotment of a portion. View this entry on the original dictionary page scan.
aṃśakaraṇan. act of dividing. View this entry on the original dictionary page scan.
aṃsakūṭam. the shoulder View this entry on the original dictionary page scan.
aṃsakūṭam. a bull's hump, the protuberance between an ox's shoulders. View this entry on the original dictionary page scan.
aṃsaphalakan. shoulder-blade View this entry on the original dictionary page scan.
aṃśaprakalpanāf. allotment of a portion. View this entry on the original dictionary page scan.
aṃsatrakośamfn. having a cask for its tunic (probably = a soma- filter ) View this entry on the original dictionary page scan.
aṃśūdakan. water which has been exposed to the rays of the sun or the moon View this entry on the original dictionary page scan.
amuṣyakulamfn. belonging to the family of such a one, (gaṇa-s pratijanādi-and manojñādi- q.v) View this entry on the original dictionary page scan.
āmuṣyakulikāf. (fr. amuṣya-kula-), the being of that family View this entry on the original dictionary page scan.
amyakind. "towards, here" ( and on ), but See myakṣ-. View this entry on the original dictionary page scan.
āmyakP. (perfect tense -mimikṣ/us-) to be contained or possessed by (locative case) View this entry on the original dictionary page scan.
anabhilakṣitam. "destitute of (right) marks or symbols", an impostor. View this entry on the original dictionary page scan.
anabhivyaktamfn. indistinct. View this entry on the original dictionary page scan.
anabhrakam. plural "cloudless", Name of a class of divinities View this entry on the original dictionary page scan.
anādeśakaramfn. doing what is not commanded or not allowed View this entry on the original dictionary page scan.
anadhyakṣamfn. not perceptible by the senses, not observable View this entry on the original dictionary page scan.
anadhyakṣamfn. without a superintendent. View this entry on the original dictionary page scan.
ānaḍuhakamfn. coming from or belonging to a bull ([ ]) gaRa kulālādi- () . View this entry on the original dictionary page scan.
anaiḍakamf(ī-)n. not coming from the animal called eḍaka-, View this entry on the original dictionary page scan.
anajakāor an-ajikā- f. a miserable little goat View this entry on the original dictionary page scan.
anājñaptakārinmfn. doing what has not been commanded. View this entry on the original dictionary page scan.
āṇakamfn. equals aṇ- q.v View this entry on the original dictionary page scan.
ānakam. (etymology doubtful) , a large military drum beaten at one end View this entry on the original dictionary page scan.
ānakam. a double drum View this entry on the original dictionary page scan.
ānakam. a small drum or tabor View this entry on the original dictionary page scan.
ānakam. a thunder-cloud or a cloud to which the thunder is ascribed View this entry on the original dictionary page scan.
ānakamfn. energetic View this entry on the original dictionary page scan.
aṇakamfn. insignificant, small, contemptible, (gaRa utkarādi- q.v) View this entry on the original dictionary page scan.
anakamfn. (for aṇaka-) inferior (confer, compare rājā- naka-). View this entry on the original dictionary page scan.
anakadundubham. Name of kṛṣṇa-'s grandfather. View this entry on the original dictionary page scan.
ānakadundubhim. equals anaka- q.v View this entry on the original dictionary page scan.
ānakadundubhim. or f(ī-). a large drum beaten at one end, a kettle-drum View this entry on the original dictionary page scan.
ānakadundubhim. Name (also title or epithet) of viṣṇu-, View this entry on the original dictionary page scan.
anakadundubhior better View this entry on the original dictionary page scan.
ānakadundubhim. Name of kṛṣṇa-'s father (vasudeva-;said to be derived from the beating of drums at his birth). View this entry on the original dictionary page scan.
anakāmamāramfn. not killing undesiredly View this entry on the original dictionary page scan.
anakasmātind. not without a cause or an object View this entry on the original dictionary page scan.
anakasmātind. not accidentally, not suddenly. View this entry on the original dictionary page scan.
ānakasthalakamfn. belonging to ānaka-sthalī-. View this entry on the original dictionary page scan.
ānakasthalīf. Name of a country. View this entry on the original dictionary page scan.
ānakāyani gaRa karṇādi- () . View this entry on the original dictionary page scan.
aṇakīyamfn. connected with what is insignificant, etc. View this entry on the original dictionary page scan.
ānakto approach, obtain, reach, present View this entry on the original dictionary page scan.
anak(nom. an-/ak-) mfn. blind View this entry on the original dictionary page scan.
anakṣamf(-)n. idem or '(nom. an-/ak-) mfn. blind ' View this entry on the original dictionary page scan.
anakṣaramfn. unfit to be uttered View this entry on the original dictionary page scan.
anakṣaramfn. unable to articulate a syllable. View this entry on the original dictionary page scan.
anakṣasaṅgam([ ]) or /an-akṣa-stambham- ([ ]) ind. so as not to interfere with the axle-tree. View this entry on the original dictionary page scan.
anakṣin. a bad eye
anakṣikamfn. eyeless View this entry on the original dictionary page scan.
anakṣitamfn. unmarked (see akṣ-), View this entry on the original dictionary page scan.
analasakham. "fire's friend", the wind, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
anāmakamfn. nameless, infamous View this entry on the original dictionary page scan.
anāmakam. the intercalary month View this entry on the original dictionary page scan.
anāmakan. piles, haemorrhoids. View this entry on the original dictionary page scan.
ānandakamf(ā-)n. gladdening, rejoicing View this entry on the original dictionary page scan.
ānandakan. Name of a lake. View this entry on the original dictionary page scan.
ānandakalikāf. Name of work View this entry on the original dictionary page scan.
ānandakānanamāhātmyan. Name of a section of the vāyu-purāṇa-. View this entry on the original dictionary page scan.
ānandakandam. "the root of joy", Name of an author View this entry on the original dictionary page scan.
ānandakandam. of a medical work View this entry on the original dictionary page scan.
ānandakandam. of a country. View this entry on the original dictionary page scan.
ānandakaramfn. exhilarating, delighting.
ānandakāvyan. Name of work View this entry on the original dictionary page scan.
ānandakośam. Name of a play. View this entry on the original dictionary page scan.
ānandamayakoṣam. the innermost case of the body, the causal frame enshrining the soul. View this entry on the original dictionary page scan.
anaṅgakam. the mind View this entry on the original dictionary page scan.
anaṅgakrīḍāf. amorous play View this entry on the original dictionary page scan.
anaṅgakrīḍāf. Name of a metre (of two verses, the first containing sixteen long syllables, the second thirty-two short ones). View this entry on the original dictionary page scan.
anantakamfn. endless, boundless, eternal, infinite View this entry on the original dictionary page scan.
anantakan. the infinite (id est infinite space) . View this entry on the original dictionary page scan.
anantakaramfn. rendering endless, magnifying indefinitely View this entry on the original dictionary page scan.
anāntarīyakamfn. immediate, , Scholiast or Commentator View this entry on the original dictionary page scan.
anantaśaktimfn. omnipotent View this entry on the original dictionary page scan.
anantaśaktim. Name of a king. View this entry on the original dictionary page scan.
anantatīrthakṛtm. = anantajit-. View this entry on the original dictionary page scan.
ananubhāvakamfn. unable to comprehend. View this entry on the original dictionary page scan.
ananubhāvakatāf. non-comprehension View this entry on the original dictionary page scan.
ananubhāvakatāf. unintelligibility. View this entry on the original dictionary page scan.
ananvābhaktamfn. ( bhaj-), not receiving a share, not interested in (locative case) View this entry on the original dictionary page scan.
ananyakāryamfn. having no other business, View this entry on the original dictionary page scan.
anapakāram. harmlessness. View this entry on the original dictionary page scan.
anapakaraṇan. (in law) non-payment, non-delivery. View this entry on the original dictionary page scan.
anapakārinmfn. not harming, innocuous. View this entry on the original dictionary page scan.
anapakarmann. idem or 'n. (in law) non-payment, non-delivery.' View this entry on the original dictionary page scan.
anapakarṣam. ( kṛṣ-) non-degradation, superiority. View this entry on the original dictionary page scan.
anapakramam. not going away. View this entry on the original dictionary page scan.
anapakrāmam. not retreating or withdrawing from View this entry on the original dictionary page scan.
anapakraminmfn. not departing from View this entry on the original dictionary page scan.
anapakraminmfn. devoted, attached to. View this entry on the original dictionary page scan.
anapakrāmukamf(-)n. not running away View this entry on the original dictionary page scan.
anapakriyāf. equals an-apakaraṇa- View this entry on the original dictionary page scan.
anapakṛtamfn. unharmed View this entry on the original dictionary page scan.
anapakṛtan. no offence View this entry on the original dictionary page scan.
anapakṣepyamfn. not to be rejected, View this entry on the original dictionary page scan.
anapatyakamfn. childless. View this entry on the original dictionary page scan.
anapuṃsakan. (in grammar) not a neuter. View this entry on the original dictionary page scan.
anapuṃsakan. not neuter, View this entry on the original dictionary page scan.
anārogyakaramfn. unwholesome, unhealthy, causing sickness. View this entry on the original dictionary page scan.
ānartakamfn. dancing towards View this entry on the original dictionary page scan.
ānartakamfn. belonging to the inhabitants of ānarta-, (gaRa dhūmādi- ) View this entry on the original dictionary page scan.
anarthakamfn. useless, vain, worthless View this entry on the original dictionary page scan.
anarthakamfn. meaningless, nonsensical. View this entry on the original dictionary page scan.
anarthakāmamfn. wishing evil to (genitive case), View this entry on the original dictionary page scan.
anarthakaramfn. doing what is useless or worthless View this entry on the original dictionary page scan.
anarthakaramfn. unprofitable View this entry on the original dictionary page scan.
anarthakaramfn. producing evil or misfortune. View this entry on the original dictionary page scan.
ānarthakyan. (fr. an-arthaka-), uselessness, unprofitableness etc. View this entry on the original dictionary page scan.
ānarthakyan. unfitness, impropriety View this entry on the original dictionary page scan.
anāryakan. Agallochum or Aloe wood (Aquila Agallocha). View this entry on the original dictionary page scan.
anāryakarminm. doing work unbecoming an ārya- or becoming only a non- ārya-. View this entry on the original dictionary page scan.
anāśakan. fasting, abstaining from food even to death. View this entry on the original dictionary page scan.
anāśakanivṛttam. one who has abandoned the practice of fasting. View this entry on the original dictionary page scan.
anāśakāyanan. a course of fasting (as a penance) View this entry on the original dictionary page scan.
anāśakinm. "not eating", an ascetic, View this entry on the original dictionary page scan.
anāsravaprakāramfn. free from the various kinds of mundane inclinations, . View this entry on the original dictionary page scan.
anasūyaka mfn. not spiteful or envious. View this entry on the original dictionary page scan.
anātmakamfn. unreal View this entry on the original dictionary page scan.
anavakāśamf(ā-)n. having no opportunity or occasion View this entry on the original dictionary page scan.
anavakāśamf(ā-)n. uncalled for, inapplicable View this entry on the original dictionary page scan.
anavakrāmamind. not stepping upon View this entry on the original dictionary page scan.
anāyakamf(ā-)n. having no leader or ruler, disorderly. View this entry on the original dictionary page scan.
anāyāsakṛtamfn. done readily or easily View this entry on the original dictionary page scan.
anāyāsakṛtan. (in med.) an infusion prepared extemporaneously. View this entry on the original dictionary page scan.
aṇḍakam. the scrotum View this entry on the original dictionary page scan.
aṇḍakan. an egg.
āṇḍakapālan. an egg-shell View this entry on the original dictionary page scan.
aṇḍakaṭāham. the shell of the mundane egg View this entry on the original dictionary page scan.
āṇḍakośam. an egg View this entry on the original dictionary page scan.
āṇḍakośamfn. enclosed in an egg, View this entry on the original dictionary page scan.
aṇḍakośa m. the scrotum View this entry on the original dictionary page scan.
aṇḍakośam. the mundane egg. View this entry on the original dictionary page scan.
aṇḍakoṣa m. the scrotum View this entry on the original dictionary page scan.
aṇḍakoṣam. the mundane egg. View this entry on the original dictionary page scan.
aṇḍakoṣakam. the scrotum View this entry on the original dictionary page scan.
aṇḍakoṣakam. the mundane egg. View this entry on the original dictionary page scan.
aṇḍakoṭarapuṣpīf. the plant Convolvulus Argenteus (?). View this entry on the original dictionary page scan.
andhacaṭakanyāyam. the rule of the blind man catching a sparrow (confer, compare ghuṇā- kṣara-- ny-), View this entry on the original dictionary page scan.
andhakamfn. blind View this entry on the original dictionary page scan.
andhakam. Name of an asura- (son of kaśyapa- and diti-) View this entry on the original dictionary page scan.
andhakam. of a descendant of yadu- and ancestor of kṛṣṇa- and his descendants View this entry on the original dictionary page scan.
andhakam. Name of a muni-. View this entry on the original dictionary page scan.
andhakaghātin m. "the slayer or enemy of the asura- andhaka-", Name of śiva-. View this entry on the original dictionary page scan.
andhakālam. a particular hell, View this entry on the original dictionary page scan.
andhakāntakam. Name (also title or epithet) of śiva-, View this entry on the original dictionary page scan.
andhakāram. n. darkness. View this entry on the original dictionary page scan.
andhakāramayamfn. dark. View this entry on the original dictionary page scan.
andhakārasaṃcayam. intensity of darkness. View this entry on the original dictionary page scan.
andhakāri m. "enemy of the asura- andhaka-", Name of śiva-. View this entry on the original dictionary page scan.
andhakārinmfn. dark, View this entry on the original dictionary page scan.
andhakaripum. "the slayer or enemy of the asura- andhaka-", Name of śiva-. View this entry on the original dictionary page scan.
andhakāritamfn. made dark, dark (see gaRa tārakādi-.) View this entry on the original dictionary page scan.
andhakāsuhṛdm. "enemy of the asura- andhaka-", Name of śiva-. View this entry on the original dictionary page scan.
andhakavartam. Name of a mountain View this entry on the original dictionary page scan.
andhakavṛṣṇim. plural descendants of andhaka- and vṛṣṇi-. View this entry on the original dictionary page scan.
andhakīf. the south-west quarter, View this entry on the original dictionary page scan.
andhakūpam. a well of which the mouth is hidden View this entry on the original dictionary page scan.
andhakūpam. a well over-grown with plants, etc. View this entry on the original dictionary page scan.
andhakūpam. a particular hell. View this entry on the original dictionary page scan.
āndolakam. a see-saw, swing. View this entry on the original dictionary page scan.
andraka equals ārdraka- q.v View this entry on the original dictionary page scan.
anekadharmakathāf. different exposition of the law. View this entry on the original dictionary page scan.
anekakālamind. a long time, for a long time. View this entry on the original dictionary page scan.
anekakālāvadhiind. long since. View this entry on the original dictionary page scan.
anekakāma(/aneka--) mfn. having many wishes View this entry on the original dictionary page scan.
anekakṛtm. "doing much", Name of śiva-. View this entry on the original dictionary page scan.
aṅgakan. a limb, member, body View this entry on the original dictionary page scan.
āṅgakamfn. relating to the country aṅga- etc. commentator or commentary on View this entry on the original dictionary page scan.
aṅgakarmann. a supplementary sacrificial act. View this entry on the original dictionary page scan.
aṅgakartanan. cutting off a limb. View this entry on the original dictionary page scan.
aṅgakaṣāyam. the essence of the body (said of, the semen virile) View this entry on the original dictionary page scan.
aṅgakriyāf. a supplementary sacrificial act. View this entry on the original dictionary page scan.
aṅgakriyāf. anointing the body, View this entry on the original dictionary page scan.
aṅgamardaka m. a servant who shampoos his master's body View this entry on the original dictionary page scan.
aṅgārakam. charcoal View this entry on the original dictionary page scan.
aṅgārakam. heated charcoal View this entry on the original dictionary page scan.
aṅgārakam. the planet Mars View this entry on the original dictionary page scan.
aṅgārakam. Tuesday View this entry on the original dictionary page scan.
aṅgārakam. Name of a prince of sauvīra- View this entry on the original dictionary page scan.
aṅgārakam. of a rudra- View this entry on the original dictionary page scan.
aṅgārakam. of an asura- View this entry on the original dictionary page scan.
aṅgārakam. Name of two plants, Eclipta (or Verbesina) Prostrata, and white or yellow Amaranth View this entry on the original dictionary page scan.
aṅgārakan. a medicated oil in which turmeric and other vegetable substances have been boiled. View this entry on the original dictionary page scan.
aṅgārakadinam. n. a festival of Mars on the fourteenth of the latter half of caitra-. View this entry on the original dictionary page scan.
aṅgārakamaṇim. coral (amber). View this entry on the original dictionary page scan.
aṅgārakārin ([Hpar.]) m. charcoal-burner. View this entry on the original dictionary page scan.
aṅgārakarmāntam. charcoal-burning, View this entry on the original dictionary page scan.
aṅgārakavāram. Tuesday. View this entry on the original dictionary page scan.
aṅgārakayantra(or bhauma-- y-), n. a kind of auspicious diagram, View this entry on the original dictionary page scan.
aṅgārakitamfn. charred, roasted, burnt, (gaRa tārakādi- q.v) View this entry on the original dictionary page scan.
aṅgārakṛt([Hpar.]) m. charcoal-burner. View this entry on the original dictionary page scan.
aṅgarakṣaṇī f. "body protector", a coat of mail View this entry on the original dictionary page scan.
aṅgarakṣiṇīf. "body protector", a coat of mail View this entry on the original dictionary page scan.
aṅgaraktam. the plant guṇḍārocanī-. View this entry on the original dictionary page scan.
aṅgārakuṣṭhakam. the plant hitāvalī-. View this entry on the original dictionary page scan.
aṅgāraśakaṭif. a portable fire-receptacle, View this entry on the original dictionary page scan.
aṅgāraśakaṭīf. a portable fire-place on wheels. View this entry on the original dictionary page scan.
aṅgārāvakṣayaṇan. an instrument for extinguishing coals View this entry on the original dictionary page scan.
aṅgārāvakṣepaṇan. an instrument for putting on coals, tongs, View this entry on the original dictionary page scan.
aṅgavāhakamfn. rubbing or shampooing the body, View this entry on the original dictionary page scan.
aṅghrināmakam. a synonym of aṅghri-, means always foot as well as root. View this entry on the original dictionary page scan.
aṅgulaka in fine compositi or 'at the end of a compound' equals aṅgula- id est so many aṅgula-s or fingers longitude View this entry on the original dictionary page scan.
aṅgulīpañcakan. the five fingers. View this entry on the original dictionary page scan.
aṅguliveṣṭakam. a glove (?). View this entry on the original dictionary page scan.
aṅgulīyakan. a finger-ring View this entry on the original dictionary page scan.
aṅgulīyakan. also aṅgulīka- View this entry on the original dictionary page scan.
aṅgurīyakamn. a finger-ring. View this entry on the original dictionary page scan.
aṅguṣṭhamātrakamf(ikā-)n. having the length or size of a thumb. View this entry on the original dictionary page scan.
aṅguṣṭhavibhedakam. "thumb-separator", a mitten, View this entry on the original dictionary page scan.
anijakamfn. not one's own, belonging to another. View this entry on the original dictionary page scan.
anīkṣakamfn. not seeing, blind, View this entry on the original dictionary page scan.
anilaghnakam. the large tree Terminalia Belerica. View this entry on the original dictionary page scan.
anilakumāram. plural "wind-princes", a class of deities
anilāntakam. "wind destroying", the plant iṅgudī- or aṅgāra-puṣpa-. View this entry on the original dictionary page scan.
anilaprakṛtimfn. "having an airy or windy nature", Name of the planet Saturn. View this entry on the original dictionary page scan.
anilasakha ([ ]) m. "the friend of wind"Name of fire. View this entry on the original dictionary page scan.
aniṣṭakamfn. without bricks, View this entry on the original dictionary page scan.
aniṣṭasūcakamfn. foreboding evil, ominous. View this entry on the original dictionary page scan.
anityadattaka m. a son surrendered by his parents to another for temporary or preliminary adoption. View this entry on the original dictionary page scan.
anityakarmann. an occasional act of worship, sacrifice for a special purpose. View this entry on the original dictionary page scan.
anityakriyāf. an occasional act of worship, sacrifice for a special purpose. View this entry on the original dictionary page scan.
anityasamaprakaraṇan. a section in the nyāya- discussing that sophism. View this entry on the original dictionary page scan.
añjakam. Name of a son of vipracitti- View this entry on the original dictionary page scan.
añjanakam. portion of a text containing the word añjana-, (gaRa goṣad-ādi- q.v) View this entry on the original dictionary page scan.
añjanakeśamf(ī-)n. whose hair (or mane) is as black as pigment View this entry on the original dictionary page scan.
añjanakeśīf. Name of a vegetable perfume. View this entry on the original dictionary page scan.
añjanakīf. Name of a medicinal plant. View this entry on the original dictionary page scan.
āñjīkūlakamfn. (varia lectio ājīk-) View this entry on the original dictionary page scan.
añjisakthamfn. having coloured thighs (a victim) View this entry on the original dictionary page scan.
añjisakthamfn. see View this entry on the original dictionary page scan.
aṅkakāram. a champion chosen by each side to decide a battle
aṅkakāram. aṅkakārī-kṛ-, to choose such a champion View this entry on the original dictionary page scan.
aṅkakaraṇan. the act of marking or stamping. View this entry on the original dictionary page scan.
aṅkalakṣaṇan. a mark, brand, View this entry on the original dictionary page scan.
aṅkolaka aṅkoṭha-, aṅkola-, aṅkolla-, aṅkoṭa- m. the plant Alangium Hexapetalum. View this entry on the original dictionary page scan.
aṅkuḍakam. a key View this entry on the original dictionary page scan.
aṅkurakam. a nest View this entry on the original dictionary page scan.
annabhakṣam. eating of food. View this entry on the original dictionary page scan.
annabhakṣaiṇan. eating of food. View this entry on the original dictionary page scan.
annādyakāmamfn. desirous of food. View this entry on the original dictionary page scan.
annakālam. meal-time, proper hour for eating View this entry on the original dictionary page scan.
annakālam. time at which a convalescent patient begins to take food View this entry on the original dictionary page scan.
annakāma(/anna--) mfn. desirous of food View this entry on the original dictionary page scan.
annakaraṇamfn. preparing food, View this entry on the original dictionary page scan.
annakāśinmfn. (?) yearning for food, View this entry on the original dictionary page scan.
annakoṣṭhakam. cupboard, granary View this entry on the original dictionary page scan.
annakoṣṭhakam. viṣṇu-, the sun View this entry on the original dictionary page scan.
annamayakośam. the gross material body (which is sustained by food equals sthūla-śarīra-). View this entry on the original dictionary page scan.
annarakṣāf. caution in eating food. View this entry on the original dictionary page scan.
ānṛtakamfn. belonging to or occupied by liars View this entry on the original dictionary page scan.
anṛtakathamfn. telling untruths, View this entry on the original dictionary page scan.
anṛtātmakamf(ikā-)n. of faithless disposition, View this entry on the original dictionary page scan.
antadīpakan. a figure in rhetoric. View this entry on the original dictionary page scan.
antadīpakan. a particular rhetorical figure (exempli gratia, 'for example' ) View this entry on the original dictionary page scan.
antaḥprakṛtif. the heart, the soul, the internal nature or constitution of a man. View this entry on the original dictionary page scan.
antaḥpurādhyakṣam. superintendent of the women's apartments, chamberlain. View this entry on the original dictionary page scan.
antaḥpurarakaka m. superintendent of the women's apartments, chamberlain. View this entry on the original dictionary page scan.
antakam. border, boundary View this entry on the original dictionary page scan.
antakamfn. making an end, causing death View this entry on the original dictionary page scan.
antakam. death View this entry on the original dictionary page scan.
antakam. yama-, king or lord of death etc. View this entry on the original dictionary page scan.
antakam. Name of a man favoured by the aśvin-s Name of a king. View this entry on the original dictionary page scan.
antakadruh Nominal verb -dhr/uk- f. demon of death View this entry on the original dictionary page scan.
antakālam. time of death, death. View this entry on the original dictionary page scan.
antakāmanan. the jaws of Death, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
antakapuran. the city or dwelling of Death (accusative with Causal of gam-,"to kill"), View this entry on the original dictionary page scan.
antakaramfn. causing death, mortal, destructive. View this entry on the original dictionary page scan.
antakaraṇamfn. causing death, mortal, destructive. View this entry on the original dictionary page scan.
antakaraṇan. causing an end of, abolishing (compound), View this entry on the original dictionary page scan.
antakārinmfn. causing death, mortal, destructive. View this entry on the original dictionary page scan.
antakarmanmfn. (= anta-- kara-), ibidem or 'in the same place or book or text' as the preceding iii, 59 View this entry on the original dictionary page scan.
antakṛddaśāf. plural Name of the eighth of the twelve sacred aṅga- texts of the jaina-s (containing ten chapters). View this entry on the original dictionary page scan.
antakṛtmfn. making an end View this entry on the original dictionary page scan.
antakṛtm. (t-) death. View this entry on the original dictionary page scan.
antarābhaktan. medicine taken between two meals, View this entry on the original dictionary page scan.
antaracakran. the whole of the thirty-two intermediate regions of the compass View this entry on the original dictionary page scan.
antaracakran. a technical term in augury. View this entry on the original dictionary page scan.
antarakośam. an interior case or sheath View this entry on the original dictionary page scan.
antarālakan. ([ ]) intermediate space View this entry on the original dictionary page scan.
antarālakeind. locative case in the midst, in midway (āla-is probably for ālaya-). View this entry on the original dictionary page scan.
antarātmakamf(ī-)n. interior View this entry on the original dictionary page scan.
antarātmeṣṭakamind. in the space between one's self and the (sacrificial) bricks View this entry on the original dictionary page scan.
antaravāsakan. the inner garment (of a Buddhist monk), View this entry on the original dictionary page scan.
antardhāyakamf(ikā-)n. rendering invisible. View this entry on the original dictionary page scan.
antarikṣakṣitmfn. dwelling in the atmosphere View this entry on the original dictionary page scan.
āntarīpakamfn. (fr. antar-īpa- gaRa dhūmādi- ,where [in Boehtlingk's edition] antarīpa-is to be read instead of antarīya-), belonging to or being in an island. View this entry on the original dictionary page scan.
antaryakṣa(used in explaining antarikṣa-), View this entry on the original dictionary page scan.
antaścakṣusn. the inner eye, View this entry on the original dictionary page scan.
antrakūjam. rumbling of the bowels. View this entry on the original dictionary page scan.
antrakūjanan. rumbling of the bowels. View this entry on the original dictionary page scan.
antrapācakam. the plant Aeschynomene Grandiflora. View this entry on the original dictionary page scan.
antyakam. a man of the lowest tribe View this entry on the original dictionary page scan.
antyakarmann. funeral rites. View this entry on the original dictionary page scan.
antyakriyāf. funeral rites. View this entry on the original dictionary page scan.
anubandhakamf(ikā-)n. connected, allied View this entry on the original dictionary page scan.
anubandhakamf(ikā-)n. related. View this entry on the original dictionary page scan.
anubhāvakamf(ikā-)n. causing to apprehend, making to understand. View this entry on the original dictionary page scan.
anubhāvakatāf. understanding. View this entry on the original dictionary page scan.
anubhūtiprakāśam. Name of a metrical paraphrase of the twelve principal upaniṣad-s by vidyāraṇya-muni-. View this entry on the original dictionary page scan.
anucak(perf. -cac/akṣa-; imperfect tense A1. -acaṣṭa-) to look at or up to
ānucārakamfn. (fr. anu-cāraka-), belonging to an attendant View this entry on the original dictionary page scan.
anucārakam. a follower, attendant, (gaRa mahiṣy-ādi- q.v) View this entry on the original dictionary page scan.
anudakamf(-)n. waterless View this entry on the original dictionary page scan.
anudakamf(-)n. without adding water View this entry on the original dictionary page scan.
anūdakan. (metri causa for an-udaka-), want of water, aridity View this entry on the original dictionary page scan.
anudakamind. without touching water View this entry on the original dictionary page scan.
anudvegakaramfn. not causing apprehension, not overawing. View this entry on the original dictionary page scan.
anugrāhakamf(ikā-)n. favouring, furthering, facilitating View this entry on the original dictionary page scan.
anugrāhakamf(ikā-)n. favourable, kind, gracious. View this entry on the original dictionary page scan.
anugrahakātaramfn. anxious to please or for favour. View this entry on the original dictionary page scan.
anugrāsakam. a mouthful (of boiled rice, etc.) View this entry on the original dictionary page scan.
anugrāsakam. the equivalent of a mouthful. View this entry on the original dictionary page scan.
anuhārakamf(ikā-)n. imitating. View this entry on the original dictionary page scan.
anujñāpakam. one who commands or enjoins. View this entry on the original dictionary page scan.
anukāmakṛtmfn. fulfilling one's desire View this entry on the original dictionary page scan.
anukampakam. "sympathizer", Name of a king View this entry on the original dictionary page scan.
anukampakamfn. in fine compositi or 'at the end of a compound' sympathizing with, compassionating. View this entry on the original dictionary page scan.
anukanakhalamind. over kanakhala-, View this entry on the original dictionary page scan.
anukrakacamfn. dentated like a saw, serrated. View this entry on the original dictionary page scan.
anukūlanāyakam. a kind husband or lover. View this entry on the original dictionary page scan.
anulakṣya ind.p. conforming to. View this entry on the original dictionary page scan.
anulepakamfn. anointing the body with unguents View this entry on the original dictionary page scan.
anulomakalpam. the thirty-fourth of the atharva-pariśiṣṭa-s. View this entry on the original dictionary page scan.
anulomakṛṣṭamfn. ploughed in the regular direction (with the grain). View this entry on the original dictionary page scan.
anumānakhaṇḍan. works on anumāna-. View this entry on the original dictionary page scan.
anumānaprakāśam. works on anumāna-. View this entry on the original dictionary page scan.
anumāpakamf(ikā-)n. causing an inference (as an effect). View this entry on the original dictionary page scan.
anumatakarmakārinmfn. doing what is allowed. acting according to an agreement. View this entry on the original dictionary page scan.
anumodakamf(ikā-)n. assenting, showing sympathetic joy. View this entry on the original dictionary page scan.
anūnaka([ ]) mfn. not less, not inferior to (ablative) View this entry on the original dictionary page scan.
anunāyakamf(ikā-)n. submissive, humble. View this entry on the original dictionary page scan.
anupahatakarṇendriyatāf. having the organ of hearing uninjured (one of the 80 minor marks 0f a buddha-), . View this entry on the original dictionary page scan.
anupahatakruṣṭamfn. whose organs of hearing are unimpaired View this entry on the original dictionary page scan.
ānūpakamfn. living in marshy places View this entry on the original dictionary page scan.
anupakārinmfn. not assisting, disobliging, ungrateful, not making a return for benefits received View this entry on the original dictionary page scan.
anupakārinmfn. unserviceable, useless. View this entry on the original dictionary page scan.
anupakiñcamfn. "having nothing defective", not hoarse, not faltering (voice), View this entry on the original dictionary page scan.
anupakṛtamfn. unassisted. View this entry on the original dictionary page scan.
anupakṣitamfn. uninjured, undecaying View this entry on the original dictionary page scan.
anupalakṣitamfn. untraced, unperceived, unmarked, indiscriminated. View this entry on the original dictionary page scan.
anupalakṣyamfn. not to be traced, imperceptible. View this entry on the original dictionary page scan.
anupalakṣyavartmanmfn. having ways that cannot be traced. View this entry on the original dictionary page scan.
anupapādakam. plural "having no material parent", Name of a class of buddha-s, called dhyānibuddha-s. View this entry on the original dictionary page scan.
anupātakan. a crime similar to a mahāpātaka- q.v (falsehood, fraud, theft, adultery, etc.) View this entry on the original dictionary page scan.
anuprakampCaus. (Potential -kampayet-,3. plural yeyur-) to follow in shaking or agitating View this entry on the original dictionary page scan.
anuprasaktamfn. strongly attached View this entry on the original dictionary page scan.
anuprasaktif. close connection with. View this entry on the original dictionary page scan.
anuprasarpakacreeping after (, Scholiast or Commentator) View this entry on the original dictionary page scan.
anupūrvakeśamfn. having regular hair, regularly shaped limbs, regular teeth, a regularly shaped navel, regular lines in the hands (all these are epithets given to buddha-, some of them also to mahāvīra-) and View this entry on the original dictionary page scan.
anurakto guard while following ; to guard, take care of. View this entry on the original dictionary page scan.
anurakṣaṇan. the act of guarding. View this entry on the original dictionary page scan.
anuraktamfn. fond of, attached, pleased View this entry on the original dictionary page scan.
anuraktamfn. beloved. View this entry on the original dictionary page scan.
anuraktalokam. a person to whom every one is attached. View this entry on the original dictionary page scan.
anuraktaprajamfn. beloved by his subjects. View this entry on the original dictionary page scan.
ānuraktif. (equals anu-rakti- q.v), passion, affection View this entry on the original dictionary page scan.
anuraktif. affection, love, devotion. View this entry on the original dictionary page scan.
anurañjakamf(ikā-)n. attaching, conciliating. View this entry on the original dictionary page scan.
ānuṣakind. (fr. anu-sañj-[ gaṇa- svarādi-]), in continuous order, uninterruptedly, one after the other (see anuṣak-). View this entry on the original dictionary page scan.
ānuṣak(according to to some also,"regularly","thoroughly"), View this entry on the original dictionary page scan.
anuśakto be able to imitate or come up with : Desiderative Causal P. -śikṣayati-, to teach, instruct. View this entry on the original dictionary page scan.
anuṣakind. in continuous order, one after the other, (gaRa svar-ādi- q.v) View this entry on the original dictionary page scan.
anuṣakind. see ānuṣ/ak-. View this entry on the original dictionary page scan.
anuṣaktamfn. closely connected with, supplied from something preceding. View this entry on the original dictionary page scan.
anusakthamind. along the thigh, View this entry on the original dictionary page scan.
anuṣaktif. clinging to, adherence, View this entry on the original dictionary page scan.
anusaṃraktamfn. attached or devoted to. View this entry on the original dictionary page scan.
anusāraka mfn. following, attendant on, according or conformable to View this entry on the original dictionary page scan.
anusārakamfn. penetrating, scrutinizing, investigating. View this entry on the original dictionary page scan.
anusāryakan. a fragrant substance. View this entry on the original dictionary page scan.
anuśāsakamfn. one who governs, instructs, directs or punishes. View this entry on the original dictionary page scan.
anuṣṇakamfn. not hot, cold View this entry on the original dictionary page scan.
anuṣṇakamfn. chilly, etc. View this entry on the original dictionary page scan.
anuśocakamfn. grieving, one who repents View this entry on the original dictionary page scan.
anuśocakamfn. occasioning repentance. View this entry on the original dictionary page scan.
anuṣṭhānakramam. the order of performing religious ceremonies. View this entry on the original dictionary page scan.
anuṣṭhānasmārakamf(ikā-)n. reminding of religious ceremonies. View this entry on the original dictionary page scan.
anuṣṭhāpakamf(ikā-)n. causing to perform. View this entry on the original dictionary page scan.
anusūcakamf(ikā-)n. ( sūc-), indicative of, pointing out. View this entry on the original dictionary page scan.
anutak(imperfect tense 2. plural -/atakṣata-) to create or procure for the help of (dative case) View this entry on the original dictionary page scan.
anutāpakamf(ikā-)n. causing repentance, View this entry on the original dictionary page scan.
anutpādakṣāntif. acquiescence in not having to undergo another birth. View this entry on the original dictionary page scan.
anutpattikadharmakṣāntif. acquiescence in the state which is still future, preparation for a future state View this entry on the original dictionary page scan.
anutpattikadharmakṣāntif. (with Buddhists) resignation to consequences which have not yet arisen, (confer, compare ). View this entry on the original dictionary page scan.
anuvādaka mfn. repeating with comment and explanation, corroborative, concurrent, conformable, in harmony with View this entry on the original dictionary page scan.
anuvādakamfn. (the masculine of the last is also the name of any one of the three notes of the gamut.) View this entry on the original dictionary page scan.
anuvakramfn. somewhat crooked or oblique. View this entry on the original dictionary page scan.
anuvakragamfn. having a somewhat oblique course (as a planet, etc.) View this entry on the original dictionary page scan.
anuvaktavyamfn. to be repeated View this entry on the original dictionary page scan.
anuvaktṛmfn. speaking after View this entry on the original dictionary page scan.
anuvaktṛmfn. replying. View this entry on the original dictionary page scan.
anuyogakṛtm. an ācārya- or spiritual teacher. View this entry on the original dictionary page scan.
anvābhaktamfn. entitled to take a share after or with another. View this entry on the original dictionary page scan.
anvācakto name after View this entry on the original dictionary page scan.
anvādeśakamfn. referring to a previous statement View this entry on the original dictionary page scan.
anvādheyaādheyakan. property presented after marriage to the wife by her husband's family View this entry on the original dictionary page scan.
anvāhāryakan. the monthly śrāddha- (q.v) held on the day of new moon (according to it should be of meat eaten after the presentation of a piṇḍa- or ball of rice). View this entry on the original dictionary page scan.
anvakind. afterwards View this entry on the original dictionary page scan.
anvakind. behind (with accusative) View this entry on the original dictionary page scan.
anvākarṣakamfn. attracting from the preceding, View this entry on the original dictionary page scan.
anvākhyāyakamfn. stating exactly or explicitly, View this entry on the original dictionary page scan.
anvakṣamfn. (fr. 4. akṣa-), following View this entry on the original dictionary page scan.
anvakṣamind. afterwards, immediately after see gaRa śarad-ādi- View this entry on the original dictionary page scan.
anvakṣaramind. according to the sound or letter, View this entry on the original dictionary page scan.
anvakṣarasandhim. a kind of saṃdhi- in the veda-s View this entry on the original dictionary page scan.
anvaksthāninmfn. inferior in dignity, View this entry on the original dictionary page scan.
anvaksthānīya mfn. inferior in dignity, View this entry on the original dictionary page scan.
anvapakramto run away after another View this entry on the original dictionary page scan.
anvaṣṭakāf. the ninth day in the latter half of the three (or four) months following the full moon in āgrahāyaṇa-, pauṣa-, māgha- (and phālguna-) View this entry on the original dictionary page scan.
anvaṣṭakyan. a śrāddha- or funeral ceremony performed on the anvaṣṭakā-s. View this entry on the original dictionary page scan.
anvavakiraṇan. scattering about successively View this entry on the original dictionary page scan.
anvavakto despise, refuse View this entry on the original dictionary page scan.
anvavakto scatter or strew about (with instrumental case) View this entry on the original dictionary page scan.
anvavakramto descend or enter in succession View this entry on the original dictionary page scan.
anveṣakamf(ikā-)n. searching, inquiring. View this entry on the original dictionary page scan.
anvīkṣakamf(ikā-)n. careful, anxious, View this entry on the original dictionary page scan.
anyahaka m. brass-metal, View this entry on the original dictionary page scan.
anyakamfn. another, other View this entry on the original dictionary page scan.
anyakāmamfn. loving another. View this entry on the original dictionary page scan.
anyakāramfn. intent on other business, View this entry on the original dictionary page scan.
anyakārukāf. a worm bred in excrement View this entry on the original dictionary page scan.
anyakriya mfn. intent on other business, View this entry on the original dictionary page scan.
anyakṛta(any/a--) mfn. done by another View this entry on the original dictionary page scan.
anyakṣetran. another territory or sphere View this entry on the original dictionary page scan.
anyaliṅgakamfn. having the gender of another (word, viz. of the substantive), an adjective. View this entry on the original dictionary page scan.
anyaśākhakam. a Brahman who has left his school View this entry on the original dictionary page scan.
anyaśākhakam. an apostate View this entry on the original dictionary page scan.
anyāsaktamfn. intent on something else. View this entry on the original dictionary page scan.
anyataḥplakṣāf. Name of a lotus pond in kurukṣetra- View this entry on the original dictionary page scan.
anyathājātīyakamfn. of another kind, View this entry on the original dictionary page scan.
anyatkārakamfn. making mistakes (the neut. form appears to be used in compound when error of any kind is implied;other examples besides the following are given) . View this entry on the original dictionary page scan.
anyatrakaraṇam. the son of a paramour, View this entry on the original dictionary page scan.
anyoktiśatakan. Name (also title or epithet) of work View this entry on the original dictionary page scan.
anyonyakalaham. mutual quarrel. View this entry on the original dictionary page scan.
anyonyakṛtyan. mutual services, View this entry on the original dictionary page scan.
anyonyapakṣanayanan. transposing (of numbers) from one side to another. View this entry on the original dictionary page scan.
apacamānaka(), mfn. one who does not cook for himself. View this entry on the original dictionary page scan.
apacāyakamfn. honouring, View this entry on the original dictionary page scan.
apādakamfn. footless View this entry on the original dictionary page scan.
āpādakamfn. causing, effecting. View this entry on the original dictionary page scan.
apadakṣiṇamind. away from the right, to the left side View this entry on the original dictionary page scan.
apadālakam. the sheat fish, View this entry on the original dictionary page scan.
āpādatalamastakamind. from the sole of the foot to the head, View this entry on the original dictionary page scan.
apagatakālakamfn. (a robe) free from black spots, View this entry on the original dictionary page scan.
apaghātakamf(ikā-)n. (in fine compositi or 'at the end of a compound') warding off. View this entry on the original dictionary page scan.
apahārakamfn. one who takes away, seizes, steals, etc. View this entry on the original dictionary page scan.
apahārakamfn. a plunderer, a thief (see ātmāpahāraka-, vāg apahāraka-.) View this entry on the original dictionary page scan.
apahastakamfn. handless, View this entry on the original dictionary page scan.
āpakamf(ī-)n. one who obtains View this entry on the original dictionary page scan.
apākacakṣas(/apāka--) mfn. shining far For a-pāka-2 See . View this entry on the original dictionary page scan.
apakalaṅkam. a deep stain or mark of disgrace View this entry on the original dictionary page scan.
apakalmaṣamf(ā-)n. stainless, sinless. View this entry on the original dictionary page scan.
apakāmam. aversion, abhorrence View this entry on the original dictionary page scan.
apakāmam. abominableness View this entry on the original dictionary page scan.
apakāmamind. against one's liking, unwillingly
apakaṇṭakamf(ā-)n. free from thorns or dangers, View this entry on the original dictionary page scan.
apakāram. wrong, offence, injury, hurt View this entry on the original dictionary page scan.
apakāram. despise, disdain. View this entry on the original dictionary page scan.
āpakaramf(ī-)n. coming from or native of the (country ?) āpakara- View this entry on the original dictionary page scan.
apakāragir([ ]) f. an offending or menacing speech. View this entry on the original dictionary page scan.
apakāraka mfn. acting wrong, doing ill to (with genitive case) View this entry on the original dictionary page scan.
apakārakamfn. offending, injuring. View this entry on the original dictionary page scan.
apakaraṇan. acting improperly View this entry on the original dictionary page scan.
apakaraṇan. doing wrong View this entry on the original dictionary page scan.
apakaraṇan. ill-treating, offending, injuring View this entry on the original dictionary page scan.
apakārārthinmfn. malicious, malevolent. View this entry on the original dictionary page scan.
apakāraśabda([ ]) m. an offending or menacing speech. View this entry on the original dictionary page scan.
apakāratāf. wrong, offence. View this entry on the original dictionary page scan.
apakārinmfn. acting wrong, doing ill to (with genitive case) View this entry on the original dictionary page scan.
apakārinmfn. offending, injuring. View this entry on the original dictionary page scan.
apakarmann. discharge (of a debt) View this entry on the original dictionary page scan.
apakarmann. evil doing View this entry on the original dictionary page scan.
apakarmann. violence View this entry on the original dictionary page scan.
apakarmann. any impure or degrading act View this entry on the original dictionary page scan.
apakarṣam. drawing or dragging off or down, detraction, diminution, decay View this entry on the original dictionary page scan.
apakarṣam. lowering, depression View this entry on the original dictionary page scan.
apakarṣam. decline, inferiority, infamy View this entry on the original dictionary page scan.
apakarṣam. anticipation View this entry on the original dictionary page scan.
apakarṣam. (in poetry) anticipation of a word occurring later. View this entry on the original dictionary page scan.
apakarṣakamf(ikā-)n. drawing down, detracting (with genitive case) View this entry on the original dictionary page scan.
apakarṣaṇamfn. taking away, forcing away, removing, diminishing View this entry on the original dictionary page scan.
apakarṣaṇan. taking away, depriving of View this entry on the original dictionary page scan.
apakarṣaṇan. drawing down View this entry on the original dictionary page scan.
apakarṣaṇan. abolishing, denying View this entry on the original dictionary page scan.
apakarṣaṇan. anticipation View this entry on the original dictionary page scan.
apakarṣasamamf(ā-) a sophism in the nyāya- (exempli gratia, 'for example'"sound has not the quality of shape as a jar has, therefore sound and a jar have no qualities in common") . View this entry on the original dictionary page scan.
apakarṣinmfn. drawing along (as a plough), View this entry on the original dictionary page scan.
apakartanan. cutting in pieces, dismembering, View this entry on the original dictionary page scan.
apakartṛmfn. injurious, offensive. View this entry on the original dictionary page scan.
apakaruṇamfn. cruel. View this entry on the original dictionary page scan.
apakaṣto scrape off View this entry on the original dictionary page scan.
apakaṣāyamfn. sinless View this entry on the original dictionary page scan.
apakaṣāyamfn. sinless, View this entry on the original dictionary page scan.
apakaṣāyatva(n.) View this entry on the original dictionary page scan.
apakhyātif. disgrace, View this entry on the original dictionary page scan.
apakīrtif. infamy, disgrace. View this entry on the original dictionary page scan.
apakośamfn. unsheathed, View this entry on the original dictionary page scan.
apakto carry away, remove, drag away ; (with genitive case or accusative) to hurt, wrong, injure: Caus. -kārayati-, to hurt, wrong, injure: Caus. -kārayati-, to hurt wrong. View this entry on the original dictionary page scan.
apakA1. apa-s-kirate- () to scrape with the feet ; (see ava-s-kṝ-): P. apa-kirati-, to spout out, spurt, scatter commentator or commentary ; to throw down View this entry on the original dictionary page scan.
apakramto go away, retreat, retire from ; to glide away ; to measure off by steps : Causal -kramayati-, to cause to run away : Desiderative -cikramiṣati-, to intend to run away or escape (with ablative) View this entry on the original dictionary page scan.
apakramam. going away etc. View this entry on the original dictionary page scan.
apakramam. flight, retreat View this entry on the original dictionary page scan.
apakramamfn. not being in the regular order (a fault in poetry). View this entry on the original dictionary page scan.
apakrāmam. passing off or away, retiring. View this entry on the original dictionary page scan.
apakrāmamind. going away, View this entry on the original dictionary page scan.
apakramamaṇḍalan. ecliptic, , Scholiast or Commentator View this entry on the original dictionary page scan.
apakramaṇan. passing off or away, retiring. View this entry on the original dictionary page scan.
apakraminmfn. going away, retiring. View this entry on the original dictionary page scan.
apakrāmukamfn. equals apa-kramin- View this entry on the original dictionary page scan.
apakrāntamfn. gone away View this entry on the original dictionary page scan.
apakrāntaabused (?), View this entry on the original dictionary page scan.
apakrāntan. (equals atītam-) that which is past View this entry on the original dictionary page scan.
apakrāntamedha(/ap--), mfn. sapless, pithless, View this entry on the original dictionary page scan.
apakrāntif. equals apa-kr/amaṇa- View this entry on the original dictionary page scan.
apakto buy (See ava-krī-).
apakriyāf. a wrong or improper act View this entry on the original dictionary page scan.
apakriyāf. delivery, clearing off (debts) View this entry on the original dictionary page scan.
apakriyāf. offence. View this entry on the original dictionary page scan.
apakrośam. reviling, abusing View this entry on the original dictionary page scan.
apakṛṣcl.1 P. -karṣati-, to draw off or aside, drag down, carry away, take away, remove ; to omit, diminish ; to put away ; to anticipate a word etc. which occurs later (in a sentence) ; to bend (a bow) ; to detract, debase, dishonour: Causal -karṣayati-, to remove, diminish, detract. View this entry on the original dictionary page scan.
apakṛṣṭamfn. drawn away, taken away, removed lost View this entry on the original dictionary page scan.
apakṛṣṭamfn. dragged down, brought down, depressed View this entry on the original dictionary page scan.
apakṛṣṭamfn. low, vile, inferior View this entry on the original dictionary page scan.
apakṛṣṭam. a crow View this entry on the original dictionary page scan.
apakṛṣṭacetanamfn. mentally debased. View this entry on the original dictionary page scan.
apakṛṣṭajātimfn. of a low tribe. View this entry on the original dictionary page scan.
apakṛṣṭatāf. inferiority, vileness. View this entry on the original dictionary page scan.
apakṛṣṭatvan. inferiority, vileness. View this entry on the original dictionary page scan.
apakṛtmfn. doing harm or injury, View this entry on the original dictionary page scan.
apakṛtcl.6 P. -kṛntati-, to cut off View this entry on the original dictionary page scan.
apakṛtamfn. done wrongly or maliciously, offensively or wickedly committed View this entry on the original dictionary page scan.
apakṛtamfn. practised as a degrading or impure act (exempli gratia, 'for example' menial work, funeral rites, etc.) View this entry on the original dictionary page scan.
apakṛtan. injury, offence. View this entry on the original dictionary page scan.
apakṛtif. oppression, wrong, injury. View this entry on the original dictionary page scan.
apakṛtyan. damage, hurt View this entry on the original dictionary page scan.
apakṛtyamfn. deserving to be harmed or injured, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
apakruśto revile. View this entry on the original dictionary page scan.
apakṣamfn. without wings etc. View this entry on the original dictionary page scan.
apakṣamfn. without followers or partisans View this entry on the original dictionary page scan.
apakṣamfn. not on the same side or party View this entry on the original dictionary page scan.
apakṣamfn. adverse, opposed to. View this entry on the original dictionary page scan.
apakṣapātam. impartiality. View this entry on the original dictionary page scan.
apakṣapātinmfn. not flying with wings (and"a partisan of A id est viṣṇu-"), View this entry on the original dictionary page scan.
apakṣapucchamfn. without wings and tail View this entry on the original dictionary page scan.
apakṣatāf. opposition, hostility. View this entry on the original dictionary page scan.
apakṣayam. decline, decay, wane View this entry on the original dictionary page scan.
apakṣepaṇan. throwing down, etc. View this entry on the original dictionary page scan.
apakṣi Passive voice -kṣ/īyate-, to decline, wane (as the moon) View this entry on the original dictionary page scan.
apakṣīṇamfn. declined, decayed View this entry on the original dictionary page scan.
apakṣipto throw away or down, take away, remove. View this entry on the original dictionary page scan.
apakṣiptamfn. thrown down or away. View this entry on the original dictionary page scan.
apakṣitamfn. waned View this entry on the original dictionary page scan.
apaktif. ( pac-), immaturity View this entry on the original dictionary page scan.
apaktif. indigestion. View this entry on the original dictionary page scan.
apakukṣim. a bad or ill-shaped belly (?) View this entry on the original dictionary page scan.
apakukṣim. (also used as a bahu-vrīhi-and avyayī-bhāva-.) View this entry on the original dictionary page scan.
apakuñjam. Name of a younger brother of the serpent-king śeṣa- View this entry on the original dictionary page scan.
apakvamf(ā-)n. unripe, immature View this entry on the original dictionary page scan.
apakvamf(ā-)n. undigested. View this entry on the original dictionary page scan.
āpakvamfn. ( pac-), half-baked, nearly crude or raw View this entry on the original dictionary page scan.
āpakvamfn. nearly ripe, not quite ripe View this entry on the original dictionary page scan.
āpakvamfn. undressed, what is eaten without further preparation (as bread etc.) View this entry on the original dictionary page scan.
apakvabuddhimfn. of immature understanding. View this entry on the original dictionary page scan.
apakvāśinmfn. eating raw, uncooked food. View this entry on the original dictionary page scan.
apakvatāf. immaturity View this entry on the original dictionary page scan.
apakvatāf. incompleteness. View this entry on the original dictionary page scan.
apalakṣmaṇamfn. without lakṣmaṇa- (rāma-'s brother), View this entry on the original dictionary page scan.
apalpūlanakṛtamfn. not soaked or macerated View this entry on the original dictionary page scan.
apamakṣetraSee krānti-kṣetra-. View this entry on the original dictionary page scan.
āpamityakamfn. (fr. apa-mitya-[ ], ind.p. of apa--), received by barter View this entry on the original dictionary page scan.
āpamityakan. property etc. obtained by barter View this entry on the original dictionary page scan.
apamyak(Imper. 2. sg. -myakṣa-) to keep off from (ablative) View this entry on the original dictionary page scan.
āpānakan. a drinking-bout View this entry on the original dictionary page scan.
āpānakan. drinking liquor View this entry on the original dictionary page scan.
apāṅgakam. equals apāmārg/a-. View this entry on the original dictionary page scan.
apanodakamfn. removing, dispelling, View this entry on the original dictionary page scan.
apāpakāśin(/a-pāpa--) mfn. not ill-looking View this entry on the original dictionary page scan.
apāpakṛt(/a-pāpa--) mfn. not committing sin View this entry on the original dictionary page scan.
aparadakṣiṇamind. south-west, (gaRa tiṣṭhadgv-ādi- q.v) View this entry on the original dictionary page scan.
aparāhṇakamfn. "born in the afternoon", a proper name View this entry on the original dictionary page scan.
aparakālam. a later period View this entry on the original dictionary page scan.
aparakānyakubjam. Name of a village in the western part of kānyakubja- View this entry on the original dictionary page scan.
aparakāyam. the hind part of the body. View this entry on the original dictionary page scan.
aparaktamfn. having a changed colour, grown pale View this entry on the original dictionary page scan.
aparaktamfn. unfavourable View this entry on the original dictionary page scan.
aparāntakamf(ikā-)n. living at the western border etc. View this entry on the original dictionary page scan.
aparāntakan. Name of a song View this entry on the original dictionary page scan.
aparapakṣam. the latter half of the month View this entry on the original dictionary page scan.
aparapakṣam. the other or opposing side, the defendant. View this entry on the original dictionary page scan.
aparapakṣīyamfn. belonging to the latter half of the month, (gaRa gahādi- q.v) View this entry on the original dictionary page scan.
āparapakṣīyamfn. (fr. aparapakṣa-), belonging to the second half (of a month) View this entry on the original dictionary page scan.
aparasakthan. the hind thigh View this entry on the original dictionary page scan.
aparavaktrāf. a kind of metre of four lines (having every two lines the same). View this entry on the original dictionary page scan.
aparibhakṣam. not passing over another at a meal, View this entry on the original dictionary page scan.
aparihīṇakālamind. without loss of time, at once, View this entry on the original dictionary page scan.
aparīkṣyakārinmfn. acting inconsiderately, View this entry on the original dictionary page scan.
aparimitakṛtvasind. innumerable times, View this entry on the original dictionary page scan.
aparipakvamfn. not quite ripe (as fruits, or a tumour[ ]) View this entry on the original dictionary page scan.
aparipakvamfn. not quite mature. View this entry on the original dictionary page scan.
apārthakamfn. useless View this entry on the original dictionary page scan.
apārthakaraṇan. a false plea in a lawsuit. View this entry on the original dictionary page scan.
aparuṣakeśatāf. having soft hair (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
aparvakamfn. jointless View this entry on the original dictionary page scan.
apaśakunan. a bad omen. View this entry on the original dictionary page scan.
apatak(3. plural -takṣṇuvanti-and imperfect tense apātakṣan-) to chip off View this entry on the original dictionary page scan.
apatānakam. idem or 'm. idem or 'm. spasmodic contraction (of the body or stomach), emprosthotonos ' ' View this entry on the original dictionary page scan.
apatānakinmfn. affected with spasmodic contraction View this entry on the original dictionary page scan.
apatantrakam. idem or 'm. spasmodic contraction (of the body or stomach), emprosthotonos ' View this entry on the original dictionary page scan.
apātrakṛtyāf. acting unbecomingly, doing degrading offices (as for a Brahman to receive wealth improperly acquired, to trade, to serve a śūdra-, and to utter an untruth) View this entry on the original dictionary page scan.
apatyakāmamfn. desirous of offspring. View this entry on the original dictionary page scan.
apavādakamfn. reviling, blaming, defaming View this entry on the original dictionary page scan.
apavādakamfn. opposing, objecting to, excepting, excluding commentator or commentary on View this entry on the original dictionary page scan.
apavāhakam. deduction, subtraction. View this entry on the original dictionary page scan.
apavaktṛm. "speaking away", warning off, averting View this entry on the original dictionary page scan.
apavaktran. a kind of metre (confer, compare apara-- v-), View this entry on the original dictionary page scan.
apavaktraka n. a kind of metre (confer, compare apara-- v-), View this entry on the original dictionary page scan.
apavarakaetc. See apa-- 1. vri-. View this entry on the original dictionary page scan.
apavarakam. an inner apartment, lying in chamber View this entry on the original dictionary page scan.
apavāritakenaind. equals apa-vāritam-. View this entry on the original dictionary page scan.
apavartakam. a common measure View this entry on the original dictionary page scan.
āphalakam. enclosure, palisade View this entry on the original dictionary page scan.
aphalakāṅkṣinmfn. disinterested, not looking to beneficial consequences. View this entry on the original dictionary page scan.
āphalodayakarmanmfn. persevering in a work until it bears fruit View this entry on the original dictionary page scan.
āpīḍakajātamfn. (said of a tree in full flower), View this entry on the original dictionary page scan.
apikakṣam. the region of the arm-pits and shoulder-blades (especially in animals) View this entry on the original dictionary page scan.
apikakṣam. Name of a man and m. plural his descendants. View this entry on the original dictionary page scan.
apikakṣya(5) mfn. connected with the region of the arm-pits View this entry on the original dictionary page scan.
āpiṅgalakam. a bull which has been set at liberty, View this entry on the original dictionary page scan.
apipakṣam. the region or direction to the side View this entry on the original dictionary page scan.
apodakamf(ā-)n. waterless, watertight View this entry on the original dictionary page scan.
apodakamf(ā-)n. not watery, not fluid View this entry on the original dictionary page scan.
aprahṛṣṭakam. a crow, View this entry on the original dictionary page scan.
aprakalpakamf(ikā-)n. not prescribing as obligatory. View this entry on the original dictionary page scan.
aprakampamfn. unshaken View this entry on the original dictionary page scan.
aprakampamfn. firm, steady View this entry on the original dictionary page scan.
aprakampamfn. unanswered, unrefuted. View this entry on the original dictionary page scan.
aprakampatāf. firmness, stability, unanswerableness. View this entry on the original dictionary page scan.
aprakampinmfn. not shaking, steady View this entry on the original dictionary page scan.
aprakāṇḍamfn. stemless View this entry on the original dictionary page scan.
aprakāṇḍam. a bush, a shrub View this entry on the original dictionary page scan.
aprakaramfn. not acting excellently View this entry on the original dictionary page scan.
aprakaraṇan. not the principal topic, not relevant to the main subject. View this entry on the original dictionary page scan.
aprakarṣitamfn. not exceeded View this entry on the original dictionary page scan.
aprakarṣitamfn. unsurpassed. View this entry on the original dictionary page scan.
aprakāśamf(ā-)n. not shining, dark View this entry on the original dictionary page scan.
aprakāśamf(ā-)n. not visible, hidden, secret View this entry on the original dictionary page scan.
aprakāśamf(ā-)n. not manifest or evident View this entry on the original dictionary page scan.
aprakāśam. indistinctness, darkness View this entry on the original dictionary page scan.
aprakāśakamf(ikā-)n. not rendering bright, making dark. View this entry on the original dictionary page scan.
aprakāśamind. in secret View this entry on the original dictionary page scan.
aprakāśamānamfn. not manifested, unrevealed. View this entry on the original dictionary page scan.
aprakāśatmfn. invisible, View this entry on the original dictionary page scan.
aprakāśin mfn. invisible, View this entry on the original dictionary page scan.
aprakāśitamfn. idem or 'mfn. not manifested, unrevealed.' View this entry on the original dictionary page scan.
aprakāśyamfn. not to be manifested. View this entry on the original dictionary page scan.
aprakaṭamf(ā-)n. unmanifested, unapparent View this entry on the original dictionary page scan.
aprakaṭamind. without having been perceived View this entry on the original dictionary page scan.
apraketamfn. indiscriminate, unrecognizable View this entry on the original dictionary page scan.
aprakharamfn. dull, obtuse View this entry on the original dictionary page scan.
aprakharamfn. bland, mild View this entry on the original dictionary page scan.
aprakhyatāf. want of a striking or dignified appearance View this entry on the original dictionary page scan.
aprakḷptamfn. not explicitly enjoined. View this entry on the original dictionary page scan.
aprakḷptatāf. the state of not being explicitly enjoined
aprakṛṣṭam. a crow (see apa-kṛṣṭa-.) View this entry on the original dictionary page scan.
aprakṛtamfn. not principal, not relevant to the main topic under discussion, not chief View this entry on the original dictionary page scan.
aprakṛtamfn. occasional or incidental View this entry on the original dictionary page scan.
aprakṛtamfn. not natural. View this entry on the original dictionary page scan.
aprakṛtamfn. not being in question, not belonging to the matter, View this entry on the original dictionary page scan.
aprakṛtif. not an inherent or inseparable property, accidental property or nature. View this entry on the original dictionary page scan.
aprakṣitamfn. undiminished, inexhaustible View this entry on the original dictionary page scan.
āprapadīnakamfn. idem or 'mfn. reaching to the fore part of the foot (as a dress) ' View this entry on the original dictionary page scan.
āprapadīnakan. a dress reaching to the end of the foot. View this entry on the original dictionary page scan.
aprāptakālamfn. out of season, inopportune, ill-timed View this entry on the original dictionary page scan.
aprāptakālamfn. under age View this entry on the original dictionary page scan.
aprāptakālan. an irregular debate View this entry on the original dictionary page scan.
aprāpyakārinmfn. acting on any object without direct contact with it, commentator or commentary on View this entry on the original dictionary page scan.
aprārthakamfn. not demanding in marriage commentator or commentary on View this entry on the original dictionary page scan.
aprasaktamfn. not addicted, not attached to. View this entry on the original dictionary page scan.
aprasaktif. non-addiction, non-attachment to (locative case) View this entry on the original dictionary page scan.
apratigrāhakamf(ikā-)n. not accepting View this entry on the original dictionary page scan.
apratilabdhakāmamfn. never satiated in one's desires. View this entry on the original dictionary page scan.
āpratinivṛttaguṇormicakramfn. (scilicet jñāna-,knowledge) through which the whole circle of wave-like qualities (of passion etc.) subside or cease completely View this entry on the original dictionary page scan.
apratipakṣamfn. without a rival or opponent. View this entry on the original dictionary page scan.
apratirūpakathāf. incomparable or unanswerable discourse View this entry on the original dictionary page scan.
apratyakṣamfn. not present to the sight, invisible, imperceptible. View this entry on the original dictionary page scan.
apratyakṣaśiṣṭamfn. not distinctly taught. View this entry on the original dictionary page scan.
apratyakṣatāf. imperceptibility. View this entry on the original dictionary page scan.
apravartakamf(ikā-)n. abstaining from action, inert View this entry on the original dictionary page scan.
apravartakamf(ikā-)n. not exciting to action. View this entry on the original dictionary page scan.
aprayāṇakan. halt (on a journey) View this entry on the original dictionary page scan.
aprayojakamf(ikā-)n. not causing or effecting, aimless. View this entry on the original dictionary page scan.
aprītyātmakamf(ikā-)n. consisting of pain. View this entry on the original dictionary page scan.
apriyakaramfn. "not giving pleasure", disagreeable View this entry on the original dictionary page scan.
apṛthakind. not separately, with, together with, collectively. View this entry on the original dictionary page scan.
apṛthakśrutimfn. not audible separately View this entry on the original dictionary page scan.
apṛthaktvinmfn. not asserting a separate existence, View this entry on the original dictionary page scan.
āptadakṣiṇamfn. having proper gifts or furnished with abundant gifts View this entry on the original dictionary page scan.
āptakāmamfn. one who has gained his wish, satisfied View this entry on the original dictionary page scan.
āptakāmamfn. (in philosophy) one who knows the identity of brahman- and ātman- View this entry on the original dictionary page scan.
āptakāmam. the supreme soul View this entry on the original dictionary page scan.
āptakārinmfn. managing affairs in a fit or confidential manner View this entry on the original dictionary page scan.
āptakārinm. a trusty agent, a confidential servant View this entry on the original dictionary page scan.
āptakriyam. a trusty agent, View this entry on the original dictionary page scan.
āptakṛtmfn. trustworthy, View this entry on the original dictionary page scan.
āptavibhaktikamfn. complete as to case-terminations, View this entry on the original dictionary page scan.
apūjakamfn. irreverent. View this entry on the original dictionary page scan.
apuṇyakṛtmfn. acting wickedly, wicked. View this entry on the original dictionary page scan.
apūpakam. () = apūp/a-, a cake etc. View this entry on the original dictionary page scan.
apūrṇakālamfn. premature View this entry on the original dictionary page scan.
apūrṇakālam. incomplete time. View this entry on the original dictionary page scan.
apūrṇakālajamfn. born before the proper time, abortive. View this entry on the original dictionary page scan.
apuronuvākyakamfn. without a puronuvākyā- View this entry on the original dictionary page scan.
apūrvakaraṇan. (with jaina-s) Name (also title or epithet) of the 8th stage leading to perfection View this entry on the original dictionary page scan.
apūrvakarmann. a religious rite or sacrifice (the power of which on the future is not before seen). View this entry on the original dictionary page scan.
āpūryamāṇapakṣam. ([ scilicet candra-]) the moon in her increase, the waxing moon View this entry on the original dictionary page scan.
aputrakamf(ikā-)n. sonless View this entry on the original dictionary page scan.
ārādhakamfn. worshipping, a worshipper View this entry on the original dictionary page scan.
ārādhanaprakāram. Name of work View this entry on the original dictionary page scan.
ārādhyakarpūram. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
ārādupakārakamfn. indirectly effective, , Scholiast or Commentator View this entry on the original dictionary page scan.
ārādupakārin mfn. indirectly effective, , Scholiast or Commentator View this entry on the original dictionary page scan.
araghaṭṭakam. equals -ghaṭṭa- q.v View this entry on the original dictionary page scan.
arājakamfn. having no king etc. View this entry on the original dictionary page scan.
arājakan. want of a king, anarchy View this entry on the original dictionary page scan.
ārājñakamfn. belonging to the above region View this entry on the original dictionary page scan.
arakam. the spoke of a wheel View this entry on the original dictionary page scan.
arakam. the jaina- division of time called ar/a- , the plant Blyxa Octandra View this entry on the original dictionary page scan.
arakam. another plant, Gardenia Enneandra. View this entry on the original dictionary page scan.
ārakātind. (with ablative) far from View this entry on the original dictionary page scan.
ārakP. -rakṣati-, to watch over, defend ; to protect from View this entry on the original dictionary page scan.
ārakṣamfn. preserved, defended, proper or worthy to be defended View this entry on the original dictionary page scan.
ārakṣam. protection, guard, preservation etc. View this entry on the original dictionary page scan.
ārakṣam. the junction of the frontal sinuses of an elephant View this entry on the original dictionary page scan.
ārakṣam. the part of the forehead below this junction View this entry on the original dictionary page scan.
ārakṣāf. protection, guard. View this entry on the original dictionary page scan.
ārakaka mfn. who or what guards or protects View this entry on the original dictionary page scan.
ārakakam. a watchman, patrol View this entry on the original dictionary page scan.
ārakakam. a village or police magistrate View this entry on the original dictionary page scan.
arakṣasmfn. (3. rakṣ-), harmless, honest View this entry on the original dictionary page scan.
arakṣasyamfn. free from evil spirits View this entry on the original dictionary page scan.
arakṣatmfn. (1. rakṣ-), not guarding View this entry on the original dictionary page scan.
ārakṣikamfn. who or what guards or protects View this entry on the original dictionary page scan.
ārakṣikam. a watchman, patrol View this entry on the original dictionary page scan.
ārakṣikam. a village or police magistrate View this entry on the original dictionary page scan.
ārakṣinmfn. guarding, watching View this entry on the original dictionary page scan.
arakṣitamfn. not guarded View this entry on the original dictionary page scan.
ārakṣitamfn. guarded, protected View this entry on the original dictionary page scan.
arakṣitṛmfn. one who does not guard View this entry on the original dictionary page scan.
ārakṣyamfn. to be preserved or guarded View this entry on the original dictionary page scan.
araktamfn. undyed, View this entry on the original dictionary page scan.
āraktamfn. reddish View this entry on the original dictionary page scan.
āraktan. red sandal-wood View this entry on the original dictionary page scan.
āraktapuṣpīf. Name of a plant View this entry on the original dictionary page scan.
araktatāmramfn. unstained by red, . View this entry on the original dictionary page scan.
āraktībhūto become or get reddish. View this entry on the original dictionary page scan.
ārakūṭam. n. a kind of brass. View this entry on the original dictionary page scan.
arālakeśīf. a woman with curled hair, View this entry on the original dictionary page scan.
arālapakṣmanayanamfn. whose eyelashes are curved View this entry on the original dictionary page scan.
ārambhakamfn. causing to begin or commence View this entry on the original dictionary page scan.
ārambhakamfn. in fine compositi or 'at the end of a compound' commencing, beginning View this entry on the original dictionary page scan.
āranālakan. idem or 'n. sour gruel made from the fermentation of boiled rice ' View this entry on the original dictionary page scan.
araṇyacaṭakam. a wood-sparrow View this entry on the original dictionary page scan.
araṇyajārdrakāf. wild ginger View this entry on the original dictionary page scan.
araṇyakan. a forest , the plant Melia Sempervirens View this entry on the original dictionary page scan.
āraṇyakamfn. forest, wild, forest-born, produced in a forest, relating to a forest or a forest animal, (the āraṇyakam parva-of the mahā-bhārata- is either the whole third book or only the first section of it) View this entry on the original dictionary page scan.
āraṇyakam. a forester, an inhabitant of the woods View this entry on the original dictionary page scan.
āraṇyakan. Name of a class of religious and philosophical writings closely connected with the brāhmaṇa-s and called āraṇyaka-s because either composed in forests or studied there, (the upaniṣad-s are considered to be attached to them.) View this entry on the original dictionary page scan.
araṇyakadalīf. the wood or wild plantain View this entry on the original dictionary page scan.
āraṇyakagānan. equals āraṇyagāna- q.v View this entry on the original dictionary page scan.
araṇyakākam. the wood-crow View this entry on the original dictionary page scan.
āraṇyakakāṇḍan. Name of the third book of the rāmāyaṇa- and of the fourteenth book of the śatapatha-brāhmaṇa-.
araṇyakaṇāf. wild cumin seed View this entry on the original dictionary page scan.
araṇyakāṇḍan. Name of (describing rāma-'s life in the wilderness) . View this entry on the original dictionary page scan.
āraṇyakāṇḍan. Name of the third book of the rāmāyaṇa-. View this entry on the original dictionary page scan.
araṇyakarpāsīf. equals -kāpāsī- below. View this entry on the original dictionary page scan.
araṇyakārpāsīf. the wild cotton-shrub View this entry on the original dictionary page scan.
araṇyaketum. Name of a plant (see araṇī-ketu-.) View this entry on the original dictionary page scan.
āraṇyakukkuṭam. a wild cock View this entry on the original dictionary page scan.
araṇyakulathikāf. the plant Glycine Labialis Lin. View this entry on the original dictionary page scan.
araṇyakusumbham. the plant Carthamus Tinctorius View this entry on the original dictionary page scan.
araṇyamakṣikāf. the gad fly View this entry on the original dictionary page scan.
araṇyarakakam. forest-keeper, superintendent of a forest district View this entry on the original dictionary page scan.
araṇyetilakam. plural "wild, sesamum growing in a forest and containing no oil", anything which disappoints expectation View this entry on the original dictionary page scan.
ararakā ararākā f. Name of the ancestress of a celebrated Hindu family, (gaRa gargādi- q.v) View this entry on the original dictionary page scan.
araraka ararāka m. plural the descendants of ararā- (see ārarākya-.)
arasīṭhakkuram. Name of a poet (mentioned in śārṅgadhara-'s anthology). View this entry on the original dictionary page scan.
arāṭakīf. Name of a plant View this entry on the original dictionary page scan.
arāṭakīf. a kind of plant, View this entry on the original dictionary page scan.
āraṭṭakamfn. belonging to or coming from the country or people of āraṭṭa-. View this entry on the original dictionary page scan.
arāyakṣayaṇan. anything that serves to destroy evil spirits View this entry on the original dictionary page scan.
arbhakamfn. small, minute View this entry on the original dictionary page scan.
arbhakamfn. weak View this entry on the original dictionary page scan.
arbhakamfn. (used together with kumārak/a-) young, childish View this entry on the original dictionary page scan.
arbhakamfn. emaciated View this entry on the original dictionary page scan.
arbhakamfn. similar View this entry on the original dictionary page scan.
arbhakam. a boy, child etc., the young of any animal (varia lectio) a fool, idiot View this entry on the original dictionary page scan.
arbhaka Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
arcakamfn. honouring, worshipping View this entry on the original dictionary page scan.
arcakam. a worshipper View this entry on the original dictionary page scan.
arcārhaka(), mfn. worthy of honour or praise View this entry on the original dictionary page scan.
ardhacakravartin m. "half a cakravartin- ", Name of the nine black vāsudeva-s (of the jaina-s) View this entry on the original dictionary page scan.
ardhacakrinm. "half a cakravartin- ", Name of the nine black vāsudeva-s (of the jaina-s) View this entry on the original dictionary page scan.
ardhacandrakam. (equals ardhacandra-) the hand bent into a semicircle for grasping any one's throat, in fine compositi or 'at the end of a compound' ( dattārdhacandraka dattārdhacandraka- mfn.) "seized at the throat" View this entry on the original dictionary page scan.
ardhacandrakan. the semilunar point of an arrow, View this entry on the original dictionary page scan.
ardhacandrakuṇḍan. Name of a mystical figure of semilunar form View this entry on the original dictionary page scan.
ardhacolakam. a short bodice View this entry on the original dictionary page scan.
ardhahastakam. a distance of 120 inches, View this entry on the original dictionary page scan.
ardhajīvakā f. equals jyārdha-, the sine of in arc. View this entry on the original dictionary page scan.
ardhakamfn. forming a half. View this entry on the original dictionary page scan.
ardhakan. the half. View this entry on the original dictionary page scan.
ardhakan. Name of a wrong pronunciation of the vowels View this entry on the original dictionary page scan.
ardhakam. water-snake View this entry on the original dictionary page scan.
ardhakaghātinmfn. "killing the water-snake"(?), Name of rudra- (adhvaga-gh- ) View this entry on the original dictionary page scan.
ardhakaiśikamf(ī-)n. having half the breadth of a hair View this entry on the original dictionary page scan.
ardhakālam. a Name of śiva- View this entry on the original dictionary page scan.
ardhakaṃsikamfn. equals ārdhak- q.v , measuring half a kaṃsa- View this entry on the original dictionary page scan.
ārdhakaṃsikamfn. measuring half a kaṃsa- commentator or commentary on View this entry on the original dictionary page scan.
ardhakapiśamfn. half-brown, brownish, , Scholiast or Commentator View this entry on the original dictionary page scan.
ardhakarṇam. "half the diameter", radius. View this entry on the original dictionary page scan.
ardhakārṣikamfn. having the weight of half a karṣa- View this entry on the original dictionary page scan.
ardhakathanan. relating only half (not to the end of a story) (varia lectio -ka-thita-,"half-related") .
ardhakauḍavikamfn. equals ārdhak- q.v , measuring half a kuḍava- View this entry on the original dictionary page scan.
ārdhakauḍavikamfn. measuring half a kuḍava- View this entry on the original dictionary page scan.
ardhaketum. Name of a rudra- View this entry on the original dictionary page scan.
ardhakhāran. half a khārī- View this entry on the original dictionary page scan.
ardhakhārīf. half a khārī- View this entry on the original dictionary page scan.
ardhakīlan. Name of a tīrtha- View this entry on the original dictionary page scan.
ardhakoṣam. a moiety of one's treasure. View this entry on the original dictionary page scan.
ardhakoṭīf. half a koṭī- id est five millions View this entry on the original dictionary page scan.
ardhakrośam. half a league. View this entry on the original dictionary page scan.
ārdhakrośikamfn. measuring half a krośa- View this entry on the original dictionary page scan.
ardhakṛṣṭamfn. half drawn out from (in compound) View this entry on the original dictionary page scan.
ardhakṛtamfn. half done, half performed. View this entry on the original dictionary page scan.
ardhakṣetran. plural Name of particular lunar mansions View this entry on the original dictionary page scan.
ardhakūṭam. a Name of śiva- View this entry on the original dictionary page scan.
ardhalakṣmīharim. "half lakṣmī- and half hari-", one of the forms of viṣṇu- (see ardha-nārīṇāteśvara-above) . View this entry on the original dictionary page scan.
ardhamāgadhakamfn. belonging to half the magadha-s (as a country) View this entry on the original dictionary page scan.
ardhamakuṭam. Name (also title or epithet) of śiva-, View this entry on the original dictionary page scan.
ardhamāṇavaka([ ]) m. a necklace of twelve strings. View this entry on the original dictionary page scan.
ardhāntaraikavācakam. (scilicet doṣa-) = ardhā- ntarai- kapadatā-, View this entry on the original dictionary page scan.
ardhapakvamfn. half ripe View this entry on the original dictionary page scan.
ardhapāñcālakamfn. belonging to half the pañcāla-s (as a country) View this entry on the original dictionary page scan.
ardhapañcamakamfn. bought for four and a half. View this entry on the original dictionary page scan.
ardhaphālakam. or n. Name (also title or epithet) of a particular garment, View this entry on the original dictionary page scan.
ardhaphālakam. plural a particular jaina- sect, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
ardhaphālakamatan. (its doctrine), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
ardhasuptakamf(ikā-)n. half-asleep, View this entry on the original dictionary page scan.
ardhāvabhedakam. equals ardhabheda- above View this entry on the original dictionary page scan.
ardhāvabhedakamfn. dividing into halves. View this entry on the original dictionary page scan.
ardheṣṭakāf. half a brick, View this entry on the original dictionary page scan.
ārdrakamf(ikā-)n. wet, moist View this entry on the original dictionary page scan.
ārdrakamf(ikā-)n. born under the constellation ārdrā- View this entry on the original dictionary page scan.
ārdrakam. Name of a king View this entry on the original dictionary page scan.
ārdrakan. ([and f(ikā-). ]) ginger in its undried state View this entry on the original dictionary page scan.
ārdrakāṣṭhan. green wood, timber not dry. View this entry on the original dictionary page scan.
ārdrālubdhakam. the dragon's tail or descending node View this entry on the original dictionary page scan.
ārdrapattrakam. bamboo View this entry on the original dictionary page scan.
arhakamfn. entitled to (compound), View this entry on the original dictionary page scan.
arhakalittle, small (for arbhaka-), View this entry on the original dictionary page scan.
arimedakam. Name of an insect View this entry on the original dictionary page scan.
ariṣṭakam. (equals /a-riṣṭa-,m.) the soapberry tree (the fruits of which are used in washing ) View this entry on the original dictionary page scan.
ariṣṭakāf. Name of a plant
ariṣṭakamfn. suffering from the disease ariṣṭa-, View this entry on the original dictionary page scan.
ariṣṭakarmanm. Name of a prince View this entry on the original dictionary page scan.
arjakamfn. procuring, acquiring View this entry on the original dictionary page scan.
arjakam. the plant Ocimum Gratissimum View this entry on the original dictionary page scan.
ārjavakamfn. straight, direct View this entry on the original dictionary page scan.
ārjavakam. Name of the ninth sarga- or creation View this entry on the original dictionary page scan.
arjunakam. Name of a hunter View this entry on the original dictionary page scan.
arjunakam. a worshipper of arjuna- View this entry on the original dictionary page scan.
arjunakāṇḍa(/arjuna--) mfn. having a white appendage View this entry on the original dictionary page scan.
arjuṇārcanakalpalatāf. Name of two works. View this entry on the original dictionary page scan.
arjunasakhim. "having arjuna- for his friend", Name of kṛṣṇa- View this entry on the original dictionary page scan.
ārjunāyanakamfn. (gaRa rājanyādi- ) inhabited by the ārjunāyana-s. View this entry on the original dictionary page scan.
arkabhakf. equals -kāntā- q.v View this entry on the original dictionary page scan.
arkakāntāf. the plant Polanisia Icosandra View this entry on the original dictionary page scan.
arkakaram. sunbeam View this entry on the original dictionary page scan.
arkakāṣṭhan. wood from the arka-, View this entry on the original dictionary page scan.
arkakośīf. a bud of the arka- plant View this entry on the original dictionary page scan.
arkakṣetran. "the field of the sun", Name of a sacred place in Orissa. View this entry on the original dictionary page scan.
arkakṣīran. the milky juice of the arka- plant View this entry on the original dictionary page scan.
arkakuṇḍatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
arkaprakāśamf(ā-)n. bright like the sun View this entry on the original dictionary page scan.
arkaprakāśam. Name of a medical work (see -cikitā-above) , of a work on jurisprudence. View this entry on the original dictionary page scan.
armakaam, rubbish, ruins View this entry on the original dictionary page scan.
armakapālam. n. a potsherd from a heap of rubbish, View this entry on the original dictionary page scan.
arṇavaśakkarīf. (incorrect for - śakvarī-) sea-girt (the earth), . View this entry on the original dictionary page scan.
arocakamfn. not shining, , causing want of appetite or disgust View this entry on the original dictionary page scan.
arocakam. want or loss of appetite, disgust, indigestion View this entry on the original dictionary page scan.
ārocakaSee ā-ruc-. View this entry on the original dictionary page scan.
arocakinmfn. suffering from want of appetite or indigestion , (in rhetoric) having a fastidious or cultivated taste. View this entry on the original dictionary page scan.
ārogyapañcakan. a remedy against fever View this entry on the original dictionary page scan.
ārohakamfn. ascending, rising View this entry on the original dictionary page scan.
ārohakamfn. raising up View this entry on the original dictionary page scan.
ārohakam. a rider View this entry on the original dictionary page scan.
ārohakam. a tree View this entry on the original dictionary page scan.
āropakamfn. in fine compositi or 'at the end of a compound' planting View this entry on the original dictionary page scan.
āropakamfn. fixing View this entry on the original dictionary page scan.
āropakamfn. causing to ascend View this entry on the original dictionary page scan.
arpitakaramfn. "having given one's hand", married
arthacintakamfn. knowing or considering what is useful (see sarvārtha-c-.) View this entry on the original dictionary page scan.
arthadarśakam. "seeing lawsuits", a judge (see akṣa-d-.) View this entry on the original dictionary page scan.
arthahārakamf(ikā-)n. stealing money View this entry on the original dictionary page scan.
arthakāman [ varia lectio ] m. dual number [ ] m. plural [ ] utility and desire, wealth and pleasure View this entry on the original dictionary page scan.
arthakāmamfn. desirous of wealth, N. , desiring to be useful. View this entry on the original dictionary page scan.
arthakāmyaNom. P. yati-, to wish for money, View this entry on the original dictionary page scan.
arthakaramf(ī-)n. () producing advantage, useful View this entry on the original dictionary page scan.
arthakārakam. Name of a son of dyutimat- (varia lectio andha-k- ) View this entry on the original dictionary page scan.
arthakāraṇātind. in fine compositi or 'at the end of a compound' for the sake or on account of. View this entry on the original dictionary page scan.
arthakārin(), mfn. useful, profitable View this entry on the original dictionary page scan.
arthakarmann. an action on purpose (opposed to guṇa-karman- q.v) View this entry on the original dictionary page scan.
arthakarśyan. poverty View this entry on the original dictionary page scan.
arthakartṛ() mfn. useful, profitable View this entry on the original dictionary page scan.
arthakāśinmfn. only apparently (id est not really) of use or utility View this entry on the original dictionary page scan.
arthakathāf. (from pāli- aṭṭhakathā-)"explaining meanings", a class of Buddhist wks., View this entry on the original dictionary page scan.
arthakilbiṣinmfn. dishonest in money matters View this entry on the original dictionary page scan.
arthakovidamfn. expert in any matter, experienced View this entry on the original dictionary page scan.
arthakṛcchran. sg. ([ ]) or plural ([ ]) a difficult matter. View this entry on the original dictionary page scan.
arthakriyāf. an action performed with a special purpose View this entry on the original dictionary page scan.
arthakriyāf. the being useful (to others) View this entry on the original dictionary page scan.
arthakṛtmfn. causing profit, useful. View this entry on the original dictionary page scan.
arthakṛtamfn. made for a special purpose View this entry on the original dictionary page scan.
arthakṛtamfn. made only with regard to utility, interested (as friendship) View this entry on the original dictionary page scan.
arthakṛtamfn. caused by the sense of a word (opposed to śabda-k-and desa-k-) commentator or commentary on View this entry on the original dictionary page scan.
arthakṛtyan. ([ ]) ([ ]) settling a matter or affair. View this entry on the original dictionary page scan.
arthakṛtyāf. ([ ]) settling a matter or affair. View this entry on the original dictionary page scan.
arthanāśakamfn. wasting money, prodigal, View this entry on the original dictionary page scan.
arthapañcakan. Name (also title or epithet) of a work on bhakti- View this entry on the original dictionary page scan.
arthaprakṛtif. "the principal thing required for a special aim", Name of the five constituent elements of a drama View this entry on the original dictionary page scan.
arthapūrvakamfn. having a particular aim or object, , Scholiast or Commentator View this entry on the original dictionary page scan.
arthapūrvakatva(n.) View this entry on the original dictionary page scan.
arthasādhakamf(ikā-)n. promoting an aim, useful, profitable (see svārthasādhaka-) View this entry on the original dictionary page scan.
arthasādhakam. the plant putraṃjīva- Roxburghii View this entry on the original dictionary page scan.
arthasādhakam. Name of a minister of king daśaratha- View this entry on the original dictionary page scan.
arthaśāstrakan. idem or 'n. a book treating of practical life (see -vidyā-above) and political government (see -cintana-above) ' View this entry on the original dictionary page scan.
arthasiddhakam. the plant Vitex Negundo View this entry on the original dictionary page scan.
arthavyaktif. clearness of the sense View this entry on the original dictionary page scan.
arthopakṣepakamfn. "indicating or suggesting a matter (so as to facilitate the understanding of the plot)", a N. applied to the parts of a drama called viṣkambha-, cūlikā-, aṅkāsya-, aṅkāvatāra-, and praveśaka-, qq.vv. View this entry on the original dictionary page scan.
arthopakṣepaṇan. suggesting or indicating a matter View this entry on the original dictionary page scan.
āruṇakamfn. belonging to the country aruṇa-, (gaRa dhūmādi- ) View this entry on the original dictionary page scan.
aruṇakamalan. the red lotus. View this entry on the original dictionary page scan.
aruṇakaram. "having red rays", the sun View this entry on the original dictionary page scan.
aruṇaketubrāhmaṇan. the brāhmaṇa- of the aruṇāḥ- ketavaḥ- (See aruṇās-above) , View this entry on the original dictionary page scan.
āruṇaketukamfn. belonging to the aruṇāḥ- ketavaḥ- (See under aruṇa-) View this entry on the original dictionary page scan.
aruṇakiraṇam. idem or 'm. "having red rays", the sun ' View this entry on the original dictionary page scan.
āruṇyakamfn. belonging to the aruṇa-s. View this entry on the original dictionary page scan.
arūpakamfn. shapeless, immaterial View this entry on the original dictionary page scan.
arūpakamfn. (in rhetoric) without figure or metaphor, literal. View this entry on the original dictionary page scan.
aryakam. Name (also title or epithet) of a demon causing disease, View this entry on the original dictionary page scan.
āryakam. an honourable or respectable man View this entry on the original dictionary page scan.
āryakam. a grandfather View this entry on the original dictionary page scan.
āryakam. Name of a cowherd who became king View this entry on the original dictionary page scan.
āryakam. of a nāga- View this entry on the original dictionary page scan.
āryakaf(akā-or ikā-). a respectable woman View this entry on the original dictionary page scan.
āryakaf(akā-or ikā-). Name of a river View this entry on the original dictionary page scan.
āryakan. a ceremony performed to the manes, the vessel etc. used in sacrifices made to the manes View this entry on the original dictionary page scan.
āryakarmanmfn. doing noble actions, acting like an Aryan, View this entry on the original dictionary page scan.
āryakṛtamfn. made by a man of the first three castes View this entry on the original dictionary page scan.
āryakulyāf. Name of a river View this entry on the original dictionary page scan.
āryakumāram. a noble prince View this entry on the original dictionary page scan.
āryamārgapudgalanāyakam. Name (also title or epithet) of buddha-, View this entry on the original dictionary page scan.
āryāṇakam. Name of a country. View this entry on the original dictionary page scan.
āśācakravālan. the whole horizon View this entry on the original dictionary page scan.
aṣaḍakṣīṇamfn. (fr. ṣaṣ-, akṣi-), not seen by six eyes id est known by two persons only, secret View this entry on the original dictionary page scan.
aṣāḍhakam. the month āṣāḍha- View this entry on the original dictionary page scan.
āṣāḍhakam. the month āṣāḍha- View this entry on the original dictionary page scan.
āṣāḍhakam. Name of a man View this entry on the original dictionary page scan.
āśakP. (only ; Aorist subjunctive -śakat-, ; perfect tense 3. plural -śekus-,x, 88, 17, etc.) to stimulate ; to bring near, invite ; to aid, help ; to give a share of, let partake: Desiderative A1. -śikṣate-, to let partake ; to give, bestow, confer and View this entry on the original dictionary page scan.
āśakamfn. eating (see an-.) View this entry on the original dictionary page scan.
asakalamfn. not all, not entire View this entry on the original dictionary page scan.
asakaumf. equals asau- (See sub voce, i.e. the word in the Sanskrit order ad/as-), only used in connection with yak/aḥ- and yak/ā- (for y/aḥ-and y/ā-) (see )
asakhim. an untrustworthy friend commentator or commentary on View this entry on the original dictionary page scan.
aknuvānamfn. (parasmE-pada A1.) idem or 'mfn. (p. P.) unable to (Inf.) ' View this entry on the original dictionary page scan.
aknuvatmfn. (p. P.) unable to (Inf.) View this entry on the original dictionary page scan.
asakramfn. ( saśc-), not ceasing to flow or drying up View this entry on the original dictionary page scan.
asakramfn. ( .) View this entry on the original dictionary page scan.
asakṛdbhavam. "produced more than once", a tooth View this entry on the original dictionary page scan.
asakṛdgarbhavāsam. repeated birth. View this entry on the original dictionary page scan.
asakṛtind. not (only) once, often, repeatedly etc. View this entry on the original dictionary page scan.
asakṛtind. with saṃvat-sarasya-, oftener than once a year View this entry on the original dictionary page scan.
asakṛtsamādhim. repeated meditation View this entry on the original dictionary page scan.
aktamfn. unable, incompetent (with infinitive mood or locative case or dative case) View this entry on the original dictionary page scan.
asaktamfn. not stopped or intercepted by or at (locative case;said of arrows and of a sword) View this entry on the original dictionary page scan.
asaktamfn. (in the same sense a-saṅga- ) View this entry on the original dictionary page scan.
asaktamfn. free from ties, independent, View this entry on the original dictionary page scan.
asaktamfn. detached from worldly feelings or passions, unattached or indifferent to (locative case) etc. View this entry on the original dictionary page scan.
asaktamfn. uninterruptedly View this entry on the original dictionary page scan.
asaktamfn. immediately, at once View this entry on the original dictionary page scan.
asaktaeternal, continual, View this entry on the original dictionary page scan.
āśaktamfn. very powerful or mighty, able View this entry on the original dictionary page scan.
āsaktamfn. fixed or fastened to View this entry on the original dictionary page scan.
āsaktamfn. attached to, lying on or upon etc. View this entry on the original dictionary page scan.
āsaktamfn. attached strongly to, intent on View this entry on the original dictionary page scan.
āsaktamfn. zealously following or pursuing etc. View this entry on the original dictionary page scan.
āsaktamfn. wound round, encircled View this entry on the original dictionary page scan.
āsaktamfn. accompanied or furnished with View this entry on the original dictionary page scan.
āsaktamfn. following directly, immediately proceeding from (accusative) View this entry on the original dictionary page scan.
āsaktan. darkness, View this entry on the original dictionary page scan.
aktabhartṛkamfn. having an impotent husband, View this entry on the original dictionary page scan.
āsaktabhāvamfn. having one's affection fixed on, being in love with View this entry on the original dictionary page scan.
āsaktacetas mfn. having the mind deeply engaged in or fixed upon (any object), intent on, devoted to, absorbed in. View this entry on the original dictionary page scan.
āsaktacittamfn. having the mind deeply engaged in or fixed upon (any object), intent on, devoted to, absorbed in. View this entry on the original dictionary page scan.
asaktamind. without obstacle or resistance View this entry on the original dictionary page scan.
āsaktamanasmfn. having the mind deeply engaged in or fixed upon (any object), intent on, devoted to, absorbed in. View this entry on the original dictionary page scan.
asakthaor a-sakthi- mfn. without thighs View this entry on the original dictionary page scan.
aktif. inability, incapability. View this entry on the original dictionary page scan.
asaktif. the being detached from worldly feelings or passions View this entry on the original dictionary page scan.
āśaktif. might, power, ability View this entry on the original dictionary page scan.
āsaktif. the act of adhering or attaching one's self firmly behind View this entry on the original dictionary page scan.
āsaktif. placing behind View this entry on the original dictionary page scan.
āsaktif. waylaying View this entry on the original dictionary page scan.
āsaktif. devotedness, attachment View this entry on the original dictionary page scan.
āsaktif. diligence, application View this entry on the original dictionary page scan.
āsaktiind. uninterruptedly, wholly, throughout View this entry on the original dictionary page scan.
akumbhīf. the aquatic plant Pistia Stratiotes View this entry on the original dictionary page scan.
akunan. (in fine compositi or 'at the end of a compound' f(ā-).) an inauspicious omen View this entry on the original dictionary page scan.
akunībhūto turn into an inauspicious omen View this entry on the original dictionary page scan.
akyamfn. impossible, impractible etc. View this entry on the original dictionary page scan.
akyamfn. impossible to be composed (as a book ) or to be executed (as an order ), not to be overcome, invincible View this entry on the original dictionary page scan.
akyārthamfn. unavailing View this entry on the original dictionary page scan.
akyatāf. impossibility (with infinitive mood) View this entry on the original dictionary page scan.
akyatvan. impossibility (with infinitive mood) View this entry on the original dictionary page scan.
asālatiprakāśam. Name (also title or epithet) of a dictionary (written under asālati-, king of Kashmir). View this entry on the original dictionary page scan.
asamakṣamind. not visibly, behind one's back View this entry on the original dictionary page scan.
asamānakāraṇamfn. not having the same cause View this entry on the original dictionary page scan.
asamasāyakam. equals -bāṇa- q.v View this entry on the original dictionary page scan.
asamaṣṭakāvya(7) mfn. ( -), of unattainable wisdom View this entry on the original dictionary page scan.
asamāvartakam. a religious student who has not yet completed the period of his residence with his teacher and who therefore has not yet returned home View this entry on the original dictionary page scan.
asamāvṛttaka m. idem or 'm. a religious student who has not yet completed the period of his residence with his teacher and who therefore has not yet returned home ' (varia lectio) View this entry on the original dictionary page scan.
asaṃgītakamind. without music (with nṛt-, to dance without m, id est "to do anything without cause or reason"), View this entry on the original dictionary page scan.
asamīkṣyakārinmfn. acting inconsiderately View this entry on the original dictionary page scan.
asaṃkhyakamfn. idem or 'mf(ā-)n. innumerable, exceedingly numerous ' View this entry on the original dictionary page scan.
asaṃlakṣyamfn. not perceptible View this entry on the original dictionary page scan.
asaṃlulitakeśatāf. having the hair not tangled (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
asaṃsaktamfn. unconnected, incoherent View this entry on the original dictionary page scan.
asaṃsaktamfn. (said of the eyebrows) not joining View this entry on the original dictionary page scan.
asaṃsaktamfn. not attached to, indifferent to (locative case) View this entry on the original dictionary page scan.
asaṃsaktamind. unconnectedly, separately View this entry on the original dictionary page scan.
asaṃskṛtālakinmfn. having unadorned curls View this entry on the original dictionary page scan.
asamyakind. incorrectly, wrongly View this entry on the original dictionary page scan.
asamyakkārinmfn. acting improperly View this entry on the original dictionary page scan.
asamyakkṛtakārinmfn. not doing one's work or duty well View this entry on the original dictionary page scan.
asamyakprayogam. incorrect application View this entry on the original dictionary page scan.
aśanakriyāf. the taking of food (yāṃ-- kṛ-,"to eat"), View this entry on the original dictionary page scan.
aśanakṛtmfn. preparing food View this entry on the original dictionary page scan.
āsaṅgakāṣṭhan. a peg, . View this entry on the original dictionary page scan.
āsannakālam. the hour of death View this entry on the original dictionary page scan.
āsannakālamfn. one who has reached his time or hour (of death). View this entry on the original dictionary page scan.
āsannakālikamfn. near in time, Sch. View this entry on the original dictionary page scan.
āsannakṣayamfn. one whose ruin is near. View this entry on the original dictionary page scan.
āsaphakhānam. = Asaf Khan, View this entry on the original dictionary page scan.
āsapiṇḍakriyākarmaind. till the śrāddha- or funeral ceremony of which the sapiṇḍa-s (q.v) partake View this entry on the original dictionary page scan.
asarvakratu(/a-sarva--) m. not a general sacrifice, not an optional sacrifice , View this entry on the original dictionary page scan.
asarvavibhaktimfn. not taking every case-termination, defective (exempli gratia, 'for example' yataḥ-, yatra-,and yadā-,considered as ablative locative case,and instrumental case respectively) View this entry on the original dictionary page scan.
aśatadakṣiṇa(/a-śata--) mfn. where the dakṣiṇā- is less than a hundred View this entry on the original dictionary page scan.
asecanaka([ ]) ([ ]) mfn. idem or 'mfn. (also ā-sec- q.v) charming, lovely ' View this entry on the original dictionary page scan.
āsecanakamfn. equals a-secanaka- qq.v. View this entry on the original dictionary page scan.
asecanakadarśanamfn. lovely to see, View this entry on the original dictionary page scan.
asidaṃṣṭrakam. "having swords for fangs", the marine monster makara- (painted on the banner of kāmadeva-) View this entry on the original dictionary page scan.
asidhāvakam. a sword- or tool-cleaner, armourer View this entry on the original dictionary page scan.
asīmakṛṣṇam. Name of a prince View this entry on the original dictionary page scan.
asipattrakam. the sugar-cane View this entry on the original dictionary page scan.
asipucchakam. the Gangetic porpoise (Delphinus Gangeticus). View this entry on the original dictionary page scan.
aśīrṣakamfn. headless View this entry on the original dictionary page scan.
āśīrvācakamfn. expressing a wish commentator or commentary on View this entry on the original dictionary page scan.
aśiśirakaram. "having hot rays", the sun View this entry on the original dictionary page scan.
aśiśirakiraṇam. idem or 'm. "having hot rays", the sun ' View this entry on the original dictionary page scan.
aśītakaram. equals aśiśira-kara- q.v View this entry on the original dictionary page scan.
aśītakara View this entry on the original dictionary page scan.
asitakeśāntamfn. having black locks View this entry on the original dictionary page scan.
āsītakīf. a kind of plant View this entry on the original dictionary page scan.
asitamuṣkakam. the plant Schrebera Swietenioides View this entry on the original dictionary page scan.
asitapucchakam. "having a black tail", Name of an animal (see kāla-pucchaka-.) View this entry on the original dictionary page scan.
aśītiṣṭakamfn. having eighty iṣṭakā-s View this entry on the original dictionary page scan.
aśītyakṣaramfn. containing eighty syllables, View this entry on the original dictionary page scan.
aśītyakṣaratva(n.) View this entry on the original dictionary page scan.
āskanditakan. (akam-) a horse's gallop View this entry on the original dictionary page scan.
āśmabhārakamf(ikā-)n. (fr. aśma-bhāra-), belonging to or burdened with a mass of stones View this entry on the original dictionary page scan.
aśmabhedaka([ ]) m. idem or '([ ]) ([ ]) m. idem or 'm. the plant Coleus Scutellarioides (supposed to dissolve stone in the bladder) ' ' View this entry on the original dictionary page scan.
aśmacakra(/aśma-.) mfn. furnished with a disk of stone View this entry on the original dictionary page scan.
asmadryakind. (dry/ak-) towards us View this entry on the original dictionary page scan.
aśmakam. (gaRa ṛśyādi- q.v) Name of a son of vasiṣṭha- and madayantī- View this entry on the original dictionary page scan.
aśmakam. plural Name of a warrior tribe etc. (see avanty-aśmakās-) View this entry on the original dictionary page scan.
aśmakadalīf. Name of a plant View this entry on the original dictionary page scan.
aśmakasumantum. Name of a ṛṣi- View this entry on the original dictionary page scan.
aśmaketum. Name of a plant View this entry on the original dictionary page scan.
aśmakīf. Name of several women View this entry on the original dictionary page scan.
aśmakuṭṭamfn. breaking or bruising with a stone (as grain) View this entry on the original dictionary page scan.
aśmakuṭṭakamfn. idem or 'mfn. breaking or bruising with a stone (as grain) ' View this entry on the original dictionary page scan.
aśmantakan. a fire. place View this entry on the original dictionary page scan.
aśmantakan. a shade for a lamp View this entry on the original dictionary page scan.
aśmantakam. (equals aśmāntaka- q.v) Name of a plant View this entry on the original dictionary page scan.
aśmāntakam. Name of a plant (from the fibres of which a Brahman's girdle may be made) View this entry on the original dictionary page scan.
asmatsakhi(asm/at--) m(Nominal verb khā-)fn. having us as friends View this entry on the original dictionary page scan.
asnāvakamfn. without sinews View this entry on the original dictionary page scan.
aśokabhāṇḍaka n. jewels given to one's bride, View this entry on the original dictionary page scan.
aśokakaram. "rendering sorrowless", Name of a vidyādhara-
aśokakarīf. a female name View this entry on the original dictionary page scan.
aspaṣṭakīrtimfn. not famous, unknown View this entry on the original dictionary page scan.
āsphānakan. a particular meditation (?), View this entry on the original dictionary page scan.
āsphoṭakam. a species of plant View this entry on the original dictionary page scan.
āsphotakam. Calotropis Gigantea View this entry on the original dictionary page scan.
asrakhadiram. a red Mimosa View this entry on the original dictionary page scan.
āśramaviḍambakamfn. profaning a hermitage, . View this entry on the original dictionary page scan.
asrapattrakam. the plant Abelmoschus Esculentus View this entry on the original dictionary page scan.
asrārjakam. the white tulasi- plant View this entry on the original dictionary page scan.
asrāyamāṇakamfn. shedding tears View this entry on the original dictionary page scan.
aṣṭācakra(aṣṭ/ā-.) mf(ā-)n. having eight wheels View this entry on the original dictionary page scan.
aṣṭācatvāriṃśadakṣaramf(ā-)n. consisting of forty-eight syllables View this entry on the original dictionary page scan.
aṣṭācatvāriṃśadiṣṭakamfn. consisting of forty-eight iṣṭakā-s View this entry on the original dictionary page scan.
aṣṭācatvāriṃśakamfn. lasting forty-eight years View this entry on the original dictionary page scan.
aṣṭācatvāriṃśakamfn. equals -catvāriṃśin- q.v commentator or commentary View this entry on the original dictionary page scan.
aṣṭādaśaprakṛti18 officials, View this entry on the original dictionary page scan.
aṣṭādaśavakram. Name (also title or epithet) of a mountain, View this entry on the original dictionary page scan.
aṣṭādaśavakrikāf. Name (also title or epithet) of a mythical river, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
aṣṭakamf(ā-or ikā-)n. (; see commentator or commentary) consisting of eight parts etc. View this entry on the original dictionary page scan.
aṣṭakamf(ā-or ikā-)n. one who is acquainted with the eight books of pāṇini-'s grammar View this entry on the original dictionary page scan.
aṣṭakam. Name of a son of viśvāmitra- (author of the hymn ) etc. View this entry on the original dictionary page scan.
aṣṭakāf. the eighth day after full moon (especially that in the months hemanta- and śiśira-, on which the progenitors or manes are worshipped etc.; aṣṭakā-is therefore also a Name of the worship itself or the oblations offered on those days etc.) etc. View this entry on the original dictionary page scan.
aṣṭakāf. a Name of the acchodā- river View this entry on the original dictionary page scan.
aṣṭakan. a whole consisting of eight parts (as each of the eight aṣṭaka-s of the , or as ,or as pāṇini-'s grammar etc.) View this entry on the original dictionary page scan.
astakan. home (see sv-astak/a-) View this entry on the original dictionary page scan.
astakam. going to one's eternal home View this entry on the original dictionary page scan.
āṣṭakan. Name of a district on Vart. 31 on View this entry on the original dictionary page scan.
aṣṭakāṅgan. a kind of dice-board having eight divisions View this entry on the original dictionary page scan.
aṣṭakapālamfn. equals aṣṭ/ā- View this entry on the original dictionary page scan.
aṣṭakapālamfn. equals aṣṭ/ā-kap- q.v commentator or commentary View this entry on the original dictionary page scan.
aṣṭakarmaparibhraṣṭam. a jaina-, View this entry on the original dictionary page scan.
aṣṭakarṇamfn. branded on the ear View this entry on the original dictionary page scan.
aṣṭakarṇam. "eight-eared", Name of brahman- (who is supposed to have four heads) View this entry on the original dictionary page scan.
aṣṭakarṇīf. a cow branded on the ear View this entry on the original dictionary page scan.
astakaruṇamfn. pitiless, cruel, View this entry on the original dictionary page scan.
aṣṭakāśrāddhan. a śrāddha- performed at the aṣṭakā- festival, View this entry on the original dictionary page scan.
aṣṭakhaṇḍam. Name of a collection of different passages of the View this entry on the original dictionary page scan.
aṣṭakinmfn. one who performs an aṣṭakā-, (gaRa vrīhy-ādi- q.v) View this entry on the original dictionary page scan.
āṣṭakīyamfn. belonging to or coming from the above country View this entry on the original dictionary page scan.
aṣṭakoṇam. an octogon View this entry on the original dictionary page scan.
astakopamfn. one whose anger is laid aside, commentator or commentary on View this entry on the original dictionary page scan.
aṣṭakṛtvasind. eight times (see aṣṭ/au k/ṛtvas- idem or 'm. a jaina-, ', ) View this entry on the original dictionary page scan.
astakṣitibhṛtm. "the mountain asta-", the western mountain (behind which the sun is supposed to set), View this entry on the original dictionary page scan.
aṣṭakyamfn. relating to an aṣṭakā-, (gaRa gav-ādi-, q.v) View this entry on the original dictionary page scan.
aṣṭakf. a cow employed at the A f, View this entry on the original dictionary page scan.
aṣṭamakamfn. the eighth View this entry on the original dictionary page scan.
aṣṭamakālikamfn. one who omitting seven meals partakes only of the eighth View this entry on the original dictionary page scan.
astamastakamn. (the head id est) the top of the mountain asta-, View this entry on the original dictionary page scan.
aṣṭāpakṣa(aṣṭ/ā--) mf(ā-)n. having eight side-pillars View this entry on the original dictionary page scan.
aṣṭāracakravatmfn. "having a wheel with eight spokes", a Name of mañjuśrī- View this entry on the original dictionary page scan.
āstārakam. a fire-receptacle, grate View this entry on the original dictionary page scan.
aṣṭasāhasrakamf(ikā-)n. consisting of eight thousand (id est śloka-s, as one of the Buddhist prajñāpāramitā-s) . View this entry on the original dictionary page scan.
aṣṭaśatakan. a hundred and eight View this entry on the original dictionary page scan.
aṣṭāvakram. Name of a Brahman (a son of kahoḍa-) View this entry on the original dictionary page scan.
aṣṭāvakram. of another man View this entry on the original dictionary page scan.
asthibhakṣam. "eating bones", a dog View this entry on the original dictionary page scan.
asthisaṃhārakam. idem or 'f. idem or 'm. idem or 'm. Name (also title or epithet) of a plant, ' ' ' View this entry on the original dictionary page scan.
asthisaṃhārakam. "bone-seizer", the adjutant bird View this entry on the original dictionary page scan.
asthisnehakam. marrow View this entry on the original dictionary page scan.
astracikitsakam. a surgeon View this entry on the original dictionary page scan.
astrakaṇṭakam. an arrow View this entry on the original dictionary page scan.
astrakāra m. a maker of weapons, armourer View this entry on the original dictionary page scan.
astrakārakam. a maker of weapons, armourer View this entry on the original dictionary page scan.
astrakārinm. idem or 'm. a maker of weapons, armourer ' View this entry on the original dictionary page scan.
astrakṣatimatmfn. wounded by arrows, View this entry on the original dictionary page scan.
astrakṣepakamfn. shooting arrows View this entry on the original dictionary page scan.
astrasāyakam. an iron arrow View this entry on the original dictionary page scan.
aśubhacintakam. Name (also title or epithet) of a fortune-teller, View this entry on the original dictionary page scan.
aśubhātmakamfn. evil-minded, View this entry on the original dictionary page scan.
aśuddhaprakṛtimfn. having dishonest ministers, View this entry on the original dictionary page scan.
aśuddhavāsakam. "having impure abodes", a vagrant, suspicious character. View this entry on the original dictionary page scan.
asurakṣamf(ā-)n. difficult to guard or preserve, perishable View this entry on the original dictionary page scan.
asurakṣayaṇamfn. destroying the asura-s View this entry on the original dictionary page scan.
asurakṣiti(/asura--.) mfn. idem or 'mfn. destroying the asura-s ' View this entry on the original dictionary page scan.
asurakumāram. plural the first of the ten classes of bhavanavāsin- deities View this entry on the original dictionary page scan.
asurarakṣasan. a demoniacal being having the qualities of an asura- as well as of a rakṣas- View this entry on the original dictionary page scan.
asurarakṣasan. plural (/āni-) asura-s and rākṣasa-s View this entry on the original dictionary page scan.
asūyakamfn. () discontented, displeased, envious, calumnious View this entry on the original dictionary page scan.
aśvabandhakam. idem or 'm. equals -nibandhika- q.v ' View this entry on the original dictionary page scan.
aśvacakram. Name of a man View this entry on the original dictionary page scan.
āsvādakamfn. tasting, enjoying View this entry on the original dictionary page scan.
aśvādhyakṣam. a guardian of horses, N. View this entry on the original dictionary page scan.
aśvahārakam. a horse-stealer View this entry on the original dictionary page scan.
aśvakam. a small or bad horse View this entry on the original dictionary page scan.
aśvakaa toy-horse, View this entry on the original dictionary page scan.
aśvakam. a sparrow View this entry on the original dictionary page scan.
aśvakam. plural Name of a people (see aśmaka-) View this entry on the original dictionary page scan.
asvakamf(akā-or ikā- )n. equals asva-, q.v View this entry on the original dictionary page scan.
aśvakandam. Physalis Flexuosa, View this entry on the original dictionary page scan.
aśvakandikāf. equals -ganghā- , q.v View this entry on the original dictionary page scan.
aśvakarṇam. the ear of a horse View this entry on the original dictionary page scan.
aśvakarṇamfn. "resembling the ear of a horse", said of a particular fracture of the bones View this entry on the original dictionary page scan.
aśvakarṇam. the tree Vatica Robusta (so called from the shape of its leaves) View this entry on the original dictionary page scan.
aśvakarṇam. Name of a mountain View this entry on the original dictionary page scan.
aśvakarṇakamfn. (equals -karṇa- mfn.) said of a particular fracture of the bones View this entry on the original dictionary page scan.
aśvakarṇakam. the tree Vatica Robusta, View this entry on the original dictionary page scan.
aśvakaśaf. a whip for a horse View this entry on the original dictionary page scan.
aśvakeśam. plural Name of a people View this entry on the original dictionary page scan.
aśvakhuram. a horse's hoof. View this entry on the original dictionary page scan.
aśvakhuram. a perfume (apparently a dried shell-fish) View this entry on the original dictionary page scan.
aśvakhurīf. the plant Clitoria Ternatea View this entry on the original dictionary page scan.
aśvakinīf. the nakṣatra- aśvinī- View this entry on the original dictionary page scan.
aśvakovidamfn. skilled in horses View this entry on the original dictionary page scan.
aśvakranda(/aśva--) m. Name of a mythical being ("Name of yakṣa-"commentator or commentary) View this entry on the original dictionary page scan.
aśvakrāntamfn. trodden by horses, View this entry on the original dictionary page scan.
aśvakrītamf(ī- )n. bought (in exchange) for a horse View this entry on the original dictionary page scan.
aśvakṣabhamf(-)n.? View this entry on the original dictionary page scan.
aśvakuṇapan. the carcass of a horse View this entry on the original dictionary page scan.
aśvakuñjaram. an excellent horse, View this entry on the original dictionary page scan.
aśvakuṭīf. a stable for horses View this entry on the original dictionary page scan.
āśvalakṣaṇikamfn. (fr. aśva-lakṣaṇa-), knowing the marks of horses commentator or commentary on View this entry on the original dictionary page scan.
āśvalāyanagṛhyakārikāf. Name of work View this entry on the original dictionary page scan.
aśvamārakam. equals -ghna- q.v View this entry on the original dictionary page scan.
aśvamedhakam. (equals aśvamedha-ja-above) Name of a king View this entry on the original dictionary page scan.
aśvamedhakāṇḍan. (aśvamedha-) Name of (treating of the aśvamedha-) View this entry on the original dictionary page scan.
aśvamohakam. equals -ghna- q.v View this entry on the original dictionary page scan.
aśvanāśakam. equals -ghna- View this entry on the original dictionary page scan.
aśvantakam. equals aśva-ghna- q.v View this entry on the original dictionary page scan.
aśvapoṣakam. a groom, , Scholiast or Commentator View this entry on the original dictionary page scan.
aśvaprakāṇḍan. (= kuñjara-), View this entry on the original dictionary page scan.
aśvapucchakam. Name of a plant View this entry on the original dictionary page scan.
asvarakamfn. unaccentuated View this entry on the original dictionary page scan.
aśvarakṣam. a groom View this entry on the original dictionary page scan.
aśvarodhakam. equals -ghna- q.v View this entry on the original dictionary page scan.
aśvaśakan. excrements of a horse, View this entry on the original dictionary page scan.
āśvāsakamfn. causing to take breath or courage, consolatory, comforting View this entry on the original dictionary page scan.
aśvaśakṛtn. idem or 'n. excrements of a horse, ' View this entry on the original dictionary page scan.
aśvaśakṛtf. Name of a river View this entry on the original dictionary page scan.
aśvatthakamfn. to be done (as paying debts) when the aśvattha- tree bears View this entry on the original dictionary page scan.
aśvatthakalpam. Name (also title or epithet) of work View this entry on the original dictionary page scan.
aśvatthakuṇam. the fruit season of the holy fig tree, (gaRa pīlv-ādi- q.v) View this entry on the original dictionary page scan.
aśvavaktram. (-mukha- q.v) a kiṃnara- View this entry on the original dictionary page scan.
aśvavārakam. a groom View this entry on the original dictionary page scan.
aśvāvarohakam. equals aśva-gandhā- q.v View this entry on the original dictionary page scan.
aśvavṛndārakam. (= - kuñjara-), View this entry on the original dictionary page scan.
āśvayujakamfn. sown on the day called āśvayujī- View this entry on the original dictionary page scan.
aśvinakṛtamfn. (irreg. for aśv/i-k-) done by the aśvin-s View this entry on the original dictionary page scan.
āsyamodakan. a mythical weapon View this entry on the original dictionary page scan.
āṭakamf(ikā-)n. going. See kāraskarāṭikā-. View this entry on the original dictionary page scan.
āṭakam. a sparrow, View this entry on the original dictionary page scan.
ātakam. Name of a nāga- demon View this entry on the original dictionary page scan.
aṭakamfn. roaming View this entry on the original dictionary page scan.
ātak(imperative 2. plural -takṣata-,3. plural -takṣantu-) to procure View this entry on the original dictionary page scan.
ātakto cut, carve, form by carving, View this entry on the original dictionary page scan.
atarkyasahasraśaktim. endowed with a thousand in comp.ehensible powers. View this entry on the original dictionary page scan.
athakimind. how else? what else? certainly, assuredly, sure enough. View this entry on the original dictionary page scan.
athakimuind. how much more View this entry on the original dictionary page scan.
athakimuind. so much the more. View this entry on the original dictionary page scan.
atibālakam. an infant View this entry on the original dictionary page scan.
atibālakamfn. infantine. View this entry on the original dictionary page scan.
atichattrakam. a mushroom View this entry on the original dictionary page scan.
atichattrakāf. Anise (Anisum or Anethum Sowa) View this entry on the original dictionary page scan.
atichattrakaf. the plant Barleria Longifolia. View this entry on the original dictionary page scan.
atikandakam. the plant hastikanda-. View this entry on the original dictionary page scan.
atikrāmakamfn. exceeding, transgressing View this entry on the original dictionary page scan.
āṭīlakan. equals ā-ṭīkana- q.v View this entry on the original dictionary page scan.
atilakṣmīmfn. very prosperous View this entry on the original dictionary page scan.
atilakṣmīf. (īs-) extraordinary prosperity. View this entry on the original dictionary page scan.
atimanorathakramam. excess of desire, ibidem or 'in the same place or book or text' as the preceding v, 35. View this entry on the original dictionary page scan.
atimuktakam. = the preceding View this entry on the original dictionary page scan.
atimuktakam. mountain ebony View this entry on the original dictionary page scan.
atimuktakam. the tree harimantha-. View this entry on the original dictionary page scan.
atimuktakam. "surpassing pearls in whiteness", Name of certain shrubs. View this entry on the original dictionary page scan.
atipātakan. a very heinous sin. View this entry on the original dictionary page scan.
atiprakāśamfn. very notorious. View this entry on the original dictionary page scan.
atiprasaktif. excessive attachment View this entry on the original dictionary page scan.
atiprasaktif. unwarrantable stretch of a rule. View this entry on the original dictionary page scan.
atirājakumārimfn. superior to a princess View this entry on the original dictionary page scan.
atiraktamfn. very red View this entry on the original dictionary page scan.
atirakf. one of agni-'s seven tongues. View this entry on the original dictionary page scan.
atiśakkarīor ati-śakvar- f. a class of metres of four lines, each containing fifteen syllables. It has eighteen varieties. View this entry on the original dictionary page scan.
atiśakramfn. superior to indra-. View this entry on the original dictionary page scan.
atiśakta mfn. very powerful View this entry on the original dictionary page scan.
atiṣaktaor (in later texts) atisakta- mfn. ( sañj-), connected with View this entry on the original dictionary page scan.
atiśaktimfn. very powerful View this entry on the original dictionary page scan.
atiśaktif. great power or valour. View this entry on the original dictionary page scan.
atisaktif. excessive attachment. View this entry on the original dictionary page scan.
atiśaktibhājmfn. possessing great power. View this entry on the original dictionary page scan.
atisaktimatmfn. excessively attached. View this entry on the original dictionary page scan.
atiśaktitāf. great power or valour. View this entry on the original dictionary page scan.
atisārakin mfn. afflicted with purging or dysentery. View this entry on the original dictionary page scan.
atīsārakin mfn. afflicted with purging or dysentery. View this entry on the original dictionary page scan.
atiślakṣṇa(/ati--) mfn. too tender View this entry on the original dictionary page scan.
atītakalam. the past time or tense. View this entry on the original dictionary page scan.
ativaicakṣaṇyan. great proficiency. View this entry on the original dictionary page scan.
ativakramfn. very crooked or curved View this entry on the original dictionary page scan.
ativakf. one of the eight descriptions of planetary motion. View this entry on the original dictionary page scan.
ativaktṛmfn. very loquacious. View this entry on the original dictionary page scan.
ativālakaSee -bālaka- above. View this entry on the original dictionary page scan.
ātmadakṣiṇamfn. (a sacrifice) in which one offers one's self as dakṣiṇā- View this entry on the original dictionary page scan.
ātmaghātakam. a suicide. View this entry on the original dictionary page scan.
ātmakamf(ikā-)n. belonging to or forming the nature of (genitive case) View this entry on the original dictionary page scan.
ātmakamf(ikā-)n. having or consisting of the nature or character of (in compound) ([ see saṃkalpātmaka-]) View this entry on the original dictionary page scan.
ātmakamf(ikā-)n. consisting or composed of (see pañcātmaka-etc.) View this entry on the original dictionary page scan.
ātmakāmamf(ā-)n. loving one's self, possessed of self-conceit View this entry on the original dictionary page scan.
ātmakāmamf(ā-)n. loving the supreme spirit () View this entry on the original dictionary page scan.
ātmakāmamfn. desirous of emancipation, View this entry on the original dictionary page scan.
ātmakāmeyam. plural Name of a people, (gaRa rājanyādi- q.v) View this entry on the original dictionary page scan.
ātmakāmeyakamfn. inhabited by the ātmakāmeya-s View this entry on the original dictionary page scan.
ātmakarmann. one's own act. View this entry on the original dictionary page scan.
ātmakāryan. one's own business, private affairs.
ātmakīyamfn. one's own View this entry on the original dictionary page scan.
ātmakrīḍamfn. playing with the supreme spirit, View this entry on the original dictionary page scan.
ātmakṛtamfn. (ātm/a--) done or committed against one's self View this entry on the original dictionary page scan.
ātmakṛtamfn. done of one's self, self-executed View this entry on the original dictionary page scan.
ātmāpahārakamfn. self-concealing, dissembling, pretending to belong to a higher class than one's own View this entry on the original dictionary page scan.
ātmapakṣam. one's own party View this entry on the original dictionary page scan.
ātmapañcakan. Name (also title or epithet) of work by śaṃkarācārya- View this entry on the original dictionary page scan.
ātmaprakāśamfn. self-shining, self-luminous View this entry on the original dictionary page scan.
ātmaprakāśam. Name of a commentary on View this entry on the original dictionary page scan.
ātmapraśaṃsakamfn. self-praising, boasting View this entry on the original dictionary page scan.
ātmarakṣāf. the plant Trichosanthes Bracteata (a creeper with poisonous fruit) View this entry on the original dictionary page scan.
ātmarakakamfn. "body guard", protector [PrakritAya-rakkhaya]. View this entry on the original dictionary page scan.
ātmarakṣaṇan. taking care of one's self View this entry on the original dictionary page scan.
ātmaśaktif. one's own power or effort () View this entry on the original dictionary page scan.
ātmavañcakamfn. deceiving one's self View this entry on the original dictionary page scan.
aṭṭahāsakam. the shrub Jasminum Multiflorum or Hirsutum. View this entry on the original dictionary page scan.
aṭṭakam. an apartment on the roof View this entry on the original dictionary page scan.
aṭṭakam. tower. View this entry on the original dictionary page scan.
āttakāntimfn. deprived of splendour, View this entry on the original dictionary page scan.
aṭṭālakam. or aṭṭāla- a watchtower View this entry on the original dictionary page scan.
āttalakṣmimfn. stripped of wealth View this entry on the original dictionary page scan.
aṭṭapālakam. overseer of a market, View this entry on the original dictionary page scan.
aṭṭapatibhāgākhyagṛhakṛtyan. business of the house called the market-master's department (an office in Kashmir) View this entry on the original dictionary page scan.
atūrtadakṣam. "having designs that cannot be obstructed", Name of the aśvin-s View this entry on the original dictionary page scan.
atuṣārakaram. "having not cold rays", the sun. View this entry on the original dictionary page scan.
atvakka([ ]) or a-tv/ac- ([ ]) mfn. skinless.
atyakṣaramfn. inarticulate, View this entry on the original dictionary page scan.
atyantakopanamfn. very passionate. View this entry on the original dictionary page scan.
audakamf(ī-)n. (fr. udaka-), living or growing in water, relating to water, aquatic, watery etc. View this entry on the original dictionary page scan.
audakāf. a town surrounded by water View this entry on the original dictionary page scan.
audakajamfn. coming from aquatic plants View this entry on the original dictionary page scan.
audakim. a descendant of udaka- gaRa bāhv-ādi- View this entry on the original dictionary page scan.
audakim. plural Name of a warrior tribe gaRa dāmany-ādi- View this entry on the original dictionary page scan.
audakīyam. a king of the audaki-s View this entry on the original dictionary page scan.
audañcanakamfn. relating to a bucket gaRa arīhaṇādi- View this entry on the original dictionary page scan.
audayakam. plural (fr. ud-aya-), a school of astronomers (who reckoned the first motion of the planets from sunrise). View this entry on the original dictionary page scan.
auḍāyanabhaktamfn. inhabited by auḍāyana-s (as a country) View this entry on the original dictionary page scan.
auddālakan. (fr. ud-dālaka-), a kind of honey (taken from certain bees which live in the earth) View this entry on the original dictionary page scan.
auddālakan. Name of a tīrtha- View this entry on the original dictionary page scan.
auddālakāyanam. a descendant of auddālaki- View this entry on the original dictionary page scan.
auddālakim. a descendant of uddālaka-, Name of several men View this entry on the original dictionary page scan.
auddaṇḍakamfn. (fr. ud-daṇḍa-), relating to one who holds up a staff gaRa arīhaṇādi- View this entry on the original dictionary page scan.
audīcyaprakāśam. Name of work View this entry on the original dictionary page scan.
audumbarakam. the country inhabited by the udumbara-s gaRa rājanyādi- View this entry on the original dictionary page scan.
aujjayanakamfn. relating to or coming from the town ujjayanī- gaRa dhūmādi- View this entry on the original dictionary page scan.
aukhyeyakamfn. equals ukhyā-jāta- gaRa kattry-ādi- View this entry on the original dictionary page scan.
aukṣakan. a multitude of bulls View this entry on the original dictionary page scan.
aumakamfn. idem or 'mf(ī-)n. (fr. umā-), made of flax, flaxen ' View this entry on the original dictionary page scan.
aumbheyakamfn. (fr. umbhi- gaRa kattry-ādi- ), relating to one who fills up ( ?) View this entry on the original dictionary page scan.
aupādhyāyakamfn. (fr. upādhyāya-), coming from a teacher on View this entry on the original dictionary page scan.
aupagavakan. an assemblage of aupagava-s View this entry on the original dictionary page scan.
aupagavakam. an admirer or worshipper of upagu- on View this entry on the original dictionary page scan.
aupakalāpyamfn. (fr. upakalāpa- gaRa parimukhādi- on ), being on or near the girdle (?). View this entry on the original dictionary page scan.
aupakārikamfn. beneficial, useful, View this entry on the original dictionary page scan.
aupakarṇikamfn. (fr. upakarṇa-), being on or near the ears View this entry on the original dictionary page scan.
aupakāryan. a preparatory or secondary action, View this entry on the original dictionary page scan.
aupakāryāf. equals upa-kāryā- q.v View this entry on the original dictionary page scan.
aupakāyanam. a descendant of upaka-, Name of an author View this entry on the original dictionary page scan.
aupakurvāṇaka equals upakurvāṇaka- q.v View this entry on the original dictionary page scan.
aupānuvākyakāṇḍan. equals upānuvākya- commentator or commentary on View this entry on the original dictionary page scan.
aupapakṣyamfn. (fr. upa-pakṣa-), being in the armpit (as hair) View this entry on the original dictionary page scan.
aupariṣṭakan. (scilicet rata-) a kind of coitus, View this entry on the original dictionary page scan.
aupavastrakan. food suitable for a fast View this entry on the original dictionary page scan.
aurabhrakan. a flock of sheep View this entry on the original dictionary page scan.
aurdhvabhaktikamfn. (fr. ūrdhva-bhakta-), used or applied after a meal View this entry on the original dictionary page scan.
aurdhvadehikakalpavallif. Name of work View this entry on the original dictionary page scan.
aurdhvakālikamf(ā-and ī-)n. (fr. ūrdhva-kāla-), relating to subsequent time gaRa kāśy-ādi- View this entry on the original dictionary page scan.
aurṇakamf(ī-)n. idem or 'mf(ī-)n. (fr. ūrṇā-), made of wool, woollen ' View this entry on the original dictionary page scan.
aurṇanābhakamfn. inhabited by the ūrṇanābha-s (as a country) gaRa rājanyādi- View this entry on the original dictionary page scan.
aurvakalpagrantham. Name (also title or epithet) of work on medicine. View this entry on the original dictionary page scan.
aurvaprakāram. Name (also title or epithet) of work on medicine. View this entry on the original dictionary page scan.
auṣadhakalpagrantham. Name (also title or epithet) of work on medicine. View this entry on the original dictionary page scan.
auṣadhapeṣakam. one who grinds or pounds medicaments View this entry on the original dictionary page scan.
auṣadhaprakāram. Name (also title or epithet) of work on medicine. View this entry on the original dictionary page scan.
auṣarakan. fossil salt View this entry on the original dictionary page scan.
auṣṭrakamfn. coming from a camel View this entry on the original dictionary page scan.
auṣṭrakan. a herd or multitude of camels View this entry on the original dictionary page scan.
auṣṭrāyaṇakamfn. relating to the above View this entry on the original dictionary page scan.
auttarabhaktikamfn. (fr. bhakta-with uttara-), employed or taken after a meal View this entry on the original dictionary page scan.
auveṇakan. a kind of song (gītaka-) View this entry on the original dictionary page scan.
avabhāsakamfn. (in vedānta- philosophy) illuminating, making manifest.
avabhāsakaram. Name of a devaputra- View this entry on the original dictionary page scan.
avabhedakamfn. "piercing (the head)", aching (as hemiplegia) (see ardha-bheda-.) View this entry on the original dictionary page scan.
avabodhakamfn. awakening (as faculties), teaching View this entry on the original dictionary page scan.
avācakamfn. not expressive of. View this entry on the original dictionary page scan.
avacakA1. -c/aṣṭe- (imperfect tense -cakṣata-; Aorist 1. sg. -acacakṣam-,2. sg. -cakṣi-;Ved.Inf. -c/akṣe-) to look down upon ; to perceive (Inf. in Passive voice sense:"to be seen by") View this entry on the original dictionary page scan.
avacakṣaṇamind. (gaRa gotādi- q.v) View this entry on the original dictionary page scan.
avacanakaramfn. not doing what one is bid or advised. View this entry on the original dictionary page scan.
avacarakam. a footman, runner, View this entry on the original dictionary page scan.
avacchedakamfn. distinguishing, particularising, determining View this entry on the original dictionary page scan.
avacchedakam. "that which distinguishes", a predicate, characteristic, property View this entry on the original dictionary page scan.
avacchuritakan. a horse-laugh View this entry on the original dictionary page scan.
avacīravicīrakamfn. dilapidation, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
avacūlakan. a chowri or brush (formed of a cow's tail, peacock's feathers, etc., for warding off flies)
avadānakalpalatāf. "storehouse of legends of buddha-'s life and acts", Name (also title or epithet) of a celebrated work, n. 1. View this entry on the original dictionary page scan.
avadārakamfn. splitting open id est digging (the earth) View this entry on the original dictionary page scan.
avadhārakamfn. determining, bearing upon, meaning View this entry on the original dictionary page scan.
avadhārakamfn. restricting View this entry on the original dictionary page scan.
avadyotakamfn. illustrating, making clear commentator or commentary on View this entry on the original dictionary page scan.
avagamakamfn. making known, conveying a sense, expressive of. View this entry on the original dictionary page scan.
avagrahaśaka Name (also title or epithet) of a pariśiṣṭa- of the View this entry on the original dictionary page scan.
avahārakamfn. one who stops fighting etc. View this entry on the original dictionary page scan.
avahārakam. a marine monster (see yuddhāvahdrika-.)
avaibhīdakamfn. not having its origin on a vibhīdaka- tree View this entry on the original dictionary page scan.
avakam. a grassy plant growing in marshy land (Blyxa Octandra Rich., otherwise called śaivāla-) View this entry on the original dictionary page scan.
avakāf. (gaRa kṣipakādi- q.v) idem or 'm. a grassy plant growing in marshy land (Blyxa Octandra Rich., otherwise called śaivāla-) '
avakādamfn. eating the above plant View this entry on the original dictionary page scan.
avakalanan. burning with kuśa- grass, View this entry on the original dictionary page scan.
avakalitamfn. (2. kal-), seen, observed View this entry on the original dictionary page scan.
avakalkanan. mingling, mixing together View this entry on the original dictionary page scan.
avakalpitaSee ava-kḷp-. View this entry on the original dictionary page scan.
avakalpitamfn. (gaRa śreṇy'-ādi- q.v) View this entry on the original dictionary page scan.
avakāṅkṣto desire, long for ; p. negative an-avakāṅkṣamāṇa-, not wishing impatiently (said of ascetics who, having renounced all food, expect death without impatience) View this entry on the original dictionary page scan.
avakaraSee ava-kṝ-. View this entry on the original dictionary page scan.
avakaraa kind of plant (growing on garbage heaps), View this entry on the original dictionary page scan.
avakaram. dust or sweepings View this entry on the original dictionary page scan.
avakarakuṭam. heap of sweepings View this entry on the original dictionary page scan.
avakarṇayaNom. P. yati-, not to listen or attend to View this entry on the original dictionary page scan.
avakarṣaṇan. taking off, etc. View this entry on the original dictionary page scan.
avakartaetc. See ava-kṛt-. View this entry on the original dictionary page scan.
avakartam. a part cut off, strip, N. View this entry on the original dictionary page scan.
avakartanan. cutting off, N. View this entry on the original dictionary page scan.
avakartinSee carmāvak-
avakarttṛSee carmāvak-. View this entry on the original dictionary page scan.
avakāś -kāśate-, to be visible, be manifest : Causal P. -kāśayati- (future parasmE-pada -kāśayiṣyat-) to cause to look at : Intensive parasmE-pada -c/ākaśat- shining ; seeing . View this entry on the original dictionary page scan.
avakāśam. (in fine compositi or 'at the end of a compound' f(ā-).) place, space View this entry on the original dictionary page scan.
avakāśam. room, occasion, opportunity, (avakāsā-1. kṛ-or -to make room, give way, admit etc.; avakāśaṃ- labh-or āp-,to get a footing, obtain a favourable opportunity etc.;to find scope, happen take place; avakāśaṃ- rudh-,not to give way, hinder ) . View this entry on the original dictionary page scan.
avakāśam. aperture ( avakāśena śena- instrumental case ind.between ) View this entry on the original dictionary page scan.
avakāśam. intermediate time View this entry on the original dictionary page scan.
avakāśam. "a glance cast on anything", Name of certain verses, during the recitation of which the eyes must be fixed on particular objects (which therefore are called avakāśya- q.v) View this entry on the original dictionary page scan.
avakāśadamfn. giving opportunity, granting the use of (in compound) View this entry on the original dictionary page scan.
avakāśavat(avakās/a--) mfn. spacious View this entry on the original dictionary page scan.
avakāśeind. (probably) about dawn, View this entry on the original dictionary page scan.
avakāśenaind. avakāśa
avakāśyamfn. "to be looked at", admitted in the recitation of the avakāśa- verses View this entry on the original dictionary page scan.
avakaṭamfn. (formed like ut-kaṭa-, pra-kaṭa-, vi-kaṭa-, saṃ-kaṭa-) View this entry on the original dictionary page scan.
avakaṭikāf. dissimulation View this entry on the original dictionary page scan.
avakeśamfn. having the hair hanging down View this entry on the original dictionary page scan.
avakeśinmfn. "having its filaments (keśa-= kesara- q.v) turned downwards (so that they remain uncopulated)", unfruitful, barren (as a plant) View this entry on the original dictionary page scan.
avakeśinm. a barren tree, View this entry on the original dictionary page scan.
avakhādam. "a devourer, destroyer" ([ ]), or mfn. "devouring, destroying" ([ ]) View this entry on the original dictionary page scan.
avakhāda according to to others from khad- = khid-,"hindrance, annoyance". View this entry on the original dictionary page scan.
avakhaṇḍ -khaṇḍayati-, to break into pieces ; to annihilate, destroy commentator or commentary on View this entry on the original dictionary page scan.
avakhaṇḍanan. breaking into pieces View this entry on the original dictionary page scan.
avakhaṇḍanan. destroying commentator or commentary on View this entry on the original dictionary page scan.
avakhyā(Imper. 2. plural -khy/ata-; imperfect tense ava-khyat-) to look down ; (with accusative) to see, perceive : Causal -khyāpayati-, to cause to look at View this entry on the original dictionary page scan.
avakīlakam. a peg or plug View this entry on the original dictionary page scan.
avakinmfn. filled with avakā- plants commentator or commentary on View this entry on the original dictionary page scan.
avakiraṇaSee ava-- 1. kṝ-. View this entry on the original dictionary page scan.
avakiraṇaetc. See View this entry on the original dictionary page scan.
avakiraṇan. sweepings View this entry on the original dictionary page scan.
avakīrṇamfn. who has spilt his semen virile, i.e. violated his vow of chastity , poured upon, covered with, filled , (see sapta dvārāvakīrṇa-) View this entry on the original dictionary page scan.
avakīrṇamfn. = ā-- k-, View this entry on the original dictionary page scan.
avakirṇajaṭābhāramfn. whose tresses of hair are scattered or have become loose View this entry on the original dictionary page scan.
avakīrṇinmfn. (equals /ava-kīrṇa-) who has violated his vow of chastity View this entry on the original dictionary page scan.
avakledam. trickling, descent of moisture View this entry on the original dictionary page scan.
avakledam. fetid discharge View this entry on the original dictionary page scan.
avakledakledanan. trickling, descent of moisture View this entry on the original dictionary page scan.
avakledakledanan. fetid discharge View this entry on the original dictionary page scan.
avaklinnapakvamfn. trickling because of being over-ripe, (gaRa rājadantādi- q.v) View this entry on the original dictionary page scan.
avakḷp -kalpate-, to correspond to, answer, be right etc. ; to be fit for, serve to (dative case) : Causal , -kalpayati-, to put in order, prepare, make ready etc. ; to employ becomingly ; to consider as possible : Desiderative of Causal (imperfect tense 3. plural avācikalpayiṣan-) to wish to prepare or to make ready View this entry on the original dictionary page scan.
avakḷptif. considering as possible (an-- negative) View this entry on the original dictionary page scan.
avakokilamfn. (equals avakruṣṭaḥ kokilayā-) called down to by the koil (singing in a tree above ?) commentator or commentary View this entry on the original dictionary page scan.
avakolbamf(ā-)n. covered or surrounded with avakā- plants View this entry on the original dictionary page scan.
avakolbaSee /avaka-. View this entry on the original dictionary page scan.
avak(ind . p. -kṛtvā [mukhāny] ava-) to direct downwards (as the face) View this entry on the original dictionary page scan.
avak -kirati- (imperfect tense avākirat-; ind.p. -kīrya-) to pour out or down, spread, scatter, etc. ; (Potential -k/iret-) to spill one's semen virile (see /ava-kīrṇa-and rṇin-below) ; to shake off, throw off, leave ; to bestrew, pour upon, cover with, fill etc.: Passive voice -kīryate- (perf. -cakre- ,according to commentator or commentary also A1. -kirate- Aorist avākirṣṭa-) to extend in different directions, disperse, pass away ; A1. (Aorist 3. plural avākīrṣata-) to fall off, become faithless, , (see ava-s-kṝ-) View this entry on the original dictionary page scan.
avakramfn. not crooked, straight View this entry on the original dictionary page scan.
avakramfn. upright, honest. View this entry on the original dictionary page scan.
avakragamitāf. having a straight gait (one of the 80 minor marks of a buddha-), . View this entry on the original dictionary page scan.
avakrakṣinmfn. (see kr/akṣamāṇa-) rushing down View this entry on the original dictionary page scan.
avakram(optative, -krāmet-) to step down upon (accusative) ; (Aorist 3. plural -kramuḥ-[ see ]; pr. p. kr/āmat-) to tread down, overcome ; to descend (into a womb) : Causal (parasmE-pada -kramayat-) to cause to go down
avakramaṇan. descending (into a womb), conception View this entry on the original dictionary page scan.
avakrāminmfn. running away View this entry on the original dictionary page scan.
avakrand(Imper. -krandatu-,2. sg. -kranda-; Aorist -cakradat, 2. sg: cakradas-) to cry out, roar Caus. (Aorist acikradat-) to rush down upon (accusative) with a loud cry View this entry on the original dictionary page scan.
avakrandam. roaring, neighing View this entry on the original dictionary page scan.
avakrandanan. crying, weeping aloud View this entry on the original dictionary page scan.
avakrāntif. idem or 'n. descending (into a womb), conception ' View this entry on the original dictionary page scan.
avakrayam. letting out to hire View this entry on the original dictionary page scan.
avakrayam. rent, revenue View this entry on the original dictionary page scan.
avakonly A1. -kriṇīte- (;but also P. Potential -krīṇīyāt- ,[ apa-krīṇīyāt- ]; ind.p. -krīya- ) to purchase for one's self hire, bribe. View this entry on the original dictionary page scan.
avakrīḍA1. to play (?) View this entry on the original dictionary page scan.
avakriyāf. non-performance of prescribed acts View this entry on the original dictionary page scan.
avakriyāSee ava-- 1. kṛ-. View this entry on the original dictionary page scan.
avakrośam. a discordant noise View this entry on the original dictionary page scan.
avakrośam. an imprecation View this entry on the original dictionary page scan.
avakrośam. abuse View this entry on the original dictionary page scan.
avakṛptamfn. corresponding with, right, fit View this entry on the original dictionary page scan.
avakṛptamfn. (/an-- negative) View this entry on the original dictionary page scan.
avakṛśCaus. (3. plural -karś/ayanti-) to emaciate, make lean or mean-looking View this entry on the original dictionary page scan.
avakṛṣ -karṣati- (ind.p. -kṛṣya-;once[ ] Passive voice Opt. -kṛṣyeta-in the sense of P.or A1.) to draw off or away, take off (as a garment or wreath, etc.) etc. ; to turn off, remove ; to drag down (See avakṛṣṭa-below) ; to entice, allure View this entry on the original dictionary page scan.
avakṛṣṭamfn. dragged down, being underneath anything (in comp.) View this entry on the original dictionary page scan.
avakṛṣṭamfn. "removed", being at some distance View this entry on the original dictionary page scan.
avakṛṣṭamfn. (also Comparative degree avakṛṣṭatara avakṛṣṭa-tara- mfn. "farther off from" [ ablative ] commentator or commentary on ) View this entry on the original dictionary page scan.
avakṛṣṭamfn. inferior, low, outcast View this entry on the original dictionary page scan.
avakṛṣṭataramfn. avakṛṣṭa View this entry on the original dictionary page scan.
avakṛt(ind.p. -kṛtya-) to cut off ; (p. -kṛntat-) to destroy Caus. (Opt. -kartayet-) to cause to cut off View this entry on the original dictionary page scan.
avakṛtamfn. directed downwards as a root View this entry on the original dictionary page scan.
avakṛttamfn. cut off View this entry on the original dictionary page scan.
avakruṣṭamfn. "called down to" See ava-kokila-. View this entry on the original dictionary page scan.
avakṣaionly past participle View this entry on the original dictionary page scan.
avakṣālanan. (2. kṣal-), washing by immersion or dipping in. View this entry on the original dictionary page scan.
avakṣāmamfn. (see ) meagre, lean View this entry on the original dictionary page scan.
avakṣāṇamfn. burnt down View this entry on the original dictionary page scan.
avakṣarCaus. (ind.p. -kṣā rayitvā-) to cause to flow down upon (accusative) View this entry on the original dictionary page scan.
avakṣayam. destruction, waste, loss View this entry on the original dictionary page scan.
avakṣāyamind. so as to give a blow View this entry on the original dictionary page scan.
avakṣayaṇaSee aṅgārāvakṣ/ayaṇa-. View this entry on the original dictionary page scan.
avakṣepam. blaming, reviling, scolding commentator or commentary View this entry on the original dictionary page scan.
avakṣepaṇan. throwing down, overcoming View this entry on the original dictionary page scan.
avakṣepaṇan. reviling, blame, despising View this entry on the original dictionary page scan.
avakṣepaṇīf. bridle View this entry on the original dictionary page scan.
avakṣi(Potential -kṣiṇuyāt-) to remove : Passive voice -kṣīyate-, to waste away View this entry on the original dictionary page scan.
avakṣīṇamfn. wasted, emaciated View this entry on the original dictionary page scan.
avakṣip -kṣipati- (subjunctive -kṣi p/at- ; parasmE-pada -kṣip/at- mfn. ) to throw down, cause to fly down or away, hurl etc. ; to revile (varia lectio apa-for ava) ; to grant, yield Caus. (Aorist subjunctive 3. plural -cikṣipan-) to cause to fall down View this entry on the original dictionary page scan.
avakṣiptamfn. thrown down View this entry on the original dictionary page scan.
avakṣiptamfn. said sarcastically, imputed, insinuated View this entry on the original dictionary page scan.
avakṣiptamfn. blamed, reviled View this entry on the original dictionary page scan.
avakṣṇu(I. sg. -kṣṇaumi-) to rub off, efface View this entry on the original dictionary page scan.
avakṣud(ind.p. -kṣudya-) to stamp or pound or rub to pieces View this entry on the original dictionary page scan.
avakṣutamfn. sneezed upon View this entry on the original dictionary page scan.
avaktavyamfn. not to be said, indescribable View this entry on the original dictionary page scan.
avaktṛmfn. who does not speak View this entry on the original dictionary page scan.
avaktramf(ā-)n. having no mouth (as a vessel) View this entry on the original dictionary page scan.
avakūj(Opt. -kūjet-) to make a sound, utter (with na- negative not to make any allusion to, be silent) View this entry on the original dictionary page scan.
avakūlto singe, burn View this entry on the original dictionary page scan.
avakuñcanan. curving, flexure, contraction View this entry on the original dictionary page scan.
avakuṇṭhanan. (equals ava-guṇṭhana- q.v) investing, surrounding, covering View this entry on the original dictionary page scan.
avakuṇṭhitamfn. invested, surrounded View this entry on the original dictionary page scan.
avakuṣto rub downwards View this entry on the original dictionary page scan.
avakuṭ(ind.p. -kuṭya-) to break or cut into pieces, View this entry on the original dictionary page scan.
avakuṭāramfn. (see ava-kaṭa-) View this entry on the original dictionary page scan.
avakuṭārikāf. equals ava-kaṭikā- q.v View this entry on the original dictionary page scan.
avakutsto blame, revile View this entry on the original dictionary page scan.
avakutsitan. blame, censure View this entry on the original dictionary page scan.
avakvaṇam. a discordant or false note View this entry on the original dictionary page scan.
avakvātham. imperfect digestion or decoction View this entry on the original dictionary page scan.
avalakṣamfn. equals bal/akṣa- q.v View this entry on the original dictionary page scan.
avalambakamfn. hanging down View this entry on the original dictionary page scan.
avalambakam. (in geometry) a perpendicular View this entry on the original dictionary page scan.
avalambakan. Name of a metre. View this entry on the original dictionary page scan.
avalehakamfn. licking View this entry on the original dictionary page scan.
avalokakamfn. wishing to view (as a spy) View this entry on the original dictionary page scan.
avalokanakamfn. having a fine view, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
avamanthakam. swellings caused by boils or contusions View this entry on the original dictionary page scan.
avamanyakamfn. equals -mantṛ- (with genitive case) (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
avamūrdhakamfn. with hanging head, View this entry on the original dictionary page scan.
avanak(2. dual number -nakṣathas-) to overtake any one (genitive case) View this entry on the original dictionary page scan.
avanakṣatran. disappearance of the luminaries View this entry on the original dictionary page scan.
avanāmakamfn. what depresses or causes to bow or bend View this entry on the original dictionary page scan.
avanatakayamfn. bending the body, crouching down. View this entry on the original dictionary page scan.
avanatottarakāyamfn. bowing the upper part of the body View this entry on the original dictionary page scan.
avanipālakam. idem or 'm. "protector of the earth", a king ' View this entry on the original dictionary page scan.
avantakam. plural Name of a people View this entry on the original dictionary page scan.
avantakam. Name of a Buddhist school. View this entry on the original dictionary page scan.
āvantakamfn. belonging to or coming from avanti- View this entry on the original dictionary page scan.
āvantakam. plural the inhabitants of avanti- View this entry on the original dictionary page scan.
avāntaradiksraktimfn. (said of the vedi-) having its corners turned towards intermediate regions of the compass View this entry on the original dictionary page scan.
avantyaśmakan. sg. or m. plural the avanti-s and the aśmaka-s, (gaRa rajadantādi-and kārtakaujapādi- q.v) View this entry on the original dictionary page scan.
āvāpakam. a bracelet of gold etc. View this entry on the original dictionary page scan.
āvapantakamf(ik/ā-)n. scattering View this entry on the original dictionary page scan.
avapīḍakam. (equals -pīḍa-) a sternutatory View this entry on the original dictionary page scan.
āvarakaetc. See 1. ā-vṛ-. View this entry on the original dictionary page scan.
āvarakamfn. covering, concealing, darkening View this entry on the original dictionary page scan.
avarakaṅkaf. Name (also title or epithet) of a city, View this entry on the original dictionary page scan.
āvaraṇaśaktif. the power of illusion (that which veils the real nature of things) View this entry on the original dictionary page scan.
āvarasamakamfn. (fr. avarasama- ), to be paid in the following year (as a debt).
āvarjakaetc. See ā-vṛj-. View this entry on the original dictionary page scan.
āvarjakamfn. attracting, propitiating View this entry on the original dictionary page scan.
avarṇakārakamfn. "not praising", speaking ill of View this entry on the original dictionary page scan.
avarocakam. want of appetite View this entry on the original dictionary page scan.
avarodhakamfn. hindering View this entry on the original dictionary page scan.
avarodhakamfn. being about to besiege (with accusative) View this entry on the original dictionary page scan.
avarodhakam. a guard View this entry on the original dictionary page scan.
avarodhakan. a barrier, fence View this entry on the original dictionary page scan.
avarohakam. See asvāv- View this entry on the original dictionary page scan.
āvartakam. a kind of venomous insect View this entry on the original dictionary page scan.
āvartakam. Name of a form of cloud personified View this entry on the original dictionary page scan.
āvartakam. a depression above the frontal ridge or over the eyebrows View this entry on the original dictionary page scan.
āvartakam. whirlpool View this entry on the original dictionary page scan.
āvartakam. revolution View this entry on the original dictionary page scan.
āvartakam. excitement of the mind from the influence of the senses View this entry on the original dictionary page scan.
āvartakam. a curl of hair View this entry on the original dictionary page scan.
āvartakamfn. bringing back (?), View this entry on the original dictionary page scan.
āvartakīf. Name of a creeping plant View this entry on the original dictionary page scan.
avāryakratu(avāry/a-.), (6) mfn. of irresistible power View this entry on the original dictionary page scan.
avasādakamfn. causing to sink, frustrating View this entry on the original dictionary page scan.
avasādakamfn. exhausting, tiresome, wearisome View this entry on the original dictionary page scan.
avasādakamfn. ending, finishing View this entry on the original dictionary page scan.
avasaktamfn. suspended from, attached to (as to the shoulder or to the branch of a tree etc.), bound round etc. View this entry on the original dictionary page scan.
avasaktamfn. being in contact with View this entry on the original dictionary page scan.
avasaktamfn. belonging to View this entry on the original dictionary page scan.
avasaktamfn. (in Passive voice sense) hung with (as with wreaths) , charged with (a business) View this entry on the original dictionary page scan.
avasakthikāf. (equals paryaṅka- q.v) sitting on the hams (or also"the cloth tied round the legs and knees of a person sitting on his hams") View this entry on the original dictionary page scan.
avasaṃcakṣyamfn. to be shunned or avoided View this entry on the original dictionary page scan.
avasānakamf(ikā-)n. attaining an end by (in compound) View this entry on the original dictionary page scan.
avasarakāle ([ ]) locative case ind. on a favourable opportunity. View this entry on the original dictionary page scan.
avasarapāṭhakam. a bard, panegyrist, View this entry on the original dictionary page scan.
avasāyakamfn. (said of an arrow, sāyaka-),"bringing to a close", destructive View this entry on the original dictionary page scan.
avaśīrṣakamfn. idem or 'mfn. having the head turned down ' View this entry on the original dictionary page scan.
avaśiṣṭakan. remainder View this entry on the original dictionary page scan.
avasitakāryamfn. one who has finished what had to be done, satisfied, View this entry on the original dictionary page scan.
avaskarakam. Name of an insect (originating from faeces) View this entry on the original dictionary page scan.
avaśyabhāgīyakamfn. inevitable, View this entry on the original dictionary page scan.
āvaśyakamfn. (fr. avaśya-), necessary, inevitable commentator or commentary on and View this entry on the original dictionary page scan.
āvaśyakan. necessity, inevitable act or conclusion View this entry on the original dictionary page scan.
āvaśyakan. religious duty View this entry on the original dictionary page scan.
āvaśyakan. a call of nature View this entry on the original dictionary page scan.
āvaśyakabṛhadvṛttif. Name of a jaina- work. View this entry on the original dictionary page scan.
avaśyakarmann. any necessary action or performance, View this entry on the original dictionary page scan.
avaśyakāryamfn. (gaRa maiyūravyaṃsakādi-, q.v) to be necessarily done View this entry on the original dictionary page scan.
avaśyakāryan. plural necessary performances View this entry on the original dictionary page scan.
āvaśyakatāf. necessity, inevitability View this entry on the original dictionary page scan.
avaśyāyakiraṇam. "cold-rayed", the moon, View this entry on the original dictionary page scan.
avaṭakacchapam. a tortoise in a hole (said of an inexperienced man who has seen nothing of the world), (gaRa pātresmitādi- q.v) View this entry on the original dictionary page scan.
avatakṣaṇan. ( takṣ-), anything cut in pieces (as chopped straw) View this entry on the original dictionary page scan.
avataṃsakamn. f(ā-). idem or 'to employ as a garland ' View this entry on the original dictionary page scan.
avataṃsakamn.Name of a Buddhist text. View this entry on the original dictionary page scan.
avataptenakulasthitan. an ichneumon's standing on hot ground (metaphorically said of a person's inconstancy) View this entry on the original dictionary page scan.
avatāradvādaśakīrtanan. "giving an account of the twelve avatāra-s", Name of a chapter of the work ūrdhvāmnāya-saṃhitā-. View this entry on the original dictionary page scan.
avatārakamfn. "making one's appearance" See raṅgāvat-. View this entry on the original dictionary page scan.
avatārakathāf. "account of an avatāra-", Name of a chapter in anantānandagiri-'s śaṃkaravijaya-. View this entry on the original dictionary page scan.
avavādakam. a spiritual instructor, View this entry on the original dictionary page scan.
āvayakamfn. belonging to the country āvaya- View this entry on the original dictionary page scan.
avayavarūpakan. a simile by which two things are only compared with regard to their parts View this entry on the original dictionary page scan.
avayavirūpakan. a simile by which two things are only compared as wholes View this entry on the original dictionary page scan.
āvedakamfn. in fine compositi or 'at the end of a compound' making known, reporting, announcing View this entry on the original dictionary page scan.
āvedakam. an appellant, a suitor View this entry on the original dictionary page scan.
āvedakam. one who makes known, an informer. View this entry on the original dictionary page scan.
āvedakaetc. See ā-- 1. vid-. View this entry on the original dictionary page scan.
āveṣṭakam. a snare commentator or commentary on View this entry on the original dictionary page scan.
āveṣṭakam. a wall, fence View this entry on the original dictionary page scan.
āveṣṭakam. an enclosure View this entry on the original dictionary page scan.
avibhaktamfn. undivided View this entry on the original dictionary page scan.
avibhaktamfn. "not shared" See -tva- un-separated, Joint (as co-heirs who have not divided their inheritance) View this entry on the original dictionary page scan.
avibhakta(manuscript). View this entry on the original dictionary page scan.
avibhaktatvan. the not being shared View this entry on the original dictionary page scan.
avibhaktatvan. the not being distinguished (from each other) View this entry on the original dictionary page scan.
avibhaktinmfn. unseparated (as co-heirs who have not divided their inheritance) View this entry on the original dictionary page scan.
avicakṣaṇamfn. not discerning, not clever, ignorant View this entry on the original dictionary page scan.
aviddhakarṇā f. the plant Cissimpelos Hexandra (see viddha-karṇā-.) View this entry on the original dictionary page scan.
āviddhakarṇamfn. having the ears pierced View this entry on the original dictionary page scan.
aviddhakarṇīf. the plant Cissimpelos Hexandra (see viddha-karṇā-.) View this entry on the original dictionary page scan.
āviddhakarṇīf. Name of a plant View this entry on the original dictionary page scan.
avidhipūrvakamind. not according to rule
avighnakaraṇavratan. Name of a particular rite on the fourth day of phālguna-, View this entry on the original dictionary page scan.
aviharyatakratumfn. one whose will cannot be averted (["doer of acts undesired (by his foes)" ]) View this entry on the original dictionary page scan.
avihiṃsakamfn. not injuring anybody (sometimes with the genitive case bhūsānām-). View this entry on the original dictionary page scan.
avijānakamfn. not knowing, not familiar with, View this entry on the original dictionary page scan.
avikalpakamfn. not hesitating, View this entry on the original dictionary page scan.
avikriyātmakamfn. whose nature is unchangeableness View this entry on the original dictionary page scan.
āvilakandam. a kind of bulbous plant View this entry on the original dictionary page scan.
āvilakandam. (for āvalī-kanda- q.v) View this entry on the original dictionary page scan.
avilakṣitamfn. not perceived, not perceivable View this entry on the original dictionary page scan.
avipakṣamfn. having no adversary, unopposed. View this entry on the original dictionary page scan.
avipakvamfn. undigested View this entry on the original dictionary page scan.
avipakvamfn. immature. View this entry on the original dictionary page scan.
avipakvabuddhimfn. having an immature or inexperienced mind View this entry on the original dictionary page scan.
avipakvakaraṇamfn. having immature or insufficiently developed organs (of mind) View this entry on the original dictionary page scan.
avipakvakaṣāyamfn. whose passions or sins have not yet ripened id est are not yet quite extinguished View this entry on the original dictionary page scan.
aviprakramaṇan. not quitting or retiring View this entry on the original dictionary page scan.
aviprakṛṣṭamfn. not remote, near (as time) View this entry on the original dictionary page scan.
aviprakṛṣṭamfn. near (in rank) View this entry on the original dictionary page scan.
avipralambhakamfn. not deceiving. View this entry on the original dictionary page scan.
aviraktamfn. not indifferent, attached to (Prakrit ratta-) etc. View this entry on the original dictionary page scan.
aviṣaktamfn. not clinging or sticking to View this entry on the original dictionary page scan.
aviṣaktamfn. unrestrained, unchecked View this entry on the original dictionary page scan.
avītakanot an inclosed place, . View this entry on the original dictionary page scan.
avitathakriyamfn. whose work is not vain or ineffectual View this entry on the original dictionary page scan.
avitṛptakāmamfn. having the desires unsatisfied View this entry on the original dictionary page scan.
avivakṣāf. not declaring especially id est considering to be unessential View this entry on the original dictionary page scan.
avivakṣatmfn. not intending to speak View this entry on the original dictionary page scan.
avivakṣitamfn. not intended to be stated or expressed etc. View this entry on the original dictionary page scan.
avivakṣitatvan. the not being intended to be expressed View this entry on the original dictionary page scan.
avivecakamfn. undiscriminating, View this entry on the original dictionary page scan.
āvṛddhabālakamind. from childhood to old age. View this entry on the original dictionary page scan.
āvrīḍakamfn. (fr. a-vrīḍa- gaRa rājanyādi- ), inhabited by shameless people. View this entry on the original dictionary page scan.
avṛkṣakamfn. idem or 'mfn. treeless, destitute of trees (edition Bomb.)' (=iv, 43, 28, edition Bomb.) View this entry on the original dictionary page scan.
avṛntakamfn. without a handle, , Scholiast or Commentator View this entry on the original dictionary page scan.
āvṛttidīpakan. (in rhetoric) enforcing a statement by repeating it View this entry on the original dictionary page scan.
avyaktamfn. undeveloped, not manifest, unapparent, indistinct, invisible, imperceptible etc. View this entry on the original dictionary page scan.
avyaktamfn. (in algebra) unknown as quantity or number View this entry on the original dictionary page scan.
avyaktamfn. speaking indistinctly View this entry on the original dictionary page scan.
avyaktam. (equals paramātman-) the universal Spirit View this entry on the original dictionary page scan.
avyaktam. Name of viṣṇu- View this entry on the original dictionary page scan.
avyaktam. of śiva- View this entry on the original dictionary page scan.
avyaktam. of kāma- View this entry on the original dictionary page scan.
avyaktam. a fool View this entry on the original dictionary page scan.
avyaktam. Name of an upaniṣad- View this entry on the original dictionary page scan.
avyaktan. (in sāṃkhya- philosophy)"the unevolved (Evolver of all things)" , the primary germ of nature, primordial element or productive principle whence all the phenomena of the material world are developed, View this entry on the original dictionary page scan.
avyaktam. (also) a young monk who has not finished his studies, View this entry on the original dictionary page scan.
āvyaktamfn. quite clear or intelligible View this entry on the original dictionary page scan.
avyaktabhāṣinmfn. speaking indistinctly, View this entry on the original dictionary page scan.
avyaktagaṇitan. idem or 'f. algebraic calculation ' View this entry on the original dictionary page scan.
avyaktagatimfn. going imperceptibly. View this entry on the original dictionary page scan.
avyaktakriyāf. algebraic calculation View this entry on the original dictionary page scan.
avyaktalakṣaṇamfn. whose marks are imperceptible, Name of śiva-. View this entry on the original dictionary page scan.
avyaktamind. indistinctly. View this entry on the original dictionary page scan.
avyaktamūrtimfn. of imperceptible form, View this entry on the original dictionary page scan.
avyaktanirmāṇamfn. not yet full-grown, View this entry on the original dictionary page scan.
avyaktānukaraṇan. the imitating of inarticulated sound View this entry on the original dictionary page scan.
avyaktapadamfn. inarticulate. View this entry on the original dictionary page scan.
avyaktarāgam. dark-red (the colour of the dawn) View this entry on the original dictionary page scan.
avyaktarāśim. (in algebra) an unknown number or indistinct quantity. View this entry on the original dictionary page scan.
avyaktasāmyan. equation of unknown quantities. View this entry on the original dictionary page scan.
avyaktavyaktamfn. idem or 'mfn. whose marks are imperceptible, Name of śiva-.' View this entry on the original dictionary page scan.
āvyaktika(fr. a-vyakta-) mfn. not perceivable, immaterial commentator or commentary on View this entry on the original dictionary page scan.
avyāpakamfn. not spread over or pervading the whole, not an invariable concomitant, special, peculiar. View this entry on the original dictionary page scan.
avyāpakatāf. non-comprehensiveness or generalization, speciality. View this entry on the original dictionary page scan.
avyāpakatvan. non-comprehensiveness or generalization, speciality. View this entry on the original dictionary page scan.
avyatiṣaktamfn. not intermingled View this entry on the original dictionary page scan.
avyuptakeśamfn. having unshorn hair, View this entry on the original dictionary page scan.
ayācakamfn. ( yāc-),"one who does not ask or solicit"[a misspelling for a-pācaka- ] View this entry on the original dictionary page scan.
āyakamfn. (fr. i-), going (?) commentator or commentary on View this entry on the original dictionary page scan.
ayakṣmamf(-)n. not consumptive, not sick, healthy View this entry on the original dictionary page scan.
ayakṣmamf(-)n. causing health, salubrious View this entry on the original dictionary page scan.
ayakṣman. (/am-) health View this entry on the original dictionary page scan.
ayakṣmaṃkaraṇamf(ī-)n. producing health View this entry on the original dictionary page scan.
ayakṣmatāti(ayakṣm/a-.) f. health View this entry on the original dictionary page scan.
ayakṣmatvan. idem or '(ayakṣm/a-.) f. health ' View this entry on the original dictionary page scan.
ayakṣyamāṇamfn. not wishing or not about to institute a sacrifice View this entry on the original dictionary page scan.
āyallakan. (etymology doubtful) , impatience View this entry on the original dictionary page scan.
āyallakan. longing for View this entry on the original dictionary page scan.
āyallakan. missing, regretting View this entry on the original dictionary page scan.
ayamitanakhamfn. with untrimmed nails View this entry on the original dictionary page scan.
ayanakalāf. plural the correction (in minutes) for ecliptic deviation, View this entry on the original dictionary page scan.
āyāsakamfn. causing effort, causing fatigue or weariness View this entry on the original dictionary page scan.
āyatapakṣmalamfn. (an arrow) with long feathers, View this entry on the original dictionary page scan.
ayathājātiyakamfn. contrary to what should be the case on View this entry on the original dictionary page scan.
ayathāśāstrakārinmfn. not acting in accordance with the scripture. View this entry on the original dictionary page scan.
ayatnakārinmfn. making no exertion, idle. View this entry on the original dictionary page scan.
ayatnakrita mfn. easily or readily produced,. spontaneous View this entry on the original dictionary page scan.
ayavakamfn. producing bad or no barley and 174 View this entry on the original dictionary page scan.
āyodhyakamfn. belonging to or native of ayodhyā- View this entry on the original dictionary page scan.
ayogakṣema(/a-yoga-) m. no secure possession of what has been acquired, no prosperity and View this entry on the original dictionary page scan.
ayograkan. a pestle View this entry on the original dictionary page scan.
āyudhīyaka n. making or dealing in weapous, View this entry on the original dictionary page scan.
ayugakṣam. = View this entry on the original dictionary page scan.
ayugmapādayamakan. (a species of alliteration) the repetition of the odd (id est the first and third) pāda-s of a stanza (in such a manner that the sense of the sounds repeated is different in the first and third pāda-) commentator or commentary on View this entry on the original dictionary page scan.
ayujakāramind. in an odd number of times, View this entry on the original dictionary page scan.
ayukpādayamakan. equals ayugma-p- q.v commentator or commentary on View this entry on the original dictionary page scan.
ayukpādayamakan. = a-- yugma-- p-, , Scholiast or Commentator View this entry on the original dictionary page scan.
ayukśaktim. "having an odd number of (id est nine) powers", śiva- View this entry on the original dictionary page scan.
āyuktakam. an official. View this entry on the original dictionary page scan.
ayuktakṛtmfn. committing wrong acts. View this entry on the original dictionary page scan.
āyuṣakind. (fr. sac-), with the co-operation of men View this entry on the original dictionary page scan.
āyuṣmatpuruṣakamfn. giving long life to men View this entry on the original dictionary page scan.
ayutādhyāpakam. an excellent teacher , View this entry on the original dictionary page scan.
bābakhānacaritran. Name of work View this entry on the original dictionary page scan.
bābhravyakamfn. inhabited by bābhravya-s gaRa rājanyādi-. View this entry on the original dictionary page scan.
babhruvaktramfn. "ichneumon-faced", having the face of an ichneumon View this entry on the original dictionary page scan.
badakṣānathe country Badakshan (varia lectio bad-). View this entry on the original dictionary page scan.
bādakṣāna= Badakshan (varia lectio bad-). View this entry on the original dictionary page scan.
badarakuṇam. the time when the fruit of the jujube becomes ripe gaRa pīlv-ādi-. View this entry on the original dictionary page scan.
badarāmalakan. Flacourtia Cataphracta (rather its fruit) View this entry on the original dictionary page scan.
badarasaktum. plural meal of the fruit of the jujube View this entry on the original dictionary page scan.
badarīpattrakan. Unguis Odoratus View this entry on the original dictionary page scan.
baddhabhīmāndhakāramf(ā-)n. wrapped in terrible darkness, View this entry on the original dictionary page scan.
baddhakam. one who is bound, a captive, prisoner View this entry on the original dictionary page scan.
baddhakadambakamfn. forming groups View this entry on the original dictionary page scan.
baddhakakṣyamfn. equals -parikara- View this entry on the original dictionary page scan.
baddhakalāpinmfn. one who has his quiver tied on View this entry on the original dictionary page scan.
baddhakamocanan. setting free a prisoner View this entry on the original dictionary page scan.
baddhakesaramfn. having the filaments formed View this entry on the original dictionary page scan.
baddhalakṣamfn. (in fine compositi or 'at the end of a compound') equals -dṛṣṭi- View this entry on the original dictionary page scan.
baddhāndhakāramfn. wrapped in darkness View this entry on the original dictionary page scan.
baddhaśrotramanaścakṣusmfn. having ears and mind and eyes fixed on (locative case) View this entry on the original dictionary page scan.
bādhabuddhipratibadhyapratihandhakatāvicāram. View this entry on the original dictionary page scan.
bādhakamf(ikā-)n. oppressing, harassing, paining (See śatru-b-) View this entry on the original dictionary page scan.
bādhakamf(ikā-)n. opposing, hindering, injuring, prejudicing ( bādhakatā -- f.) View this entry on the original dictionary page scan.
bādhakamf(ikā-)n. setting aside, suspending, annulling ( bādhakatva -tva- n.) View this entry on the original dictionary page scan.
bādhakam. a particular disease of women View this entry on the original dictionary page scan.
bādhakam. a kind of tree View this entry on the original dictionary page scan.
bādhakamf(ī-)n. belonging to or derived from the bādhaka- tree View this entry on the original dictionary page scan.
bādhakamayamf(ī-)n. equals prec. mfn. View this entry on the original dictionary page scan.
bādhakatāf. bādhaka
bādhakatvan. bādhaka
bādhapūrvapakṣagranthakroḍam. View this entry on the original dictionary page scan.
bādhapūrvapakṣagranthānugamam. View this entry on the original dictionary page scan.
bādhapūrvapakṣagranthaprakāśam. View this entry on the original dictionary page scan.
bādhapūrvapakṣagranthaṭīkāf. View this entry on the original dictionary page scan.
bādhapūrvapakṣagranthavivecanan. View this entry on the original dictionary page scan.
bādhasiddhāntagranthakroḍam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthaprakāśam. Name of work View this entry on the original dictionary page scan.
bādhavibhājakam. or n. Name of work View this entry on the original dictionary page scan.
badhirakam. Name of a man (plural"his descendants"), gaRa upakādi- View this entry on the original dictionary page scan.
bādhirakamfn. (fr. badhira-) gaRa arīhaṇādi-. View this entry on the original dictionary page scan.
bādhyabādhakatāf. the condition of oppressed and oppressor View this entry on the original dictionary page scan.
bādhyabādhakatāf. the condition of one who pains such as deserve to be pained View this entry on the original dictionary page scan.
bahalacakṣusm. Odina Pinisata View this entry on the original dictionary page scan.
bahanakam. plural Name of a people View this entry on the original dictionary page scan.
baheṭakam. Terminalia Belrica View this entry on the original dictionary page scan.
bahirdvāraprakaṣṭhakan. a portico, a covered terrace in front of the door of a house View this entry on the original dictionary page scan.
bāhlaka bāhlava-, bāhli- etc. See bālhava- etc., . View this entry on the original dictionary page scan.
bahrāmakhānam. = $ View this entry on the original dictionary page scan.
bahubhakṣamfn. eating much, a great eater View this entry on the original dictionary page scan.
bahubhastrakamf(ā-or ikā-)n. (fr. bahu-+ bhastrā-) View this entry on the original dictionary page scan.
bahubhojakamfn. eating much View this entry on the original dictionary page scan.
bahubollakam. a great talker View this entry on the original dictionary page scan.
bahucarmakamf(ikā-)n. View this entry on the original dictionary page scan.
bahūdakamfn. (hu-ud-) having much water View this entry on the original dictionary page scan.
bahūdakam. a kind of mendicant who begs his food at bathing-places View this entry on the original dictionary page scan.
bahudakṣiṇamfn. marked by many fees or donations (as a religious ceremony), liberal, lavish, bountiful View this entry on the original dictionary page scan.
bahudalakaniśam. a particular species of grain View this entry on the original dictionary page scan.
bāhudantakan. (with śāstra-) Name of a treatise on morals abridged by indra- (see next) . View this entry on the original dictionary page scan.
bahudarśakamf(ikā-)n. seeing much, prudent, circumspect View this entry on the original dictionary page scan.
bahudhānyakam. or n. (?) Name of a place View this entry on the original dictionary page scan.
bahudhātmaka mf(ikā-)n. existing in various forms, manifold in essence View this entry on the original dictionary page scan.
bahudhātmakamf(ikā-)n. existing in various forms, manifold in essence View this entry on the original dictionary page scan.
bahukaṇṭakamfn. "many-thorned", Name of several plants (a species of Asteracantha;Alhagi Maurorum;Phoenix Paludosa) View this entry on the original dictionary page scan.
bahukaṇṭakāf. equals next View this entry on the original dictionary page scan.
bāhukuleyakam. patronymic fr. bahu-kula- View this entry on the original dictionary page scan.
bahulakaincorrect for bāhulaka- q.v View this entry on the original dictionary page scan.
bāhulakan. manifoldness, diversity on View this entry on the original dictionary page scan.
bahuletarapakṣam. dual number the dark and the other (i.e. light) half of a month View this entry on the original dictionary page scan.
bahumālakamfn. possessing many necklaces View this entry on the original dictionary page scan.
bahumūlakam. a species of reed View this entry on the original dictionary page scan.
bahumūlakam. Name of a nāga- View this entry on the original dictionary page scan.
bahumūlakan. the sweet-scented root of Andropogon Muricatus View this entry on the original dictionary page scan.
bahumūtrakam. a kind of chameleon View this entry on the original dictionary page scan.
bāhupracālakamind. shaking the arms View this entry on the original dictionary page scan.
bahuprakāramfn. of many kinds, manifold View this entry on the original dictionary page scan.
bahuprakāramind. in many ways, manifoldly View this entry on the original dictionary page scan.
bahuprakṛtimfn. consisting of many primary parts or verbal elements (as a compound) View this entry on the original dictionary page scan.
bāhurakṣāf. armour for the upper arm View this entry on the original dictionary page scan.
bahurūpakamf(ikā-)n. multiform, manifold View this entry on the original dictionary page scan.
bahurūpakam. a kind of animal View this entry on the original dictionary page scan.
bahurūpakalpam. Name of work View this entry on the original dictionary page scan.
bahurūpakaśobhitamfn., adorned in many ways, variously decorated (varia lectio ṅgaś-). View this entry on the original dictionary page scan.
bahurūpāṣṭakatantran. a collective N. for eight tantra-s (viz. the brāhmītantra-, māheśvarī-t-, kaumārika-t-, vaiṣṇavī-t-, vārāhī-t-, indrāṇī-t-, cāmuṇḍā-t-, śiva-dūtī-t-) View this entry on the original dictionary page scan.
bahuśaktimfn. possessing great power View this entry on the original dictionary page scan.
bahuśaktim. Name of a prince View this entry on the original dictionary page scan.
bāhuśaktim. "strong of arm", Name of a king View this entry on the original dictionary page scan.
bahusuvarṇakamfn. costing or possessing much gold View this entry on the original dictionary page scan.
bahusuvarṇakam. Name of an agrahāra- on the Ganges View this entry on the original dictionary page scan.
bahusuvarṇakam. of a prince View this entry on the original dictionary page scan.
bahusvarṇalakṣamūlyamfn. worth many hundred thousand pieces of gold, View this entry on the original dictionary page scan.
bahutarakamfn. very -much or numerous View this entry on the original dictionary page scan.
bahutarakaṇiśam. a kind of corn or grain (see gucchakaṇiśa-). View this entry on the original dictionary page scan.
bahutvakkam. (fr. bahu-+ tvac-),"having much bark", Betula Bhojpatra View this entry on the original dictionary page scan.
bahuvaktavyamfn. to be said much about View this entry on the original dictionary page scan.
bahuvārakam. Cordia Myxa ( bahuvārakaphala ka-phala- n.its fruit ) View this entry on the original dictionary page scan.
bahuvārakaphalan. bahuvāraka
bāhuvartakamfn. (fr. bahu-varta-) ( -gartaka-). View this entry on the original dictionary page scan.
bahvakṣaramfn. many-syllabled, polysyllabic View this entry on the original dictionary page scan.
bahvakṣarāntyamfn. being at the end of a polysyllabic word View this entry on the original dictionary page scan.
bahvakṣaratvan. polysyllableness View this entry on the original dictionary page scan.
bahvṛcagṛhyakārikāf. plural Name of work View this entry on the original dictionary page scan.
bahvṛcakārikāf. plural Name of work View this entry on the original dictionary page scan.
bahvṛcaṣoḍaśakarmamantravivaraṇan. Name of work View this entry on the original dictionary page scan.
bāhyakāf. Name of sṛñjarī- and one of the two wives of bhajamāna- (an older sister of upabāhyakā-) View this entry on the original dictionary page scan.
bāhyakakṣam. the outer side (of a house) View this entry on the original dictionary page scan.
bāhyakaraṇan. an external organ of sense View this entry on the original dictionary page scan.
bāhyakarṇa m. Name of two nāga-s View this entry on the original dictionary page scan.
bāhyakasṛñjarī f. Name of sṛñjarī- and one of the two wives of bhajamāna- (an older sister of upabāhyakā-) View this entry on the original dictionary page scan.
bāhyakuṇḍam. Name of two nāga-s View this entry on the original dictionary page scan.
bāhyaprakṛtif. plural the constituents of a foreign state exclusive of the king (see prakṛti-) View this entry on the original dictionary page scan.
bāhyāśakalam. a fragment from a tree's outer bark View this entry on the original dictionary page scan.
baidakulan. (prob.) the family of the baida-s vArttika View this entry on the original dictionary page scan.
baiḍālikarṇakakantha n. (prob.) Name of a city gaRa cihaṇādi-. View this entry on the original dictionary page scan.
baiḍālikarṇakakanthakarṇikanthan. (prob.) Name of a city gaRa cihaṇādi-. View this entry on the original dictionary page scan.
bailvajakamfn. (with deśa-) inhabited by bailvaja-s View this entry on the original dictionary page scan.
bailvakamfn. gaRa arīhaṇādi-. View this entry on the original dictionary page scan.
bailvakīyamfn. (fr. prec.) View this entry on the original dictionary page scan.
bailvalakamfn. inhabited by bailvala-s View this entry on the original dictionary page scan.
bailvavanakamfn. (with deśa-) inhabited by bailvavana-s View this entry on the original dictionary page scan.
baimbakim. (also written vai-) patronymic fr. bimba- vArttika View this entry on the original dictionary page scan.
bakam. (also written vaka-) a kind of heron or crane, Ardea Nivea (often figuratively = a hypocrite, cheat, rogue, the crane being regarded as a bird of great cunning and deceit as well as circumspection) etc. View this entry on the original dictionary page scan.
bakam. Sesbana Grandiflora View this entry on the original dictionary page scan.
bakam. an apparatus for calcining or subliming metals or minerals View this entry on the original dictionary page scan.
bakam. Name of kubera- View this entry on the original dictionary page scan.
bakam. of a demon View this entry on the original dictionary page scan.
bakam. of an asura- (said to have assumed the form of a crane and to have been conquered by kṛṣṇa-) View this entry on the original dictionary page scan.
bakam. of a rākṣasa- killed by bhīma-sena- View this entry on the original dictionary page scan.
bakam. of a ṛṣi- (with the patronymic dālbhi- or dālbhya-) View this entry on the original dictionary page scan.
bakam. of a peasant View this entry on the original dictionary page scan.
bakam. of a king View this entry on the original dictionary page scan.
bakam. (plural) of a people View this entry on the original dictionary page scan.
bakabakāyaNom. A1. yate-, to croak (varia lectio for bhakabh-and makam-). View this entry on the original dictionary page scan.
bakacaram. equals -vratin- View this entry on the original dictionary page scan.
bakācīf. a kind of fish (equals baka-ciñcikā-) View this entry on the original dictionary page scan.
bakaciñcikāf. a sort of fish (equals bakācī-) View this entry on the original dictionary page scan.
bakadhūpam. a kind of perfume View this entry on the original dictionary page scan.
bakadvīpam. Name of a dvīpa- View this entry on the original dictionary page scan.
bakajitm. "conqueror of baka-", Name of bhīma-sena- View this entry on the original dictionary page scan.
bakakaccham. Name of a place View this entry on the original dictionary page scan.
bakakalpam. Name of a particular kalpa- or period of the world View this entry on the original dictionary page scan.
bakālīnamfn. lurking like a heron View this entry on the original dictionary page scan.
bakanakham. Name of a son of viśvā-mitra- View this entry on the original dictionary page scan.
bakanakhagudapariṇaddham. plural the descendants of baka-nakha- and guda-pariṇaddha- gaRa tikakitavādi-. View this entry on the original dictionary page scan.
bakaniṣūdanam. "destroyer of baka-", Name of bhīma-sena- View this entry on the original dictionary page scan.
bakapañcakan. the 5 days during which even the heron eats no fish (Name of the last 5 tithi-s of the bright half of the mouth kārttika-) View this entry on the original dictionary page scan.
bakapuṣpam. Agati Grandiflora
bakāram. the sound or letter ba-, the soft form of pa-. View this entry on the original dictionary page scan.
bakarājam. the king of the cranes (called rāja-dharman-, son of kaśyapa-;See ). View this entry on the original dictionary page scan.
bakārim. "enemy of baka-", Name of kṛṣṇa- View this entry on the original dictionary page scan.
bakaripum. "enemy of baka-", Name of bhīma-sena- View this entry on the original dictionary page scan.
bakasahavāsinm. "fellow-lodger of the heron", a lotus flower View this entry on the original dictionary page scan.
bakasaktham. Name of a man View this entry on the original dictionary page scan.
bakasaktham. plural his descendants gaRa yaskādi-. View this entry on the original dictionary page scan.
bakatvan. the state or condition of a crane View this entry on the original dictionary page scan.
bakavadham. "the killing of baka-", Name of (see ) . View this entry on the original dictionary page scan.
bakavairinm. equals -ripu- View this entry on the original dictionary page scan.
bakavatind. like a crane or heron View this entry on the original dictionary page scan.
bakavatīf. Name of a river View this entry on the original dictionary page scan.
bakavratan. "crane-like conduct", hypocrisy View this entry on the original dictionary page scan.
bakavratacaram. equals next View this entry on the original dictionary page scan.
bakavratika m. a hypocrite (especially a false devotee) View this entry on the original dictionary page scan.
bakavratinm. a hypocrite (especially a false devotee) View this entry on the original dictionary page scan.
bakavṛkṣam. a kind of tree View this entry on the original dictionary page scan.
bakavṛttimfn. one who acts like a heron, a hypocrite View this entry on the original dictionary page scan.
bakāyaNom. P. yati-, to represent or act like the asura- baka- View this entry on the original dictionary page scan.
bakayantran. "crane-instrument", Name of a particular form of retort View this entry on the original dictionary page scan.
bakerukāf. a small crane View this entry on the original dictionary page scan.
bakerukāf. the branch of a tree bent by the wind View this entry on the original dictionary page scan.
bakeśam. Name of a temple founded by baka- View this entry on the original dictionary page scan.
bakīf. a female crane View this entry on the original dictionary page scan.
bakīf. a female demon equals pūtanā- View this entry on the original dictionary page scan.
bakoṭam. a kind of crane View this entry on the original dictionary page scan.
bakulam. (also written vakula-) a kind of tree, Mimusops Elengi (said to put forth blossoms when sprinkled with nectar from the mouth of lovely women) etc. View this entry on the original dictionary page scan.
bakulam. Name of śiva- View this entry on the original dictionary page scan.
bakulam. of a country View this entry on the original dictionary page scan.
bakulāf. Helleborus Niger View this entry on the original dictionary page scan.
bakulan. the fragrant flower of Mimusops Elengi View this entry on the original dictionary page scan.
bakūlam. the bakula- tree View this entry on the original dictionary page scan.
bakulābharaṇacāṭun. Name of a poem. View this entry on the original dictionary page scan.
bakulābharaṇamunim. Name of a sage View this entry on the original dictionary page scan.
bakuladāmann. a garland of bakula- flowers View this entry on the original dictionary page scan.
bakulamālāf. idem or 'n. a garland of bakula- flowers ' View this entry on the original dictionary page scan.
bakulamālāf. Name of a woman, View this entry on the original dictionary page scan.
bakulamālinīpariṇayam. Name of a drama. View this entry on the original dictionary page scan.
bakulamedhīf. Name of a temple View this entry on the original dictionary page scan.
bakulāraṇyamāhātmyan. Name of chapter of View this entry on the original dictionary page scan.
bakulāvalif. equals la-dāman- View this entry on the original dictionary page scan.
bakulāvalikāf. Name of a woman View this entry on the original dictionary page scan.
bakulīf. a kind of drug View this entry on the original dictionary page scan.
bakulitamfn. furnished with bakula- trees or flowers, gaRa tārakādi-. View this entry on the original dictionary page scan.
bakuram. (prob.) a horn, trumpet (or other wind instrument used in battle; see bākura-, bekurā-) ("a thunderbolt, lightning") . View this entry on the original dictionary page scan.
bālabhadrakan. a kind of mineral poison (?) View this entry on the original dictionary page scan.
bālabhañjakam. Name of a man View this entry on the original dictionary page scan.
balabhitsakhim. balabhid
bālabodhakam. instructing the young View this entry on the original dictionary page scan.
bālabodhanībhāvaprakāśam. Name of work View this entry on the original dictionary page scan.
bālabuddhiprakāśinīf. Name of work View this entry on the original dictionary page scan.
balacakran. "circle of power", dominion, sovereignty ( balacakravartin -vartin- m.a powerful sovereign) View this entry on the original dictionary page scan.
balacakran. an army, host View this entry on the original dictionary page scan.
balacakravartinm. balacakra
bāladalakam. "small-leafed", Acacia Catechu View this entry on the original dictionary page scan.
balādhyakṣam. the superintendent or commander of an army, a general, minister of war View this entry on the original dictionary page scan.
bālādhyāpakam. a teacher of boys ( bālādhyāpakatā -- f.), View this entry on the original dictionary page scan.
bālādhyāpakatāf. bālādhyāpaka
balāhakam. or valāhak/a- () a rain or thunder -cloud, any cloud etc. (in fine compositi or 'at the end of a compound' f(ā-).) View this entry on the original dictionary page scan.
balāhakam. one of the 7 clouds appearing at the destruction of the world View this entry on the original dictionary page scan.
balāhakam. a mountain View this entry on the original dictionary page scan.
balāhakam. Cyperus Rotundus View this entry on the original dictionary page scan.
balāhakam. a kind of crane (equals balāka-) View this entry on the original dictionary page scan.
balāhakam. a kind of snake View this entry on the original dictionary page scan.
balāhakam. a kind of metre View this entry on the original dictionary page scan.
balāhakam. Name of a serpent-demon View this entry on the original dictionary page scan.
balāhakam. of a commander View this entry on the original dictionary page scan.
balāhakam. of one of the 4 horses of viṣṇu- View this entry on the original dictionary page scan.
balāhakam. of a brother of jayad-ratha- View this entry on the original dictionary page scan.
balāhakam. of a daitya- View this entry on the original dictionary page scan.
balāhakam. of a mountain, View this entry on the original dictionary page scan.
bālāhakam. idem or '(or vāl-) m. Name of a mythical horse ' View this entry on the original dictionary page scan.
bālāhakam. Name of a serpent-demon View this entry on the original dictionary page scan.
bālāhakam. yuddhe balāhaka-jambu-māle-,"in the contest between bālāhaka- and jambu-māla-" View this entry on the original dictionary page scan.
balāhvakandam. a kind of esculent root View this entry on the original dictionary page scan.
bālajātakan. "child's nativity", Name of work View this entry on the original dictionary page scan.
balakam. Name of a demon (see valaka-) View this entry on the original dictionary page scan.
balakam. a dream at nightfall View this entry on the original dictionary page scan.
balakan. a mixture of treacle and milk View this entry on the original dictionary page scan.
bālakamf(ikā-)n. young, childish, not yet full-grown etc. View this entry on the original dictionary page scan.
bālakam. a child, boy, youth (in law"a minor"), the young of an animal (f(ikā-).a girl ) View this entry on the original dictionary page scan.
bālakam. a young elephant five years old View this entry on the original dictionary page scan.
bālakam. a fool, simpleton View this entry on the original dictionary page scan.
bālakam. a kind of fish View this entry on the original dictionary page scan.
bālakam. Name of a prince (varia lectio pālaka-) View this entry on the original dictionary page scan.
bālakadalīf. a young plantain tree, Musa Sapientum View this entry on the original dictionary page scan.
bālakahatyāf. infanticide View this entry on the original dictionary page scan.
balakāmamfn. desiring strength View this entry on the original dictionary page scan.
bālakamalinīf. a young lotus plant View this entry on the original dictionary page scan.
bālakāṇḍam. "the boy (rāma-) section", Name of the first book of the rāmāyaṇa- (ādi-k-in Bombay edition) and of the adhyātma-rāmāyaṇa- (sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
bālakapralapitan. childish talk, foolish prattle View this entry on the original dictionary page scan.
bālakapriyamfn. fond of children View this entry on the original dictionary page scan.
bālakapriyāf. colocynth View this entry on the original dictionary page scan.
bālakapriyāf. Musa Sapientum View this entry on the original dictionary page scan.
balakaramfn. inspiring strength, strengthening View this entry on the original dictionary page scan.
bālakatvan. childhood, childishness View this entry on the original dictionary page scan.
bālakavim. Name of an author View this entry on the original dictionary page scan.
bālakāvyan. Name of a poem. View this entry on the original dictionary page scan.
balakāyam. "armed body", an army View this entry on the original dictionary page scan.
bālakeli f. child's play or amusement View this entry on the original dictionary page scan.
bālakelīf. child's play or amusement View this entry on the original dictionary page scan.
bālakhilyaSee vāla-kh-. View this entry on the original dictionary page scan.
balakhinmfn. coming from Balkh View this entry on the original dictionary page scan.
bālakīyamfn. childish, infantine View this entry on the original dictionary page scan.
balakramam. Name of a mountain View this entry on the original dictionary page scan.
bālakrīḍāf. equals -keli- View this entry on the original dictionary page scan.
bālakrīḍākāvyan. Name of work View this entry on the original dictionary page scan.
bālakrīḍanan. equals -keli- View this entry on the original dictionary page scan.
bālakrīḍanakan. idem or 'n. equals -keli- ' View this entry on the original dictionary page scan.
bālakrīḍanakan. (plural) Name of chapter of vātsyāyana-'s kāmasūtra- View this entry on the original dictionary page scan.
bālakrīḍanakam. a child's toy or plaything View this entry on the original dictionary page scan.
bālakrīḍanakam. a bill View this entry on the original dictionary page scan.
bālakrīḍanakam. Name of śiva- View this entry on the original dictionary page scan.
bālakrīḍanakam. Cypraea Moneta View this entry on the original dictionary page scan.
bālakrīḍāvarṇanan. Name of work View this entry on the original dictionary page scan.
bālakriyāf. doings or conduct of children View this entry on the original dictionary page scan.
bālakṛṣṇam. the boy kṛṣṇa- or kṛṣṇa- as a boy View this entry on the original dictionary page scan.
bālakṛṣṇam. Name of a man also called gaṅgā-dhara- View this entry on the original dictionary page scan.
bālakṛṣṇam. of various authors (also -dāsa-, -dīkṣita-, -bhaṭṭa-and -miśra--) View this entry on the original dictionary page scan.
bālakṛṣṇacampūf. Name of a poem View this entry on the original dictionary page scan.
bālakṛṣṇakrīḍākāvyan. Name of a poem View this entry on the original dictionary page scan.
bālakṛṣṇānandam. Name of an author View this entry on the original dictionary page scan.
bālakṛṣṇāṣṭakan. Name of a stotra-. View this entry on the original dictionary page scan.
balakṛtmfn. strengthening View this entry on the original dictionary page scan.
balakṛtamfn. done by force or against free consent View this entry on the original dictionary page scan.
balakṛtif. a mighty deed View this entry on the original dictionary page scan.
balakṣamf(ī-)n. (also written valakṣa-) white etc. etc. View this entry on the original dictionary page scan.
balakṣam. white (the colour) View this entry on the original dictionary page scan.
balakṣam. (with pakṣa-) the light half of a month View this entry on the original dictionary page scan.
balakṣagum. "white-rayed", the moon View this entry on the original dictionary page scan.
balakṣataṇḍulāf. Sida Cordifolia View this entry on the original dictionary page scan.
balakṣobham. commotion in the forces, mutiny in an army View this entry on the original dictionary page scan.
bālakundam. a young jasmine View this entry on the original dictionary page scan.
bālakundānuviddhamfn. adorned with young jasmine blossoms View this entry on the original dictionary page scan.
balālakam. Flacourtia Cataphracta View this entry on the original dictionary page scan.
bālamūlakam. a species of plant View this entry on the original dictionary page scan.
balāṅgakam. "strong-limbed (?)", the spring season View this entry on the original dictionary page scan.
balāpakarṣamind. by force View this entry on the original dictionary page scan.
bālapattrakam. Acacia Catechu, L: View this entry on the original dictionary page scan.
bālaprakāśam. Name of work View this entry on the original dictionary page scan.
bālaputrakam. a little son View this entry on the original dictionary page scan.
bālarakṣāf. equals -rakṣaṇa- View this entry on the original dictionary page scan.
bālarakṣaṇan. "guarding children" View this entry on the original dictionary page scan.
bālarakṣaṇavidhānan. Name of work View this entry on the original dictionary page scan.
bālarakṣāstavam. Name of work View this entry on the original dictionary page scan.
bālarakṣāstotran. Name of work View this entry on the original dictionary page scan.
bālārkakomalamfn. soft as the orient sun View this entry on the original dictionary page scan.
balāsakam. a yellow spot in the white of the eye (caused by disease) View this entry on the original dictionary page scan.
bālasakhim. equals -mitra- View this entry on the original dictionary page scan.
bālasakhim. the friend of a fool ( bālasakhitva -tva- n.) View this entry on the original dictionary page scan.
bālasakhitvan. bālasakhi
balāsakṣayakaramfn. destroying the phlegmatic humour View this entry on the original dictionary page scan.
bālāṣṭaka n. Name of stotra-s. View this entry on the original dictionary page scan.
bālasūryakan. lapis lazuli View this entry on the original dictionary page scan.
bālātaparaktamfn. red with the morning sunbeams View this entry on the original dictionary page scan.
bālavinaṣṭakam. Name of a man View this entry on the original dictionary page scan.
bālayajñopavītakan. the sacred thread worn across the breast View this entry on the original dictionary page scan.
bālayajñopavītakan. a sort of substitute for the sacred thread worn by children (?) (see bāl/opavīta-). View this entry on the original dictionary page scan.
baliṃdamaprakhyamfn. equal to viṣṇu- View this entry on the original dictionary page scan.
balipīṭhalakṣaṇan. Name of work View this entry on the original dictionary page scan.
balipodakīf. Basella Cordifolia View this entry on the original dictionary page scan.
balipratigrāhakamf(ikā-)n. receiving oblations View this entry on the original dictionary page scan.
bālyakālam. the period or age of childhood View this entry on the original dictionary page scan.
balyupakhyānan. Name of chapter of the vāsiṣṭha-rāmāyaṇa-. View this entry on the original dictionary page scan.
bandhakam. a binder, one who is employed in binding (especially animals) View this entry on the original dictionary page scan.
bandhakam. a catcher (See naga--and pāśa-b-) View this entry on the original dictionary page scan.
bandhakam. a violator, ravisher View this entry on the original dictionary page scan.
bandhakam. a band, tie (See pāśu-b-) View this entry on the original dictionary page scan.
bandhakam. a dam, dike (See jala-b-) View this entry on the original dictionary page scan.
bandhakam. a promise, vow View this entry on the original dictionary page scan.
bandhakam. exchanging, barter View this entry on the original dictionary page scan.
bandhakam. a city View this entry on the original dictionary page scan.
bandhakam. (in fine compositi or 'at the end of a compound' with numerals) a part (See sa-daśa-b-) View this entry on the original dictionary page scan.
bandhakam. or n. (?) pledging or a pledge (See sa-b-) View this entry on the original dictionary page scan.
bandhakan. binding, confinement View this entry on the original dictionary page scan.
bandhakampam. Name of a poet View this entry on the original dictionary page scan.
bandhakaraṇan. binding, fettering, holding back (also by magic) View this entry on the original dictionary page scan.
bandhakartṛm. a binder, fetterer, restrainer (said of śiva-) View this entry on the original dictionary page scan.
bandhakatvan. the being a fetter View this entry on the original dictionary page scan.
bandhakaumudīf. Name of a poem and a work on metrics. View this entry on the original dictionary page scan.
bāndhakeyam. idem or 'm. (fr. bandhakī-) the son of an unmarried woman, a bastard (gaRa kalyāṇy-ādi-).' gaRa śubhrādi-.
bandhakīf. ("connected", scilicet with many men) , an unchaste woman, harlot, courtezan etc. View this entry on the original dictionary page scan.
bandhakīf. a barren woman (see bandhyā-) View this entry on the original dictionary page scan.
bandhakīf. a female elephant View this entry on the original dictionary page scan.
bāndhakim. patronymic or metron. gaRa taulvaly-ādi-. View this entry on the original dictionary page scan.
bāndhakineyam. (fr. bandhakī-) the son of an unmarried woman, a bastard (gaRa kalyāṇy-ādi-). View this entry on the original dictionary page scan.
bandhanakārinmfn. (in fine compositi or 'at the end of a compound') fettering id est clasping, embracing ( bandhanakāritā ri-- f.) View this entry on the original dictionary page scan.
bandhanakāritāf. bandhanakārin
bandhanapālakam. a gaol-keeper View this entry on the original dictionary page scan.
bāndhavakamfn. belonging or relating to kinsmen, kindred View this entry on the original dictionary page scan.
bandhujīvakam. equals prec. m. View this entry on the original dictionary page scan.
bandhujīvakam. Name of a cakra-vartin- View this entry on the original dictionary page scan.
bandhumatīyakamfn. belonging to this town View this entry on the original dictionary page scan.
bandhurakomalāṅgulimfn. (a hand) that has rounded or delicate fingers View this entry on the original dictionary page scan.
bandhuvañcakam. "deceiver of relations", Name of a vidūṣaka- View this entry on the original dictionary page scan.
bārbarakamfn. (fr. barbara-) gaRa dhūmādi-. View this entry on the original dictionary page scan.
barhacandrakam. the eye in a peacock's tail View this entry on the original dictionary page scan.
barhaketum. Name of a son of sagara- View this entry on the original dictionary page scan.
barhaketum. of a son of the ninth manu- View this entry on the original dictionary page scan.
barhaṇacakran. Name of a mountain village View this entry on the original dictionary page scan.
barhāpīḍaka() m. a wreath of peacock's feathers (worn on the crown of the head). View this entry on the original dictionary page scan.
bārhatakam. Name of a man (wrong reading vāhataka-) View this entry on the original dictionary page scan.
barhicitrakan. Name of . View this entry on the original dictionary page scan.
barhiṇalakṣaṇamf(ā-)n. equals barhiṇa- mfn. View this entry on the original dictionary page scan.
bārhiṇalakṣmaṇamfn. (prob.) wrong reading for barhiṇa-l- q.v View this entry on the original dictionary page scan.
barkarakarkaramfn. (?) of all kinds View this entry on the original dictionary page scan.
bāṣkalakamf(ikā-)n. belonging to or derived from the bāṣkala-s View this entry on the original dictionary page scan.
bāṣpaka(in fine compositi or 'at the end of a compound' f(ā-).), steam, vapour, View this entry on the original dictionary page scan.
bāṣpakam. a kind of vegetable (equals māriṣa-) View this entry on the original dictionary page scan.
bāṣpakāf. equals hiṅgu-pattrī- View this entry on the original dictionary page scan.
bāṣpakalamfn. inarticulate through tears View this entry on the original dictionary page scan.
bāṣpakaṇṭhamf(ī-)n.,"having tears in the throat", almost choked with tears View this entry on the original dictionary page scan.
bāṣpaprakaram. a flow or gush of tears View this entry on the original dictionary page scan.
bastakarṇam. Shorea Robusta View this entry on the original dictionary page scan.
baṭarakan. plural circular lines of light which appear before the closed eye View this entry on the original dictionary page scan.
baṭṭalohakan. damasked steel View this entry on the original dictionary page scan.
baṭucaritanāṭakan. Name of a drama. View this entry on the original dictionary page scan.
baṭukabhairavakavacamn. Name of work View this entry on the original dictionary page scan.
baṭukakavacam. or n. Name of chapter of work View this entry on the original dictionary page scan.
baudhāyanacarakasautrāmaṇīf. Name of work View this entry on the original dictionary page scan.
bāverujātakan. Name of work View this entry on the original dictionary page scan.
bedarakaram. (prob.) an inhabitant of the city Bedar or Bidar (also proper N.) View this entry on the original dictionary page scan.
bhacakran. the whole multitude of stars or asterisms View this entry on the original dictionary page scan.
bhacakranābhif. the centre of the zodiac View this entry on the original dictionary page scan.
bhadantaghoṣakam. Name of 2 Buddhist teachers. View this entry on the original dictionary page scan.
bhadraghaṭaka() m. "vase of fortune", a lottery vase. View this entry on the original dictionary page scan.
bhadrakamf(ikā-)n. good, brave (m. vocative case plural kāḥ-in address ) View this entry on the original dictionary page scan.
bhadrakamf(ikā-)n. fine, handsome, beautiful View this entry on the original dictionary page scan.
bhadrakam. a kind of bean (Scholiast or Commentator) View this entry on the original dictionary page scan.
bhadrakam. Cyperus Pertenuis (?) View this entry on the original dictionary page scan.
bhadrakam. Pinus Deodora View this entry on the original dictionary page scan.
bhadrakam. (plural) Name of a people View this entry on the original dictionary page scan.
bhadrakam. Name of a prince View this entry on the original dictionary page scan.
bhadrakam. varia lectio for bhadrika- q.v View this entry on the original dictionary page scan.
bhadrakāf. Name of a woman View this entry on the original dictionary page scan.
bhadrakan. Cyperus Rotundus View this entry on the original dictionary page scan.
bhadrakan. a particular posture in sitting (equals bhadrāsana-) View this entry on the original dictionary page scan.
bhadrakan. a kind of metre View this entry on the original dictionary page scan.
bhadrakan. a particular mystic sign View this entry on the original dictionary page scan.
bhadrakan. a harem View this entry on the original dictionary page scan.
bhadrakālīf. Name of a goddess (later a form of durgā-) etc. View this entry on the original dictionary page scan.
bhadrakālīf. of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
bhadrakālīf. of a village on the right bank of the Ganges View this entry on the original dictionary page scan.
bhadrakālīf. of a plant (equals gandholī-) View this entry on the original dictionary page scan.
bhadrakālīcintāmaṇim. Name of work View this entry on the original dictionary page scan.
bhadrakālīkavacan. Name of chapter of View this entry on the original dictionary page scan.
bhadrakālīmāhātmyan. Name of work or chapter of work View this entry on the original dictionary page scan.
bhadrakālīmantram. plural Name of work or chapter of work View this entry on the original dictionary page scan.
bhadrakālīmanum. Name of work or chapter of work View this entry on the original dictionary page scan.
bhadrakālīpūjāvidhim. Name of work or chapter of work View this entry on the original dictionary page scan.
bhadrakālīpūjāyantran. Name of a mystical diagram View this entry on the original dictionary page scan.
bhadrakālīpurāṇan. Name of work View this entry on the original dictionary page scan.
bhadrakaṇṭam. Asteracantha Longifolia View this entry on the original dictionary page scan.
bhadrakanyāf. Name of the mother, of maudgalyāyana- View this entry on the original dictionary page scan.
bhadrakāpam. "the good or beautiful kalpa-", Name of the present age (see ) View this entry on the original dictionary page scan.
bhadrakāpan. of a sūtra- work View this entry on the original dictionary page scan.
bhadrakāpikamfn. living in the bhadra-kalpa- View this entry on the original dictionary page scan.
bhadrakapilam. Name of śiva- View this entry on the original dictionary page scan.
bhadrakāpyam. Name of a man View this entry on the original dictionary page scan.
bhadrakāram. Name of a son of kṛṣṇa- View this entry on the original dictionary page scan.
bhadrakāram. (plural) of a people View this entry on the original dictionary page scan.
bhadrakārakamfn. causing prosperity, prosperous, auspicious View this entry on the original dictionary page scan.
bhadrakarṇeśvaram. Name of a tīrtha- View this entry on the original dictionary page scan.
bhadrakarṇikāf. Name of dākṣāyaṇī- in go-karṇa- View this entry on the original dictionary page scan.
bhadrakāśīf. a kind of Cyperus View this entry on the original dictionary page scan.
bhadrakāṣṭhan. the wood of Pinus Deodora View this entry on the original dictionary page scan.
bhadrakṛtmfn. causing prosperity or welfare View this entry on the original dictionary page scan.
bhadrakṛtmfn. (with jaina-s) Name of the 24th arhat- of the future utsarpiṇī- View this entry on the original dictionary page scan.
bhadrakumbham. "auspicious jar", a golden jar filled with water from a holy place or from the Ganges (used especially at the consecration of a king) View this entry on the original dictionary page scan.
bhadralakṣaṇan. the mark of a bhadra- elephant (whose chief and inferior limbs are in good proportion) View this entry on the original dictionary page scan.
bhadramustakam. () a kind of Cyperus (only in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
bhadrārakam. Name of one of the 18 lesser dvīpa-s View this entry on the original dictionary page scan.
bhadraśaunakam. Name of an ancient physician View this entry on the original dictionary page scan.
bhadrāvakāśāf. Name of a river View this entry on the original dictionary page scan.
bhagabhakakam. "living by the vulva", a procurer, pander View this entry on the original dictionary page scan.
bhagabhakta(bh/aga--) mfn. fortune-favoured, endowed with prosperity View this entry on the original dictionary page scan.
bhāgakamfn. (in fine compositi or 'at the end of a compound') equals bhāga-, a part, portion, share View this entry on the original dictionary page scan.
bhāgakam. (in arithmetic) a divisor View this entry on the original dictionary page scan.
bhāgakalpanāf. the allotment of shares View this entry on the original dictionary page scan.
bhagakāmamf(ā-)n. desirous of sexual pleasure View this entry on the original dictionary page scan.
bhāgalakamfn. gaRa arīhaṇādi-. View this entry on the original dictionary page scan.
bhāgalakṣaṇāf. insinuation or intimation of a part View this entry on the original dictionary page scan.
bhaganetrāntakam. () "destroyer of bhagas- eyes", Name of śiva-. View this entry on the original dictionary page scan.
bhagavadārādhanakramam. Name of work View this entry on the original dictionary page scan.
bhagavadbhakti(in the beginning of a compound),"devotion to bhagavat- or kṛṣṇa-" View this entry on the original dictionary page scan.
bhagavadbhakticandrikāf. Name of work View this entry on the original dictionary page scan.
bhagavadbhakticandrikollāsam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktimāhātmyan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktinirṇayam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktirasāyaṇan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktiratnāvalīf. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktisādhanan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktisārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktistotran. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktitaraṃgiṇīf. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktivilāsam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktivivekam. Name of work View this entry on the original dictionary page scan.
bhagavadbhāvakam. Name of the author of a commentator or commentary on View this entry on the original dictionary page scan.
bhagavadgītābhāvaprakāśam. Name of work View this entry on the original dictionary page scan.
bhagavadgītābodhakan. Name of work View this entry on the original dictionary page scan.
bhagavadgītālakṣābharaṇan. Name of work View this entry on the original dictionary page scan.
bhagavadgītārtharakṣāf. Name of work View this entry on the original dictionary page scan.
bhagavadudyamanāṭakan. Name of a play. View this entry on the original dictionary page scan.
bhagavannāmakaumudīf. Name of work View this entry on the original dictionary page scan.
bhāgavatakathāsaṃgraham. Name of work View this entry on the original dictionary page scan.
bhāgavatakaumudīf. an explanation of some difficult passages in the View this entry on the original dictionary page scan.
bhāgavatakramasaṃdarbham. Name of work View this entry on the original dictionary page scan.
bhāgavatāmṛtakaṇikāf. Name of work View this entry on the original dictionary page scan.
bhāgavatāmṛtāṣṭakan. Name of work View this entry on the original dictionary page scan.
bhāgavatapurāṇabhāvārthadīpikāprakaranakramasaṃgraham. Name of work connected with the View this entry on the original dictionary page scan.
bhāgavatapurāṇakroḍapattran. plural Name of work connected with the View this entry on the original dictionary page scan.
bhāgavatapurāṇaprakāśam. Name of work connected with the View this entry on the original dictionary page scan.
bhāgavatapurāṇasvarūpaviṣayakaśaṅkānirāsam. Name of work connected with the View this entry on the original dictionary page scan.
bhāgavatatattvadipaprakāśāvaraṇabhaṅgam. Name of work View this entry on the original dictionary page scan.
bhagavatīkīlakam. Name of work View this entry on the original dictionary page scan.
bhāgineyakam. (fr. bhaginī-) a sister's son etc. (also in friendly address to any younger person ) View this entry on the original dictionary page scan.
bhagīrathakanyāf. "daughter of bhagī-ratha-", Name of gaṅgā- View this entry on the original dictionary page scan.
bhagnadantanakhamfn. having the teeth and claws broken View this entry on the original dictionary page scan.
bhagnakāmaSee a-bhagnak-. View this entry on the original dictionary page scan.
bhagnakraman. the breaking id est violating of grammatical order or construction View this entry on the original dictionary page scan.
bhagnaprakraman. "broken arrangement", (in rhetoric) the use of a word which does not correspond to one used before (also bhagnaprakramatā -- f. ) View this entry on the original dictionary page scan.
bhagnaprakramatāf. bhagnaprakrama
bhagnaśaktimfn. one whose strength is broken View this entry on the original dictionary page scan.
bhagnaviṣāṇakamfn. having broken horns or tusks View this entry on the original dictionary page scan.
bhagnotsāhakriyātmanmfn. one whose energy and labour have been frustrated View this entry on the original dictionary page scan.
bhāgyakrameṇaind. in course of fortune View this entry on the original dictionary page scan.
bhaiḍakaand bhaiṇḍaka- mfn. (fr. bheḍa-, bheṇḍa-) relating to or coming from a sheep View this entry on the original dictionary page scan.
bhaikṣaka(in fine compositi or 'at the end of a compound') equals bhaikṣa-, alms View this entry on the original dictionary page scan.
bhaikṣakālam. "alms-time", the time for bringing home anything obtained as alms View this entry on the original dictionary page scan.
bhairavakārakamfn. causing terror, formidable View this entry on the original dictionary page scan.
bhairavaprādurbhāvanāṭakan. Name of work View this entry on the original dictionary page scan.
bhairavārcanakalpalatāf. Name of work View this entry on the original dictionary page scan.
bhairavāṣṭakan. Name of a collection of 8 View this entry on the original dictionary page scan.
bhairavatarjakam. "threatening terrible things", Name of viṣṇu- (properly of śiva-) View this entry on the original dictionary page scan.
bhaiṣmakamf(ī-)n., fr. bhīṣmaka- View this entry on the original dictionary page scan.
bhaiṣmakīf. patronymic of rukmiṇī- View this entry on the original dictionary page scan.
bhājakind. (gaRa di-) quickly, swiftly View this entry on the original dictionary page scan.
bhajakam. a distributer, apportioner (See civara-bh-) View this entry on the original dictionary page scan.
bhajakam. a worshipper View this entry on the original dictionary page scan.
bhājakam. (fr. Causal) a divisor (in arithmetic) View this entry on the original dictionary page scan.
bhakabhakāya(onomatopoetic (i.e. formed from imitation of sounds); confer, compare bheka-,a frog, and Greek ) Nom. A1. yate-, to croak (confer, compare bakabakāya-, makamakāya-). View this entry on the original dictionary page scan.
bhakakṣāf. the path of the asterisms View this entry on the original dictionary page scan.
bhakāram. the letter or sound bha-. View this entry on the original dictionary page scan.
bhakkikāf. a cricket (see phaḍiṅgā-). View this entry on the original dictionary page scan.
bhakkuḍaor bhakkura- m. a species of fish View this entry on the original dictionary page scan.
bhak (prob. a secondary form fr. bhaj-,or Nom.fr. bhakṣ/a-; see also bhikṣ-and bhañj-) cl.10 P. () bhakṣ/ayati- (rarely A1. te-), and in later language also cl.1 P. A1. () bhakṣati-, te- (perfect tense bhakṣayām āsa- etc. future bhakṣayiṣyati-, te- ; Aorist ababhakṣat- ; Passive voice abhakṣi- ; infinitive mood bhakṣayitum- , kṣitum- ; ind.p. bhakṣayitvā- ; -bhakṣya- ; -bhakṣam- ), to eat or drink, devour, partake of (with accusative,in Vedic or Veda also with genitive case;in the older language usually of fluids, in the later only exceptionally so) etc. ; to sting, bite ; to consume, use up, waste, destroy etc. ; to drain the resources of, impoverish : Causal bhakṣ/ayati- See above ; to cause anything (accusative) to be eaten by (accusative or instrumental case) Va1rtt. 7 : Desiderative bibhakṣiṣati- or kṣayiṣati-, to wish to eat or devour (see bibhakṣayiṣu-).
bhakṣam. drinking or eating, drink or (in later language) food etc. etc. (often in fine compositi or 'at the end of a compound',withf(ā-).,having anything for food or beverage, eating, drinking, living upon) View this entry on the original dictionary page scan.
bhakṣabījam. wrong reading for bhakṣya-b- View this entry on the original dictionary page scan.
bhakṣacchandasn. a metre used while eating the sacrificial food, View this entry on the original dictionary page scan.
bhakṣāhāram. a meal of leavings View this entry on the original dictionary page scan.
bhakṣajapam. the prayer muttered while drinking soma- View this entry on the original dictionary page scan.
bhakakamfn. one who eats, an eater, enjoyer, one who feeds or lives upon (often in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
bhakakamfn. voracious, gluttonous, a gourmand View this entry on the original dictionary page scan.
bhakakam. food View this entry on the original dictionary page scan.
bhakakam. a meal, food (see uṣṭra-bh-). View this entry on the original dictionary page scan.
bhakakāram. "food-maker", a cook, baker View this entry on the original dictionary page scan.
bhākṣālakamfn. relating to or coming from the place bhakṣālī- gaRa dhūmūdi-. View this entry on the original dictionary page scan.
bhakṣālīf. Name of a place gaRa dhūmādi- (not in ) View this entry on the original dictionary page scan.
bhakṣamantram. a verse spoken while drinking soma- View this entry on the original dictionary page scan.
bhakṣaṃkāramfn. furnishing food (see Va1rtt. 2 ) View this entry on the original dictionary page scan.
bhakṣaṃkṛtamfn. (kṣ/aṃ--) drunk or eaten, enjoyed View this entry on the original dictionary page scan.
bhakṣaṇamfn. eating, one who eats (see dāḍima--, pāpa-bh-) View this entry on the original dictionary page scan.
bhakṣaṇan. the act of eating, drinking, feeding etc. View this entry on the original dictionary page scan.
bhakṣaṇan. eating what excites thirst View this entry on the original dictionary page scan.
bhakṣaṇan. chewing View this entry on the original dictionary page scan.
bhakṣaṇan. the being eaten by (instrumental case) View this entry on the original dictionary page scan.
bhakṣaṇan. (bh/a-) a drinking vessel View this entry on the original dictionary page scan.
bhakṣaṇīyamfn. to be (or being) eaten View this entry on the original dictionary page scan.
bhakṣaṇīyatāf. eatableness View this entry on the original dictionary page scan.
bhakṣapattrīf. betel-pepper (the leaf of which serves for food) View this entry on the original dictionary page scan.
bhakṣaṭakam. a variety of Asteracantha Longifolia View this entry on the original dictionary page scan.
bhakṣavikāram. plural various dishes of food, View this entry on the original dictionary page scan.
bhakṣayitavyamfn. to be eaten or devoured, edible View this entry on the original dictionary page scan.
bhakṣayitṛm. an eater, enjoyer View this entry on the original dictionary page scan.
bhakṣikāf. eating, chewing (see ikṣu-bh-) View this entry on the original dictionary page scan.
bhakṣinmfn. (mostly in fine compositi or 'at the end of a compound'; bhakṣitva ṣi-tva- n.) eating, devouring View this entry on the original dictionary page scan.
bhakṣiṇīf. Coix Barbata View this entry on the original dictionary page scan.
bhakṣitamfn. eaten or drunk, chewed, masticated, devoured, enjoyed, partaken of etc. View this entry on the original dictionary page scan.
bhakṣitamfn. eaten (said of a particular bad pronunciation of words) View this entry on the original dictionary page scan.
bhakṣitan. the being eaten by (instrumental case) View this entry on the original dictionary page scan.
bhakṣitaśeṣam. remnants of food, leavings View this entry on the original dictionary page scan.
bhakṣitṛm. equals kṣayitṛ- View this entry on the original dictionary page scan.
bhakṣitvan. bhakṣin
bhakṣivanmfn. eating, enjoying (see bhakti-v/an-, -v/as-). View this entry on the original dictionary page scan.
bhakṣyamfn. to be eaten, eatable, fit for food etc. View this entry on the original dictionary page scan.
bhakṣyan. anything eaten, food (especially such as requires mastication) View this entry on the original dictionary page scan.
bhakṣyam. food, dish (prob. wrong reading for bhakṣa-) View this entry on the original dictionary page scan.
bhakṣyabhakakam. dual number food and the eater View this entry on the original dictionary page scan.
bhakṣyābhakṣyan. what may and may not be eaten, food allowed and prohibited View this entry on the original dictionary page scan.
bhakṣyabhojyamayamf(ī-)n. consisting of food of all kinds View this entry on the original dictionary page scan.
bhakṣyabhojyavihāravatmfn. furnished with various kinds of food and places of refection View this entry on the original dictionary page scan.
bhakṣyabijam. Buchanania Latifolia View this entry on the original dictionary page scan.
bhakṣyakāram. a baker View this entry on the original dictionary page scan.
bhakṣyakārakam. a baker View this entry on the original dictionary page scan.
bhakṣyālābuf. a variety of cucumber (equals rājālābu-) View this entry on the original dictionary page scan.
bhakṣyamālyāpaṇam. a market where victuals and garlands are sold View this entry on the original dictionary page scan.
bhakṣyaṃkāram. a baker View this entry on the original dictionary page scan.
bhakṣyavastun. edible matter, victuals, viands View this entry on the original dictionary page scan.
bhakta bhakti- etc. See p.743. View this entry on the original dictionary page scan.
bhaktamfn. distributed, assigned, allotted etc. View this entry on the original dictionary page scan.
bhaktamfn. divided View this entry on the original dictionary page scan.
bhaktamfn. (in fine compositi or 'at the end of a compound') forming part of, belonging to View this entry on the original dictionary page scan.
bhaktamfn. (in fine compositi or 'at the end of a compound') loved, liked View this entry on the original dictionary page scan.
bhaktamfn. served, worshipped View this entry on the original dictionary page scan.
bhaktamfn. dressed, cooked View this entry on the original dictionary page scan.
bhaktamfn. engaged in, occupied with, attached or devoted to, loyal, faithful, honouring, worshipping, serving (locative case genitive case accusative or compound) etc. View this entry on the original dictionary page scan.
bhaktam. a worshipper, votary (especially as Name of a division of the śākta-s) View this entry on the original dictionary page scan.
bhaktan. food or a meal etc. View this entry on the original dictionary page scan.
bhaktan. boiled rice View this entry on the original dictionary page scan.
bhaktan. any eatable grain boiled with water View this entry on the original dictionary page scan.
bhaktan. a vessel View this entry on the original dictionary page scan.
bhaktan. a share, portion View this entry on the original dictionary page scan.
bhaktābhilāṣam. equals ta-cchanda- View this entry on the original dictionary page scan.
bhaktābhisāram. an eating room (others"giving of food") View this entry on the original dictionary page scan.
bhaktacchandam. desire of food, hunger, appetite View this entry on the original dictionary page scan.
bhaktada() mfn. giving food, supporter, maintainer. View this entry on the original dictionary page scan.
bhaktadāsam. "food-slave", a slave who serves for his daily food View this entry on the original dictionary page scan.
bhaktadātṛ() mfn. giving food, supporter, maintainer. View this entry on the original dictionary page scan.
bhaktadāyaka() mfn. giving food, supporter, maintainer. View this entry on the original dictionary page scan.
bhaktadāyin() mfn. giving food, supporter, maintainer. View this entry on the original dictionary page scan.
bhaktadveṣam. aversion from food, loss of appetite View this entry on the original dictionary page scan.
bhaktadveṣinmfn. one who has lost his appetite View this entry on the original dictionary page scan.
bhaktagītāṭīkāf. Name of work View this entry on the original dictionary page scan.
bhaktāgram. or n. a refectory View this entry on the original dictionary page scan.
bhaktajāf. nectar View this entry on the original dictionary page scan.
bhaktajayantīf. Name of work View this entry on the original dictionary page scan.
bhaktakaṃsam. a dish of food View this entry on the original dictionary page scan.
bhaktākāṅkṣāf. equals ta-cchanda- View this entry on the original dictionary page scan.
bhaktakaram. equals -kāra- View this entry on the original dictionary page scan.
bhaktakaram. artificially prepared incense View this entry on the original dictionary page scan.
bhaktakāram. "food-preparer", a cook View this entry on the original dictionary page scan.
bhaktakṛtyan. preparations for a meal (kṛta-bh-,one who has made a meal ) View this entry on the original dictionary page scan.
bhaktamālāf. (and bhaktamālāgragrantha gra-grantha- m. see ) View this entry on the original dictionary page scan.
bhaktamālāgragrantham. bhaktamālā
bhaktamaṇḍa m. n. the scum of boiled rice View this entry on the original dictionary page scan.
bhaktamaṇḍakam. n. the scum of boiled rice View this entry on the original dictionary page scan.
bhaktamayastotran. View this entry on the original dictionary page scan.
bhaktamīmāṃsāf. Name of work View this entry on the original dictionary page scan.
bhaktamodataraṃgiṇīf. Name of work View this entry on the original dictionary page scan.
bhaktāmṛtan. Name of work View this entry on the original dictionary page scan.
bhaktapātran. equals -kaṃsa- View this entry on the original dictionary page scan.
bhaktapratiṣṭhāf. Name of work View this entry on the original dictionary page scan.
bhaktapulākam. or n. (?) a mouthful of rice kneaded into a ball View this entry on the original dictionary page scan.
bhaktārādhanaprayogamaṇimālikāf. Name of work View this entry on the original dictionary page scan.
bhaktarocanamfn. exciting appetite View this entry on the original dictionary page scan.
bhaktarucif. equals -cchanda- View this entry on the original dictionary page scan.
bhaktārucif. equals ta-dveṣa- View this entry on the original dictionary page scan.
bhaktaśālāf. "food-hall", (prob.) equals prec. (others"audience-chamber") View this entry on the original dictionary page scan.
bhaktaśaraṇan. "food-receptacle", a store-room or kitchen View this entry on the original dictionary page scan.
bhaktasiktha m. equals -pulāka- View this entry on the original dictionary page scan.
bhaktasikthakam. equals -pulāka- View this entry on the original dictionary page scan.
bhaktatāf. devotedness, attachment, inclination View this entry on the original dictionary page scan.
bhaktatūryan. music played during a meal View this entry on the original dictionary page scan.
bhaktatvan. (in fine compositi or 'at the end of a compound') the forming part of, belonging to Va1rtt. 2 Sch. View this entry on the original dictionary page scan.
bhaktavaibhavan. Name of work View this entry on the original dictionary page scan.
bhaktavatsalamfn. kind to worshippers or to faithful attendants View this entry on the original dictionary page scan.
bhaktavatsalamāhātmyan. Name of chapter of View this entry on the original dictionary page scan.
bhaktavilāsam. Name of work View this entry on the original dictionary page scan.
bhaktavrātasaṃtoṣikamn. Name of work View this entry on the original dictionary page scan.
bhaktif. distribution, partition, separation etc. (see kṣetra--, bhaṅgī-bh-) View this entry on the original dictionary page scan.
bhaktif. a division, portion, share View this entry on the original dictionary page scan.
bhaktif. a division of a sāman- (also called vidhi-,of which 7 or 5 are enumerated)
bhaktif. division by streaks or lines View this entry on the original dictionary page scan.
bhaktif. a streak, line, variegated decoration View this entry on the original dictionary page scan.
bhaktif. a row, series, succession, order ( bhaktyā tyā- ind.and bhaktitas ti-tas- ind.in succession) View this entry on the original dictionary page scan.
bhaktif. (in fine compositi or 'at the end of a compound') the being a part of (ajbhakteḥ-,"on the part of the vowels") , belonging to etc. View this entry on the original dictionary page scan.
bhaktif. that which belongs to or is contained in anything else, an attribute View this entry on the original dictionary page scan.
bhaktif. predisposition (of body to any disease) View this entry on the original dictionary page scan.
bhaktif. attachment, devotion, fondness for, devotion to (with locative case, genitive case or in fine compositi or 'at the end of a compound'), trust, homage, worship, piety, faith or love or devotion (as a religious principle or means of salvation, together with karman-,"works", and jñāna-,"spiritual knowledge"; see ) etc. View this entry on the original dictionary page scan.
bhaktif. (in fine compositi or 'at the end of a compound') assumption of the form of View this entry on the original dictionary page scan.
bhaktif. often wrong reading for bhaṅgi- or bhukti- View this entry on the original dictionary page scan.
bhaktibhājmfn. possessing true devotion, firmly attached or devoted to (locative case or compound) View this entry on the original dictionary page scan.
bhaktibhavam. Name of work View this entry on the original dictionary page scan.
bhaktibhāvapradīpam. Name of work View this entry on the original dictionary page scan.
bhaktibhuṣaṇasaṃdarbham. Name of work View this entry on the original dictionary page scan.
bhaktibindum. Name of work View this entry on the original dictionary page scan.
bhakticandrikāf. Name of work View this entry on the original dictionary page scan.
bhakticandrikollāsam. Name of work View this entry on the original dictionary page scan.
bhakticandrodayam. Name of work View this entry on the original dictionary page scan.
bhakticchedam. plural divided lines or streaks of painting or decoration (especially the separating or distinguishing marks on the forehead, nose, cheeks, breast and arms, which denote devotion to viṣṇu-, kṛṣṇa- etc.) View this entry on the original dictionary page scan.
bhaktidīpikāf. Name of work View this entry on the original dictionary page scan.
bhaktidūtīf. Name of work View this entry on the original dictionary page scan.
bhaktīdyāvāpṛthivīf. dual number Name of the deities to whom the garbha-puroḍāśa- is offered View this entry on the original dictionary page scan.
bhaktīdyāvāpṛthivyamfn. sacred to these deities View this entry on the original dictionary page scan.
bhaktigamyamfn. accessible by devotion (śiva-) View this entry on the original dictionary page scan.
bhaktihaṃsam. Name of work View this entry on the original dictionary page scan.
bhaktihetunirṇayam. Name of work View this entry on the original dictionary page scan.
bhaktihīnamfn. destitute of devotion View this entry on the original dictionary page scan.
bhaktijñamfn. knowing faith or devotion, faithfully attached View this entry on the original dictionary page scan.
bhaktijñatāf. () devotion, faithfulness, loyalty. View this entry on the original dictionary page scan.
bhaktijñatvan. () devotion, faithfulness, loyalty. View this entry on the original dictionary page scan.
bhaktikaonly in fine compositi or 'at the end of a compound' View this entry on the original dictionary page scan.
bhaktikaSee uttara--, eka--, and paurva-bhaktika-. View this entry on the original dictionary page scan.
bhaktikalpatarum. Name of work View this entry on the original dictionary page scan.
bhaktikāpalatāf. Name of work View this entry on the original dictionary page scan.
bhaktikaramf(ī-)n. View this entry on the original dictionary page scan.
bhaktilamfn. attached, faithful, trusty (said of horses) View this entry on the original dictionary page scan.
bhaktilaharīf. Name of work View this entry on the original dictionary page scan.
bhaktimahatmfn. truly devoted View this entry on the original dictionary page scan.
bhaktimahodayam. Name of work View this entry on the original dictionary page scan.
bhaktimañjarīf. Name of work View this entry on the original dictionary page scan.
bhaktimārgam. "the way of devotion"(regarded as a means of salvation and opp. to karma--and jñāna-m-; see above ) View this entry on the original dictionary page scan.
bhaktimārganirūpaṇan. Name of work View this entry on the original dictionary page scan.
bhaktimārgopadeśadīkṣāf. Name of work View this entry on the original dictionary page scan.
bhaktimatmfn. equals -bhāj- etc. View this entry on the original dictionary page scan.
bhaktimatmfn. accompanied by devotion or loyalty View this entry on the original dictionary page scan.
bhaktimīmāṃsasūtran. Name of work View this entry on the original dictionary page scan.
bhaktimuktāvalīf. Name of work View this entry on the original dictionary page scan.
bhaktinamramfn. bent down in devotion, making a humble obeisance View this entry on the original dictionary page scan.
bhaktiprabhāf. Name of work View this entry on the original dictionary page scan.
bhaktiprakaraṇan. Name of work View this entry on the original dictionary page scan.
bhaktiprārthanāf. Name of work View this entry on the original dictionary page scan.
bhaktipraśaṃsāvarṇanan. Name of work View this entry on the original dictionary page scan.
bhaktipratipādakamn. Name of work View this entry on the original dictionary page scan.
bhaktipravaṇamfn. faithfully devoted, View this entry on the original dictionary page scan.
bhaktipūrvakam() ind. preceded by devotion, devoutly, reverentially. View this entry on the original dictionary page scan.
bhaktipūrvam() ind. preceded by devotion, devoutly, reverentially. View this entry on the original dictionary page scan.
bhaktipūrvapakṣam. Name of work View this entry on the original dictionary page scan.
bhaktirāgam. affection or predilection for (locative case) View this entry on the original dictionary page scan.
bhaktirasam. a sense of devotion, feeling of loving faith View this entry on the original dictionary page scan.
bhaktirasābdhikaṇikāf. Name of work View this entry on the original dictionary page scan.
bhaktirasāmṛtan. Name of work View this entry on the original dictionary page scan.
bhaktirasāmṛtabindum. Name of work View this entry on the original dictionary page scan.
bhaktirasāmṛtasindhum. Name of work View this entry on the original dictionary page scan.
bhaktirasāyanan. Name of work View this entry on the original dictionary page scan.
bhaktiratnan. Name of work View this entry on the original dictionary page scan.
bhaktiratnākaram. Name of work View this entry on the original dictionary page scan.
bhaktiratnāvalīf. Name of work View this entry on the original dictionary page scan.
bhaktisāgaram. Name of work View this entry on the original dictionary page scan.
bhaktisāmānyanirūpaṇan. Name of work View this entry on the original dictionary page scan.
bhaktisaṃdarbham. (and bhaktisaṃdarbhapadyāvalī bha-padyāvalī- f.) Name of work View this entry on the original dictionary page scan.
bhaktisaṃdarbhapadyāvalīf. bhaktisaṃdarbha
bhaktisaṃnyāsanirṇayavivaraṇan. Name of work View this entry on the original dictionary page scan.
bhaktisaṃvardhanaśatakan. Name of work View this entry on the original dictionary page scan.
bhaktisāram. (and bhaktisārasaṃgraha ra-saṃgraha-,m.) Name of work View this entry on the original dictionary page scan.
bhaktisārasaṃgraham. bhaktisāra
bhaktiśāstran. Name of work View this entry on the original dictionary page scan.
bhaktiśatan. Name of work View this entry on the original dictionary page scan.
bhaktiśatakan. Name of work View this entry on the original dictionary page scan.
bhaktisiddhāntam. Name of work View this entry on the original dictionary page scan.
bhaktisudhodayam. Name of work View this entry on the original dictionary page scan.
bhaktisūtran. Name of work () View this entry on the original dictionary page scan.
bhaktitaraṃgiṇīf. Name of work View this entry on the original dictionary page scan.
bhaktitasind. bhakti
bhaktitattvarasāyanan. Name of work View this entry on the original dictionary page scan.
bhaktivādam. declaration of devotion or attachment View this entry on the original dictionary page scan.
bhaktivan() mfn. partaking of (with genitive case; see bhakṣi-v/an-). View this entry on the original dictionary page scan.
bhaktivardhinīf. Name of work View this entry on the original dictionary page scan.
bhaktivas() mfn. partaking of (with genitive case; see bhakṣi-v/an-). View this entry on the original dictionary page scan.
bhaktivijayam. Name of work View this entry on the original dictionary page scan.
bhaktivilāsam. (and bhaktivilāsatattvadīpikā sa-tattva-dīpikā- f.) Name of work View this entry on the original dictionary page scan.
bhaktivilāsatattvadīpikāf. bhaktivilāsa
bhaktivivṛddhyupāyagrantham. Name of work View this entry on the original dictionary page scan.
bhaktiyogam. devoted attachment, loving devotion View this entry on the original dictionary page scan.
bhaktiyogam. Name of 1st chapter of śiva-gītā-. View this entry on the original dictionary page scan.
bhaktoddeśakam. "food-prescriber", a particular official in a Buddhist monastery View this entry on the original dictionary page scan.
bhaktopasādhakam. "food-dresser", a cook View this entry on the original dictionary page scan.
bhaktṛmfn. devotedly attached, an adorer, worshipper View this entry on the original dictionary page scan.
bhaktṛtvan. adoration, worship View this entry on the original dictionary page scan.
bhaktyāind. not in the regular sense, figuratively View this entry on the original dictionary page scan.
bhaktyāind. bhakti
bhaktyadhikaraṇamālāf. Name of work View this entry on the original dictionary page scan.
bhaktyullāsamañjarīf. Name of work View this entry on the original dictionary page scan.
bhaktyupakramam. Name of work View this entry on the original dictionary page scan.
bhālakṛtm. Name of a man View this entry on the original dictionary page scan.
bhālandanakamfn. (fr. bhalandana-) gaRa arīhaṇādi-. View this entry on the original dictionary page scan.
bhallakam. a bear, View this entry on the original dictionary page scan.
bhallakīya gaRa utsādi-. View this entry on the original dictionary page scan.
bhāllakīyamfn. (fr. bhallakīya-) gaRa utsādi-. View this entry on the original dictionary page scan.
bhallātakam. idem or 'm. the marking-nut plant, Semecarpus Anacardium (n. equals next n.)' (also bhallātakī - f. ) View this entry on the original dictionary page scan.
bhallātakan. the Acajou or cashew-nut, she marking-nut (from which is extracted an acid juice used for medicinal purposes, and a black liquid used for marking linen) View this entry on the original dictionary page scan.
bhallātakatailan. the oil of the cashew-nut View this entry on the original dictionary page scan.
bhallātakīf. bhallātaka
bhallaṭaśatakan. the 100 couplets of bhallaṭa-. View this entry on the original dictionary page scan.
bhāmakam. a sister's husband View this entry on the original dictionary page scan.
bhāmatītilakan. Name of Comm. on the bhāmatī-. View this entry on the original dictionary page scan.
bhāṇakam. (see dharma-bh-) a proclaimer, declarer, reciter View this entry on the original dictionary page scan.
bhāṇḍabhajakam. the distributer of vessels or utensils (in a temple) View this entry on the original dictionary page scan.
bhāṇḍabharakam. the contents of any vessel View this entry on the original dictionary page scan.
bhāṇḍagopakam. the keeper of vessels or utensils (in a temple) View this entry on the original dictionary page scan.
bhaṇḍakam. a water wagtail View this entry on the original dictionary page scan.
bhaṇḍakam. Name of a poet View this entry on the original dictionary page scan.
bhāṇḍakamn. (m. ) a small vessel, cup, plate, box, chest View this entry on the original dictionary page scan.
bhāṇḍakamn. (in fine compositi or 'at the end of a compound') goods, merchandise View this entry on the original dictionary page scan.
bhāṇḍapratibhāṇḍakan. "commodity for commodity", computation of the exchange of goods, barter View this entry on the original dictionary page scan.
bhāṇḍarañjakamṛttikāf. a particular colouring earth used by potters View this entry on the original dictionary page scan.
bhāṇḍāvakāśadam. one who grants (thieves) room for (concealing their) implements View this entry on the original dictionary page scan.
bhaṇḍītakīf. equals ḍī- View this entry on the original dictionary page scan.
bhāṅgakan. (fr. bhaṅga-) a tattered or ragged cloth View this entry on the original dictionary page scan.
bhaṅgakaram. Name of two men (sons of avikṣit- and sattrājit-) View this entry on the original dictionary page scan.
bhaṅgībhaktif. division or separation into (a series of) waves or wave-like steps View this entry on the original dictionary page scan.
bhaṅgurakaSee mṛtyu-bh-. View this entry on the original dictionary page scan.
bhañjakamf(ikā-)n. who or what breaks or divides or destroys View this entry on the original dictionary page scan.
bhañjakam. a breaker (of doors) View this entry on the original dictionary page scan.
bhañjakam. Rubia Munjista View this entry on the original dictionary page scan.
bhānudatttakam. endearing form fr. deva-datta- View this entry on the original dictionary page scan.
bhānuśaktirājam. Name of a king View this entry on the original dictionary page scan.
bharadvājakam. a skylark. View this entry on the original dictionary page scan.
bhāradvājakamf(ikā-)n. belonging or relating to bharad-vāja- View this entry on the original dictionary page scan.
bhāradvājakīf. a skylark View this entry on the original dictionary page scan.
bhāradvājaśrāddhakāṇḍavyākhyāf. Name of work View this entry on the original dictionary page scan.
bhārakam. (prob.) a burden, load, weight (in fine compositi or 'at the end of a compound' f(ikā-).,loaded with; see phaṇi-bhārikā-) View this entry on the original dictionary page scan.
bhārakam. a particular weight (equals bhāra-) View this entry on the original dictionary page scan.
bhārakṣamamfn. able to bear loads (as a ship) View this entry on the original dictionary page scan.
bharaṇḍakeṣṇa(of unknown meaning), . View this entry on the original dictionary page scan.
bharatadvirūpakośam. Name of work View this entry on the original dictionary page scan.
bharaṭakam. a particular class of mendicants (also ḍaka-) View this entry on the original dictionary page scan.
bharaṭakadvātriṃśikāf. Name of a collection of 32 popular tales. View this entry on the original dictionary page scan.
bhāratakarṇam. Name of an author View this entry on the original dictionary page scan.
bharatakhaṇḍan. Name of a part of bharata-varṣa- (equals kumārikā-) View this entry on the original dictionary page scan.
bhāratapadaprakāśam. Name of work View this entry on the original dictionary page scan.
bharataputraka() m. "son of bharata-varṣa-", an actor, mime. View this entry on the original dictionary page scan.
bharatārjunanāṭakan. Name (also title or epithet) of a drama by hasti-malla-sena-. View this entry on the original dictionary page scan.
bhāratārthaprakāśam. Name of two Commentaries on View this entry on the original dictionary page scan.
bhāravāhakam. a load-bearer, porter View this entry on the original dictionary page scan.
bhārgavakan. a diamond View this entry on the original dictionary page scan.
bhārgavakalpavallīcakravidyārahasyan. Name of work View this entry on the original dictionary page scan.
bhartṛbhaktamfn. idem or 'mfn. devoted to one's master ' View this entry on the original dictionary page scan.
bhartṛdārakam. a king's son, crown prince (especially in dramatic language) View this entry on the original dictionary page scan.
bhartṛdarśanakāṅkṣāf. desire of seeing a husband View this entry on the original dictionary page scan.
bhartṛhariśatakan. Name of husband's collection of couplets (see above and ) . View this entry on the original dictionary page scan.
bhartsakamfn. (in fine compositi or 'at the end of a compound') threatening, reviling View this entry on the original dictionary page scan.
bharuṭakan. ( bhṝ-?) fried meat View this entry on the original dictionary page scan.
bharūṭakan. ( bhṝ-?) fried meat View this entry on the original dictionary page scan.
bhāryaka(in fine compositi or 'at the end of a compound') equals bhāryā-, a wife View this entry on the original dictionary page scan.
bhāryakaSee sa-bhāryaka-. View this entry on the original dictionary page scan.
bhāṣācitrakan. a play on words, conundrum View this entry on the original dictionary page scan.
bhaṣakam. a barker, dog View this entry on the original dictionary page scan.
bhāṣakamfn. (in fine compositi or 'at the end of a compound') speaking, talking about View this entry on the original dictionary page scan.
bhāsakamfn. (fr. Causal) causing to appear, enlightening, making evident or intelligible (in fine compositi or 'at the end of a compound') ( bhāsakatva -tva- n.) View this entry on the original dictionary page scan.
bhāsakamfn. Name of a dramatic poet (See bhāsa-). View this entry on the original dictionary page scan.
bhāsakarṇam. Name of a rākṣasa- View this entry on the original dictionary page scan.
bhāsakatvan. bhāsaka
bhāṣāprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhāṣipakṣinm. a talking bird View this entry on the original dictionary page scan.
bhāskarakaṇṭham. Name of an author View this entry on the original dictionary page scan.
bhasmādilakṣaṇan. Name of work 1. View this entry on the original dictionary page scan.
bhasmakamfn. (with agnī-) equals bhasmāgni-, View this entry on the original dictionary page scan.
bhasmakan. a particular disease of the eyes or morbid appetite from over-digestion (see bhasmāgni-) View this entry on the original dictionary page scan.
bhasmakan. gold View this entry on the original dictionary page scan.
bhasmakan. the fruit of Embelia Ribes View this entry on the original dictionary page scan.
bhasmakāram. "making id est using ashes ", a washerman View this entry on the original dictionary page scan.
bhasmakaumudīf. Name of work View this entry on the original dictionary page scan.
bhasmakṛtmfn. (in fine compositi or 'at the end of a compound') reducing to ashes View this entry on the original dictionary page scan.
bhasmakṛtamfn. reduced to ashes View this entry on the original dictionary page scan.
bhasmakūṭam. a heap of ashes View this entry on the original dictionary page scan.
bhasmakūṭam. Name of a mountain in kāmarūpa- (see bhasmācala-). View this entry on the original dictionary page scan.
bhasmasūtakaraṇan. the calcining of quicksilver View this entry on the original dictionary page scan.
bhasmavedhakam. camphor View this entry on the original dictionary page scan.
bhastrakāf. diminutive fr. bhastrā- (see bhastrākā-and bhastrikā- ) . View this entry on the original dictionary page scan.
bhāstrāyaṇakamfn. (fr. prec.) . View this entry on the original dictionary page scan.
bhasūcakam. "indicator of asterisms", an astrologer View this entry on the original dictionary page scan.
bhāsurakam. Name of a man View this entry on the original dictionary page scan.
bhāsurakam. (also -siṃha-), Name of a lion View this entry on the original dictionary page scan.
bhāṣyakaiyaṭīyan. kaiyaṭa-'s commentator or commentary on patañjali-'s bhāṣya- View this entry on the original dictionary page scan.
bhāṣyakāram. Name of various commentators (of patañjali-, śaṃkarācārya-, a poet etc.) vArttika View this entry on the original dictionary page scan.
bhāṣyakāraprapattif. Name of work View this entry on the original dictionary page scan.
bhāṣyakārastotran. Name of work View this entry on the original dictionary page scan.
bhāṣyakṛtm. the writer of any commentator or commentary , (especially) Name of patañjali- View this entry on the original dictionary page scan.
bhāṣyaratnaprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhāṭakam. equals prec., View this entry on the original dictionary page scan.
bhāṭakajīvikāf. subsistence by wages etc., View this entry on the original dictionary page scan.
bhaṭapeṭakan. a troop of soldiers View this entry on the original dictionary page scan.
bhaṭaprakāśam. Name of work View this entry on the original dictionary page scan.
bhaṭaprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhaṭṭabījakan. Name of authors View this entry on the original dictionary page scan.
bhāṭṭadinakaram. Name of work (and bhāṭṭadinakarīya rīya- n.), View this entry on the original dictionary page scan.
bhāṭṭadinakarīyan. View this entry on the original dictionary page scan.
bhāṭṭadinakarīyan. bhāṭṭadinakara
bhāṭṭadīpikānyakkāram. Name of work View this entry on the original dictionary page scan.
bhaṭṭakārikāf. plural Name of particular kārikā-s. View this entry on the original dictionary page scan.
bhāṭṭakaustubham. or n. Name of work View this entry on the original dictionary page scan.
bhaṭṭakedāram. equals kedāra-bh- q.v View this entry on the original dictionary page scan.
bhaṭṭanāyakam. Name of a poet and a rhetorician View this entry on the original dictionary page scan.
bhāṭṭaparibhāṣāprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhāṭṭaparibhāṣāprakāśikāf. bhāṭṭaparibhāṣā
bhaṭṭaprakāśam. Name of work (see bhaṭa-pr-). View this entry on the original dictionary page scan.
bhaṭṭarakamf(ikā-)n. venerable View this entry on the original dictionary page scan.
bhaṭṭārakam. a great lord, venerable or worshipful person (used of gods and of great or learned men, especially of Buddhist teachers and of a particular class of śaiva- monks) etc. View this entry on the original dictionary page scan.
bhaṭṭārakam. (in dramatic language) a king View this entry on the original dictionary page scan.
bhaṭṭārakam. the sun View this entry on the original dictionary page scan.
bhaṭṭārakam. Ardea Nivea View this entry on the original dictionary page scan.
bhaṭṭārakamf(ikā-)n. venerable View this entry on the original dictionary page scan.
bhaṭṭārakamaṭham. Name of a college View this entry on the original dictionary page scan.
bhaṭṭārakavāram. "day of the great lord id est the sun ", Sunday View this entry on the original dictionary page scan.
bhaṭṭārakāyatanan. a temple View this entry on the original dictionary page scan.
bhāṭṭasārakārikāf. Name of work View this entry on the original dictionary page scan.
bhātvakṣas(bh/ā-) mfn. producing light View this entry on the original dictionary page scan.
bhaugakam. patronymic fr. bhogaka- gaRa bidādi-. View this entry on the original dictionary page scan.
bhaujakaṭamfn. relating to or coming from bhoja-kaṭa- View this entry on the original dictionary page scan.
bhaumakam. any animal living in the earth View this entry on the original dictionary page scan.
bhaumavratakathāf. Name of work View this entry on the original dictionary page scan.
bhāvabodhakamf(ikā-)n. revealing any sentiment or feeling View this entry on the original dictionary page scan.
bhāvaguptiśatakan. Name of work View this entry on the original dictionary page scan.
bhavakam. (in fine compositi or 'at the end of a compound') equals bhava-, being, existence (exempli gratia, 'for example' parārtha-bh-,existing for others) View this entry on the original dictionary page scan.
bhavakāf. equals bhavatat- Va1rtt. 3 View this entry on the original dictionary page scan.
bhāvakamfn. (fr. Causal) causing to be, effecting (compound) View this entry on the original dictionary page scan.
bhāvakamfn. promoting any one's (genitive case) welfare View this entry on the original dictionary page scan.
bhāvakamfn. imagining, fancying (genitive case or compound) View this entry on the original dictionary page scan.
bhāvakamfn. having a taste for the beautiful or poetical View this entry on the original dictionary page scan.
bhāvakamfn. singing with expression View this entry on the original dictionary page scan.
bhāvakam. sentiment, affection View this entry on the original dictionary page scan.
bhāvakam. the external expression of amatory sentiments View this entry on the original dictionary page scan.
bhāvakāf. Name of a female demon (prob. wrong reading for bhāvukā-) View this entry on the original dictionary page scan.
bhavakalpam. Name of a particular kalpa- View this entry on the original dictionary page scan.
bhāvakalpam. Name of work View this entry on the original dictionary page scan.
bhāvakalpalatāf. Name of work View this entry on the original dictionary page scan.
bhavakāntāram. or n. (?) the wilderness of worldly existence View this entry on the original dictionary page scan.
bhāvakarmann. dual number the neuter and passive state (exempli gratia, 'for example' aśāyi-,it was slept, fr.2. śī-) View this entry on the original dictionary page scan.
bhāvakartṛkamfn. (a verb) having for its agent the state implied by it, an impersonal verb on View this entry on the original dictionary page scan.
bhāvakaumudīf. Name of work View this entry on the original dictionary page scan.
bhāvakeralīyan. Name of work View this entry on the original dictionary page scan.
bhavaketum. Name of a particular phenomenon in the sky View this entry on the original dictionary page scan.
bhavakhāmi(?) m. Name of a man (prob. wrong reading for -svāmin- q.v) View this entry on the original dictionary page scan.
bhavakṣitif. the place of birth View this entry on the original dictionary page scan.
bhāvaleśaprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhavānandīprakāśam. Name of Comm. on it View this entry on the original dictionary page scan.
bhavānandīyakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
bhāvanāpuruṣottamanāṭakan. Name of a drama. View this entry on the original dictionary page scan.
bhavānīsakham. " bhavānī-'s friend", Name of śiva- View this entry on the original dictionary page scan.
bhavānīstavaśatakan. View this entry on the original dictionary page scan.
bhavāntakṛtm. "destroying worldly existence", Name of brahmā- or of a buddha- View this entry on the original dictionary page scan.
bhavānyaṣṭakan. Name of work. View this entry on the original dictionary page scan.
bhāvaprakāśam. Name of various works. (especially of a medical work by bhāva-miśra-)
bhāvaprakāśakam. View this entry on the original dictionary page scan.
bhāvaprakāśakośam. Name of work View this entry on the original dictionary page scan.
bhāvaprakāśanighaṇṭum. Name of work View this entry on the original dictionary page scan.
bhāvaprakāśikāf. View this entry on the original dictionary page scan.
bhāvapratyayaśaktivicāram. View this entry on the original dictionary page scan.
bhāvarāmakṛṣṇam. Name of a man View this entry on the original dictionary page scan.
bhāvaratnakośam. Name of work View this entry on the original dictionary page scan.
bhāvārthakaustubhan. Name of work View this entry on the original dictionary page scan.
bhāvārthaprakāśikāf. Name of work View this entry on the original dictionary page scan.
bhāvaśatakan. Name of a poem. View this entry on the original dictionary page scan.
bhāvasiṃhaprakriyāf. Name of an elementary grammar. View this entry on the original dictionary page scan.
bhāvātmakamfn. "consisting of reality", real, actual ( bhāvātmakatā -- f.) View this entry on the original dictionary page scan.
bhāvātmakatāf. bhāvātmaka
bhāvavācakan. (?) an abstract noun View this entry on the original dictionary page scan.
bhāvicakravartinm. a future king, hereditary prince View this entry on the original dictionary page scan.
bhaviṣyadvaktṛ mfn. predicting future events, prophesying View this entry on the original dictionary page scan.
bhaviṣyakālam. the future tense View this entry on the original dictionary page scan.
bhāvitakan. equals bhāvita- n. View this entry on the original dictionary page scan.
bhavottārakam. a particular samādhi- View this entry on the original dictionary page scan.
bhayahāraka() mfn. removing or dispelling fear. View this entry on the original dictionary page scan.
bhayakampam. tremor from fear View this entry on the original dictionary page scan.
bhayakara mfn. causing fear, terrible, dangerous View this entry on the original dictionary page scan.
bhayakartṛmfn. causing fear, terrible, dangerous View this entry on the original dictionary page scan.
bhayakṛtmfn. idem or 'mfn. causing fear, terrible, dangerous ' View this entry on the original dictionary page scan.
bhayakṛtm. Name of viṣṇu- View this entry on the original dictionary page scan.
bhayānakamf(ā-)n. (prob. fr. bhayāna-for bhayamāna-) fearful, terrible, dreadful, formidable etc. View this entry on the original dictionary page scan.
bhayānakan. terror (?) View this entry on the original dictionary page scan.
bhayānakam. the sentiment of, terror (as one of the 9 rasa-s in poetical or dramatic composition) etc. View this entry on the original dictionary page scan.
bhayānakam. a tiger View this entry on the original dictionary page scan.
bhayānakam. rāhu- or the ascending node personified View this entry on the original dictionary page scan.
bhayānakarasanirdeśam. Name of chapter of View this entry on the original dictionary page scan.
bhayānakatāf. View this entry on the original dictionary page scan.
bhayānakatvan. fearfulness, formidableness. View this entry on the original dictionary page scan.
bhayeḍakam. a wild ram View this entry on the original dictionary page scan.
bhedadhikkāranyakkārahuṃkṛtif. Name of work View this entry on the original dictionary page scan.
bhedadhikkāranyakkāranirūpaṇan. Name of work View this entry on the original dictionary page scan.
bhedakamfn. breaking into or through, piercing, perforating View this entry on the original dictionary page scan.
bhedakamfn. diverting (water-courses) View this entry on the original dictionary page scan.
bhedakamfn. destroying (boundary-marks) View this entry on the original dictionary page scan.
bhedakamfn. seducing (ministers) View this entry on the original dictionary page scan.
bhedakamfn. making a difference, distinguishing, determining, defining. View this entry on the original dictionary page scan.
bhedakan. a determinative id est an adjective (see bhedya-). View this entry on the original dictionary page scan.
bhedakaramf(ī-)n. breaking through or down View this entry on the original dictionary page scan.
bhedakaramf(ī-)n. sowing dissension among or in (genitive case or compound) View this entry on the original dictionary page scan.
bhedakārinmfn. causing dissension or disunion View this entry on the original dictionary page scan.
bhedakārinmfn. making or showing a difference, altered View this entry on the original dictionary page scan.
bhedakhaṇḍanan. "refutation of duality", Name of a vedānta- work View this entry on the original dictionary page scan.
bhedakṛtmfn. equals -kara- View this entry on the original dictionary page scan.
bhedaprakāram. Name of work View this entry on the original dictionary page scan.
bhedaprakāśam. Name of work View this entry on the original dictionary page scan.
bhedyakaSee utpala-bh-. View this entry on the original dictionary page scan.
bhelakamn. bhela
bheṇḍītakam. Abelmoschus Esculentus View this entry on the original dictionary page scan.
bherībhramakam. supposed Name of a poet View this entry on the original dictionary page scan.
bheṣajabhakṣaṇan. "drug-eating", the act of taking medicine View this entry on the original dictionary page scan.
bheṣajakalpam. Name of work View this entry on the original dictionary page scan.
bheṣajakalpasārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bheṣajakaraṇan. preparation of drugs or medicine View this entry on the original dictionary page scan.
bheṣajakṛtamfn. healed, cured View this entry on the original dictionary page scan.
bheṭakam. buying, purchase View this entry on the original dictionary page scan.
bhidakam. "cutter"or"wounder", a sword View this entry on the original dictionary page scan.
bhidakam. indra-'s thunderbolt View this entry on the original dictionary page scan.
bhikṣāṭanakāvyan. Name of a poem View this entry on the original dictionary page scan.
bhikṣāṭananāṭakan. Name of a drama. View this entry on the original dictionary page scan.
bhillīcakreśvaram. Name of viṣṇu- View this entry on the original dictionary page scan.
bhilloṭakam. a species of plant (prob. = bhilla-taru-) View this entry on the original dictionary page scan.
bhīmakam. Name of a demon View this entry on the original dictionary page scan.
bhīmakalambakam. Name of an author View this entry on the original dictionary page scan.
bhīmakāram. Name of two men View this entry on the original dictionary page scan.
bhīmakarmanmfn. terrible in act, dreadful View this entry on the original dictionary page scan.
bhīmakārmukamfn. having formidable bows View this entry on the original dictionary page scan.
bhīmakāvyan. Name of work View this entry on the original dictionary page scan.
bhīmakhaṇḍan. Name of chapter in and View this entry on the original dictionary page scan.
bhīmanāyakam. Name of a man View this entry on the original dictionary page scan.
bhiṇḍakam. () Abelmoschus Esculentus. View this entry on the original dictionary page scan.
bhindipālakam. a short javelin or arrow thrown from the hand or shot through a tube (others"a stone fastened to a string"or"a kind of sling for throwing stones") (varia lectio bhindapāla-, bhiṇḍimālā-, bhindomāla-, bhindimāla-or laka-, bhindumāla-). View this entry on the original dictionary page scan.
bhiṇḍītakam. () Abelmoschus Esculentus. View this entry on the original dictionary page scan.
bhinnagaṇḍakaraṭamfn. equals -karaṭa- View this entry on the original dictionary page scan.
bhinnakamfn. broken View this entry on the original dictionary page scan.
bhinnakam. "a seceder", a Buddhistic mendicant View this entry on the original dictionary page scan.
bhinnakam. Name of a musical mode or rāga- View this entry on the original dictionary page scan.
bhinnakālamfn. one who does not keep to the right time, View this entry on the original dictionary page scan.
bhinnakalpamfn. having different rites View this entry on the original dictionary page scan.
bhinnakaraṭa() mfn. a rutting elephant having a fissure in the temples (from which fluid exudes). View this entry on the original dictionary page scan.
bhinnakarīndrakumbhamuktāmayamf(ī-)n. consisting of pearls fallen from the crack in the frontal protuberances of a chief elephant View this entry on the original dictionary page scan.
bhinnakarṇamfn. having divided ears (said of particular animals) View this entry on the original dictionary page scan.
bhinnakaṭa() mfn. a rutting elephant having a fissure in the temples (from which fluid exudes). View this entry on the original dictionary page scan.
bhinnakīind. with kṛ-, to divide, separate View this entry on the original dictionary page scan.
bhinnakleśamfn. one in whom the (Buddhistic) kleśa-s (sub voce, i.e. the word in the Sanskrit order) are destroyed View this entry on the original dictionary page scan.
bhinnakleśatvan.
bhinnakramamfn. out of order or place, displaced commentator or commentary View this entry on the original dictionary page scan.
bhinnakumbham. a person who has regained his liberty by redeeming his pledge View this entry on the original dictionary page scan.
bhinnakūṭamfn. each employing a different stratagem (Scholiast or Commentator) View this entry on the original dictionary page scan.
bhinnakūṭan. an army whose inferior officers have perished View this entry on the original dictionary page scan.
bhinnaliṅgakamf(ikā-)n. containing words of different gender View this entry on the original dictionary page scan.
bhinnamastakapiṇḍaka mfn. whose skull and forehead are cloven, (an elephant) whose frontal prominences have fissures View this entry on the original dictionary page scan.
bhinnamastakapiṇḍikamfn. whose skull and forehead are cloven, (an elephant) whose frontal prominences have fissures View this entry on the original dictionary page scan.
bhinnapnakāramfn. of a different kind or sort View this entry on the original dictionary page scan.
bhinnaśakṛtmfn. equals -varcas- View this entry on the original dictionary page scan.
bhinnavyavakalitan. subtraction of fractions View this entry on the original dictionary page scan.
bhīrakaSee under bhīruka-. View this entry on the original dictionary page scan.
bhiṣakin compound for 2. bhiṣaj-. View this entry on the original dictionary page scan.
bhīṣakam. (fr. Causal) Name of one of śiva-'s attendants (see bhīmaka-) View this entry on the original dictionary page scan.
bhīṣaka ṣaṇa- etc. See p.758. View this entry on the original dictionary page scan.
bhiṣakcakracittotsavam. Name of work View this entry on the original dictionary page scan.
bhiṣakcakranidānan. Name of work View this entry on the original dictionary page scan.
bhiṣakpāśam. an inferior physicians, quack doctor (see under pāśa-). View this entry on the original dictionary page scan.
bhiṣakpriyāf. "dear to a physicians", Cocculus Cordifolius View this entry on the original dictionary page scan.
bhiṣaktamamfn. (ṣ/ak--) most healing View this entry on the original dictionary page scan.
bhiṣaktamam. dual number "the best physicians", the aśvin-s View this entry on the original dictionary page scan.
bhiṣaktara(ṣ/ak--) mfn. more healing View this entry on the original dictionary page scan.
bhiṣaktvan. the state or condition of a physicians View this entry on the original dictionary page scan.
bhīṣaṇakamfn. terrifying, horrible View this entry on the original dictionary page scan.
bhiṣāyakam. a yakṣa- View this entry on the original dictionary page scan.
bhiṣāyakapuran. Name of a town View this entry on the original dictionary page scan.
bhīṣmakam. bhīṣma- the son of śāṃtanu- (used contemptuously) View this entry on the original dictionary page scan.
bhīṣmakam. Name of another king (the father of rukmiṇī- who was carried off by kṛṣṇa-) View this entry on the original dictionary page scan.
bhīṣmakātmajāf. " bhīṣma-'s daughter", patronymic of rukmiṇī- View this entry on the original dictionary page scan.
bhīṣmamuktipradāyakam. "giving release to bhīṣma-", Name of viṣṇu- View this entry on the original dictionary page scan.
bhīṣmapañcakan. "five days sacred to bhīṣma-", the 5 days from the 11th to the 15th in the light half of the month kārttika- View this entry on the original dictionary page scan.
bhīṣmapañcakavratan. Name of a particular observance performed during this period View this entry on the original dictionary page scan.
bhītināṭitakan. mimic representation of fear View this entry on the original dictionary page scan.
bhlak (varia lectio for bhakṣ-) cl.1 P. A1. bhlakṣati-, te-, to eat View this entry on the original dictionary page scan.
bhobhavatpūrvakamind. with bhoḥ- and bhavat- preceding View this entry on the original dictionary page scan.
bhogabhṛtakam. a servant who works only for maintenance View this entry on the original dictionary page scan.
bhogakaramf(ī-)n. producing or affording enjoyment View this entry on the original dictionary page scan.
bhogakārikāf. Name of work View this entry on the original dictionary page scan.
bhogakarmanm. (with kāśmīra-), Name of a poet (equals bhogi-varman-). View this entry on the original dictionary page scan.
bhojakamfn. eating (See bahu-bh-) View this entry on the original dictionary page scan.
bhojakamfn. being about to eat View this entry on the original dictionary page scan.
bhojakamfn. (fr. Causal) giving to eat, nourishing View this entry on the original dictionary page scan.
bhojakam. (perhaps) a waiter at table View this entry on the original dictionary page scan.
bhojakam. Name of a class of priests (or Sun-worshippers, supposed to be descended from the maga-s by intermarriage with women of the bhoja- race) View this entry on the original dictionary page scan.
bhojakam. an astrologer View this entry on the original dictionary page scan.
bhojakam. Name of a king View this entry on the original dictionary page scan.
bhojakanyāf. a girl of the race of the bhoja-s View this entry on the original dictionary page scan.
bhojakaṭan. Name of a town View this entry on the original dictionary page scan.
bhojakaṭan. the country of bhoja- (the present Bhojpur, or the vicinity of Patna and Bhagalpur) View this entry on the original dictionary page scan.
bhojakaṭam. plural the inhabitants of the town of bhoja-kaṭa-
bhojakaṭīyam. plural the inhabitants of bhojakaṭa- View this entry on the original dictionary page scan.
bhojakulapradīpam. "lamp of the race of Bhojpur", Name of a king of vidarbha- View this entry on the original dictionary page scan.
bhojanakam. a species of plant commentator or commentary View this entry on the original dictionary page scan.
bhojanakālam. meal-time View this entry on the original dictionary page scan.
bhojanakastūrīf. Name of work View this entry on the original dictionary page scan.
bhojanakīsmṛtif. Name of work View this entry on the original dictionary page scan.
bhojanakutūhalan. Name of work on culinary art, View this entry on the original dictionary page scan.
bhojarājakavivargam. Name of work View this entry on the original dictionary page scan.
bhojyakālam. eating time, meal-time View this entry on the original dictionary page scan.
bhokṣyakam. Name of a people View this entry on the original dictionary page scan.
bhokṣyakam. plural Name of a people View this entry on the original dictionary page scan.
bhoktṛśaktif. the faculty of the soul as the enjoyer and possessor of nature View this entry on the original dictionary page scan.
bhoṭīyakośīf. Name of a river View this entry on the original dictionary page scan.
bhrājakamf(ī-)n. (fr. Causal) causing to shine, making bright (said of the digestive fire and bile as brightening the skin) View this entry on the original dictionary page scan.
bhrājakan. the bile, bilious humour, gall View this entry on the original dictionary page scan.
bhrakSee bhṛkṣ-, p.765. View this entry on the original dictionary page scan.
bhrakuṃśaor sa-, bhra-kuñca-, bhrakuṭi- etc. See under bhrū-, . View this entry on the original dictionary page scan.
bhrakuṃśa m. equals bhrūkuṃśa- View this entry on the original dictionary page scan.
bhrakuṃsam. equals bhrūkuṃśa- View this entry on the original dictionary page scan.
bhrakuñcam. the son of kṣatriya- and a Jalli View this entry on the original dictionary page scan.
bhrakuṭif. (L.) equals bhrūkuṭi- View this entry on the original dictionary page scan.
bhrakuṭīf. () equals bhrūkuṭi- View this entry on the original dictionary page scan.
bhrakuṭīmukhamfn. with a frowning face View this entry on the original dictionary page scan.
bhrāmakamf(ikā-)n. (fr. Causal) causing error, deceitful, false View this entry on the original dictionary page scan.
bhrāmakamn. "causing (scilicet iron) to turn round", a magnet (also bhrāmakādri dri-,m.) View this entry on the original dictionary page scan.
bhrāmakam. "turning round (scilicet towards the sun?)", a sunflower, heliotrope View this entry on the original dictionary page scan.
bhrāmakam. a deceiver, cheat View this entry on the original dictionary page scan.
bhrāmakāf. a species of plant View this entry on the original dictionary page scan.
bhrāmakādrim. bhrāmaka
bhramakuṭīf. a sort of umbrella (see bhramat-k-). View this entry on the original dictionary page scan.
bhramaradūtakāvyan. Name of a poem (= -saṃdeśa-k-). View this entry on the original dictionary page scan.
bhramarakamn. a curl on the forehead (see bhramarālaka-) View this entry on the original dictionary page scan.
bhramarakam. a bee View this entry on the original dictionary page scan.
bhramarakam. a ball for playing with View this entry on the original dictionary page scan.
bhramarakam. a whirlpool View this entry on the original dictionary page scan.
bhramarakan. a humming-top (-bhrāmam-with Causal of bhram-,to cause to spin like a humming-top ) View this entry on the original dictionary page scan.
bhramarakan. honey of the large black bee View this entry on the original dictionary page scan.
bhramarakaraṇḍakam. a small box containing bees (which are let out by thieves to extinguish lights in houses) View this entry on the original dictionary page scan.
bhramarakīṭam. Vespa Solitaria View this entry on the original dictionary page scan.
bhramarakuṇḍan. Name of a sacred bathing-place on the mountain nīla- View this entry on the original dictionary page scan.
bhramarālakan. "bee-curl", a curl on the forehead View this entry on the original dictionary page scan.
bhramarāmbāṣṭakan. Name of work View this entry on the original dictionary page scan.
bhramarasadṛśakeśatāf. having hair dark like a bee (one of the 80 minor marks of a buddha-) View this entry on the original dictionary page scan.
bhramarasaṃdeśakāvyan. equals -dūta-k-, q.v View this entry on the original dictionary page scan.
bhramarāṣṭakan. Name of a poem (see bhṛṅgāṣṭaka-). View this entry on the original dictionary page scan.
bhramāsaktam. "occupied at the grindstone" View this entry on the original dictionary page scan.
bhramāsaktam. a sword cleaner, armourer View this entry on the original dictionary page scan.
bhraṃśakalākṛ gaRa ūry-ādi- () View this entry on the original dictionary page scan.
bhraṣṭakam. Name of a man View this entry on the original dictionary page scan.
bhraṣṭakam. plural his descendants gaRa upakādi-. View this entry on the original dictionary page scan.
bhraṣṭakakapiṣṭhalam. plural gaRa tikakitavādi-. View this entry on the original dictionary page scan.
bhraṣṭakriyamfn. one who has discontinued or omitted prescribed acts View this entry on the original dictionary page scan.
bhraṣṭavaiṣṇavakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
bhrāṣṭrakam. or n. (?) a frying-pan (varia lectio) View this entry on the original dictionary page scan.
bhrāṣṭrakam. Name of a man (see next) . View this entry on the original dictionary page scan.
bhrāṣṭrakim. patronymic fr. prec. View this entry on the original dictionary page scan.
bhrāṣṭrakṛtSee bhrāṣṭreya-. View this entry on the original dictionary page scan.
bhrātṛvyakṣayaṇamfn. destroying rivals View this entry on the original dictionary page scan.
bhṛguharītakīf. a particular mixture View this entry on the original dictionary page scan.
bhṛjjakaṇṭakam. a particular mixed tribe (varia lectio bhūrja--, bhūta-k-etc.; see next) . View this entry on the original dictionary page scan.
bhṛjjakaṇṭham. a particular mixed tribe (the son of a Brahman vrātya- and a brāhmaṇī-. ) View this entry on the original dictionary page scan.
bhṛjjakaṇṭham. a surgeon View this entry on the original dictionary page scan.
bhṛjjakaṇṭhakam. a person who uses medicinal roots for injurious purposes View this entry on the original dictionary page scan.
bhṛkuṃsakam. equals bhrū-kuṃśa-
bhṛṅgakamfn. (in fine compositi or 'at the end of a compound') equals bhṛṅga-, a bee View this entry on the original dictionary page scan.
bhṛṅgakam. the fork-tailed shrike View this entry on the original dictionary page scan.
bhṛṅgakam. Name of a man View this entry on the original dictionary page scan.
bhṛṅgarājakam. a species of bird View this entry on the original dictionary page scan.
bhṛṅgārakam. a pitcher or vase (equals bhṛṅgāra-) View this entry on the original dictionary page scan.
bhṛṅgāṣṭakan. Name of work View this entry on the original dictionary page scan.
bhṛśakopanamfn. extremely passionate, very wrathful
bhṛṣṭakāram. a preparer of roasted or fried meat View this entry on the original dictionary page scan.
bhṛtakamfn. brought, fetched (See drāg-bh-) View this entry on the original dictionary page scan.
bhṛtakamfn. hired, receiving wages View this entry on the original dictionary page scan.
bhṛtakam. a hired labourer, servant etc. View this entry on the original dictionary page scan.
bhṛtakādhyāpakam. a hired teacher View this entry on the original dictionary page scan.
bhṛtakādhyāpanan. instruction given by a hired teacher View this entry on the original dictionary page scan.
bhṛtakādhyāpitamfn. taught by a hired teacher View this entry on the original dictionary page scan.
bhṛtakādhyayanan. learning from a hired teacher, View this entry on the original dictionary page scan.
bhṛtikarmakaram. a hired labourer or servant View this entry on the original dictionary page scan.
bhṛtyakāmakṛtmfn. acting kindly to servants View this entry on the original dictionary page scan.
bhrūsaṃgatakan. the contact of the eyebrows View this entry on the original dictionary page scan.
bhūbhramavādakhaṇḍananirāsam. Name of work View this entry on the original dictionary page scan.
bhūcakran. "earth-circle", the equator or equinoctial line View this entry on the original dictionary page scan.
bhūdharātmakam. Name of baṭukabhairava- View this entry on the original dictionary page scan.
bhūgolahastāmalakan. Name of work View this entry on the original dictionary page scan.
bhūgolakam. the terrestrial globe View this entry on the original dictionary page scan.
bhūgolakhagolavirodhaparihāram. Name of work View this entry on the original dictionary page scan.
bhujadaṇḍaka() m. "arm-staff", a long arm. View this entry on the original dictionary page scan.
bhujagāntakam. "serpent-destroyer", Name of garuḍa- View this entry on the original dictionary page scan.
bhujakoṭaram. the armpit View this entry on the original dictionary page scan.
bhujaṃgakanyāf. a young female snake or a serpent. nymph View this entry on the original dictionary page scan.
bhujaṃgaprayātāṣṭakan. Name of work View this entry on the original dictionary page scan.
bhūkadambakam. Ptychotis Ajowan View this entry on the original dictionary page scan.
bhūkarbudārakam. Cordia Myxa View this entry on the original dictionary page scan.
bhuktiprakaraṇan. Name of work View this entry on the original dictionary page scan.
bhūlakṣaṇan. Name of work View this entry on the original dictionary page scan.
bhūlakṣaṇapaṭalamn. Name of a mantra-. View this entry on the original dictionary page scan.
bhūliṅgaśakunam. a species of bird (said to make a sound like mā sāhasam-,"no rashness!")
bhūliṅgaśakunim. a species of bird (said to make a sound like mā sāhasam-,"no rashness!")
bhūlokakailāsamāhātmyan. Name of a chapter of the View this entry on the original dictionary page scan.
bhūlokasuranāyakam. an indra- of the earth View this entry on the original dictionary page scan.
bhūmakatṛtīyāf. Name of the 3rd day in a particular , month View this entry on the original dictionary page scan.
bhūmicampakam. Kaempferia Rotunda View this entry on the original dictionary page scan.
bhūmikandaka n. a mushroom View this entry on the original dictionary page scan.
bhūmīkurabakam. a species of plant View this entry on the original dictionary page scan.
bhūmipakṣam. a swift horse View this entry on the original dictionary page scan.
bhūmipāśakāf. a species of plant View this entry on the original dictionary page scan.
bhūmirakakam. the guardian or protector of a country View this entry on the original dictionary page scan.
bhūmirakakam. a swift horse View this entry on the original dictionary page scan.
bhūmyāmalakī f. Flacourtia Cataphracta View this entry on the original dictionary page scan.
bhūmyāmalakīf. Phyllanthus Niruri View this entry on the original dictionary page scan.
bhūnāyakam. a prince or king View this entry on the original dictionary page scan.
bhūpādiskandhalakṣaṇan. Name of work View this entry on the original dictionary page scan.
bhūprakampam. (in fine compositi or 'at the end of a compound' f(ā-).) an earthquake View this entry on the original dictionary page scan.
bhūrbhuvakaram. a dog View this entry on the original dictionary page scan.
bhūricakṣas(bh/ūri--) mfn. "much-seeing"or"affording manifold appearances"(said of the sun) View this entry on the original dictionary page scan.
bhūridakṣiṇamfn. attended with rich presents or rewards View this entry on the original dictionary page scan.
bhūridakṣiṇamfn. bestowing rich presents (especially on Brahmans at a sacrifice), liberal View this entry on the original dictionary page scan.
bhūridakṣiṇamind. with rich offerings or presents View this entry on the original dictionary page scan.
bhūrisakhamfn. "having many friends"or,"dear to many", View this entry on the original dictionary page scan.
bhūriśreṣṭhakaor
bhūrjakaṇṭakam. a man of one of the mixed classes (the son of an out-caste Brahman by a woman of the name tribe) (varia lectio bhūtya-kaṇṭaka-and bhṛjja-k-; see bhṛjya-kaṇṭa-). View this entry on the original dictionary page scan.
bhūryakṣamfn. many-eyed View this entry on the original dictionary page scan.
bhūśakram. "earth- indra-", a king, prince View this entry on the original dictionary page scan.
bhūṣaṇadāyakamfn. bestowing ornaments View this entry on the original dictionary page scan.
bhūṣaṇakāntif. Name of work View this entry on the original dictionary page scan.
bhūtakālam. past time or the preterite tense View this entry on the original dictionary page scan.
bhūtakālikamfn. relating to it View this entry on the original dictionary page scan.
bhūtakaraṇan. "causing a word to have a past meaning", Name of the augment View this entry on the original dictionary page scan.
bhūtakaraṇavatīf. (scilicet vibhakti-) the character and personal endings of the augmented verbal forms (id est of imperfect tense Aorist and Conditional) View this entry on the original dictionary page scan.
bhūtakarmanm. Name of a man View this entry on the original dictionary page scan.
bhūtakartṛm. "maker of beings", brahmā-, the creator View this entry on the original dictionary page scan.
bhūtakeśam. Corydalis Goveniana (also n.andf(ī-).) View this entry on the original dictionary page scan.
bhūtakesarāf. Trigonella Foenum Graecum View this entry on the original dictionary page scan.
bhūtakeśīf. a species of plant (L Nardostachys Jatamansi, Vitex Negundo and white basil) . View this entry on the original dictionary page scan.
bhūtaketum. Name of a son of manu- dakṣa-sāvarṇi- View this entry on the original dictionary page scan.
bhūtaketum. of a vetāla- View this entry on the original dictionary page scan.
bhūtakoṭif. "the highest culminating point for all beings", absolute non-entity (equals śūnya--) View this entry on the original dictionary page scan.
bhūtakrāntif. (for k-?) possession by spirits View this entry on the original dictionary page scan.
bhūtakṛtmfn. forming beings, creative View this entry on the original dictionary page scan.
bhūtakṛtm. the creator etc. View this entry on the original dictionary page scan.
bhūtakṛtm. plural a class of gods View this entry on the original dictionary page scan.
bhūtalakṣaṇan. Name of work View this entry on the original dictionary page scan.
bhūtāntakam. "destroyer of beings", the god of death View this entry on the original dictionary page scan.
bhūtaprakṛtif. the origin of all beings View this entry on the original dictionary page scan.
bhūtārthakathanan. () statement of facts View this entry on the original dictionary page scan.
bhūtātmakamfn. possessing the essence of the elements View this entry on the original dictionary page scan.
bhūtavināyakam. a leader of evil beings View this entry on the original dictionary page scan.
bhūteṣṭakāf. a particular kind of brick View this entry on the original dictionary page scan.
bhūtiyuvakam. plural Name of a people View this entry on the original dictionary page scan.
bhūtyakaṇṭaka varia lectio for bhūrja-k- (See bhūrja-). View this entry on the original dictionary page scan.
bhuvanadīpakam. Name of work (and bhuvanadīpakaśāstra ka-śāstra- n.) View this entry on the original dictionary page scan.
bhuvanadīpakaśāstran. bhuvanadīpaka
bhuvanakośam. the globe or sphere of the earth View this entry on the original dictionary page scan.
bhuvanakośam. Name of several works. View this entry on the original dictionary page scan.
bhuvanāṇḍakan. the world-egg View this entry on the original dictionary page scan.
bhuvaneśvarīdaṇḍakamn. Name of work View this entry on the original dictionary page scan.
bhuvaneśvarīkakṣapuṭatantran. Name of work View this entry on the original dictionary page scan.
bibhakṣayiṣāf. (fr. Desiderative of bhaj-) a desire of eating or enjoying View this entry on the original dictionary page scan.
bibhakṣayiṣumfn. desirous of eating View this entry on the original dictionary page scan.
bibhakṣayiṣudaṃṣṭrinmfn. "having teeth desirous of eating", hungry-mouthed View this entry on the original dictionary page scan.
bībhatsakam. Name of a man View this entry on the original dictionary page scan.
bībhatsakarmanmfn. doing loathsome or wicked things (as an abusive word) View this entry on the original dictionary page scan.
bibhrajjiṣuprakhyamfn. resembling fire (equals agni-tulya- Scholiast or Commentator) View this entry on the original dictionary page scan.
bibhrakṣumfn. (fr. Desiderative of bhrajj-) wishing to parch or destroy View this entry on the original dictionary page scan.
bibhrakṣum. fire View this entry on the original dictionary page scan.
bidakula(vida--) n. equals vaidasya- and vaidayoḥ kulam- Va1rtt. 1 View this entry on the original dictionary page scan.
bidālakam. a cat View this entry on the original dictionary page scan.
bidālakam. the eyeball View this entry on the original dictionary page scan.
bidālakam. application of ointment to the eye View this entry on the original dictionary page scan.
bidālakan. yellow orpiment
bidalakārīf. a woman employed in splitting bamboos View this entry on the original dictionary page scan.
biḍālapadakan. a particular measure of weight (= karṣa-) View this entry on the original dictionary page scan.
biḍārakam. a cat (see next) . View this entry on the original dictionary page scan.
bījadarśakam. "explainer of the germ or plot of a play", a stage. manager View this entry on the original dictionary page scan.
bījādhyakṣam. "presiding over seed", Name of śiva- View this entry on the original dictionary page scan.
bījakan. seed View this entry on the original dictionary page scan.
bījakan. a list View this entry on the original dictionary page scan.
bījakam. Citrus Medica etc. View this entry on the original dictionary page scan.
bījakam. a citron or lemon View this entry on the original dictionary page scan.
bījakam. Terminalia Tomentosa View this entry on the original dictionary page scan.
bījakam. the position of the arms of a child at birth View this entry on the original dictionary page scan.
bījakam. Name of a poetry or poetic View this entry on the original dictionary page scan.
bījakāṇḍaprarohin() (i, 48) mfn. springing from a seed or from the (slip or portion taken from a) stalk, View this entry on the original dictionary page scan.
bījakāṇḍaruha mfn. springing from a seed or from the (slip or portion taken from a) stalk, View this entry on the original dictionary page scan.
bījakartṛm. "producer of seed", Name of śiva- View this entry on the original dictionary page scan.
bījakośam. Name of a tantra- View this entry on the original dictionary page scan.
bījakośam. = f(ī-). a seed-vessel (especially of the lotus) View this entry on the original dictionary page scan.
bījakośam. a pod View this entry on the original dictionary page scan.
bījakośoddhāram. Name of work View this entry on the original dictionary page scan.
bījakriyāf. the operation of analysis, algebraic solution View this entry on the original dictionary page scan.
bījakṛtn. "producing semen", an aphrodisiac View this entry on the original dictionary page scan.
bījaphalakam. Citrus Medica View this entry on the original dictionary page scan.
bījapūrakam. ( ) "seed-filled", a citron, Citrus Medica View this entry on the original dictionary page scan.
bījapūrakan. a citron View this entry on the original dictionary page scan.
bījodakan. "grain-(like) water", hail View this entry on the original dictionary page scan.
bījopticakran. a kind of astrology diagram for indicating good or bad luck following on the sowing of seed View this entry on the original dictionary page scan.
bilakārinm. "hole-maker", a mouse View this entry on the original dictionary page scan.
bilhaṇakāvyan. Name of work View this entry on the original dictionary page scan.
bilhaṇaśatakan. Name of work View this entry on the original dictionary page scan.
bilvakam. Name of a serpent. demon View this entry on the original dictionary page scan.
bilvakam. Name of a place of pilgrimage (see bailvaki-) View this entry on the original dictionary page scan.
bilvakam. a crab View this entry on the original dictionary page scan.
bilvakīyāf. a place planted with bilva- trees gaRa naḍādi- (see bailvaka-). View this entry on the original dictionary page scan.
bilvāmrakam. or n. (?) Name of a place on the revā- or narmadā- river View this entry on the original dictionary page scan.
bilvāmrakamāhātmyan. Name of work View this entry on the original dictionary page scan.
bilvāṣṭakan. Name of work View this entry on the original dictionary page scan.
bilvodakeśvaram. Name of a temple of śiva- View this entry on the original dictionary page scan.
bimbakan. the disk of the sun or moon (also f(ikā-).) View this entry on the original dictionary page scan.
bimbakan. the fruit of Momordica Monadelpha (also f(ikā-).) View this entry on the original dictionary page scan.
bimbakan. a round form, roundness (of a face) View this entry on the original dictionary page scan.
bimbakim. Name of a prince View this entry on the original dictionary page scan.
bimbalakṣaṇan. Name of work View this entry on the original dictionary page scan.
bimbatattvaprakāśikāf. Name of work View this entry on the original dictionary page scan.
binducitrakam. the spotted antelope. View this entry on the original dictionary page scan.
bindujālakan. collection or mass of dots or spots (especially on an elephant's face and trunk) View this entry on the original dictionary page scan.
bindupattrakam. a species of Amaranthus View this entry on the original dictionary page scan.
bindurakam. Ximenia Aegyptiaca View this entry on the original dictionary page scan.
bindurekhakam. a kind of bird (see prec. and next) . View this entry on the original dictionary page scan.
bisakaṇṭhikāf. a kind of small crane View this entry on the original dictionary page scan.
bisakaṇṭhinm. a kind of small crane View this entry on the original dictionary page scan.
bisakmfn. one who digs up fibres of lotus-roots View this entry on the original dictionary page scan.
bisakhādikāf. "eating lotus-fibres", Name of a play or sport View this entry on the original dictionary page scan.
bisakisalayacchedapatheyavatmfn. having pieces of fibres of young lotus as provisions for a journey View this entry on the original dictionary page scan.
bisakusuman. a lotus-flower View this entry on the original dictionary page scan.
biśāyaka(or viś-) m. a species of Euphorbia (see bitākara-). View this entry on the original dictionary page scan.
biṭakamfn. equals piṭaka-, a boil View this entry on the original dictionary page scan.
bīṭakasee vīṭaka-. View this entry on the original dictionary page scan.
biṭhakan. equals antarikṣa-, the sky View this entry on the original dictionary page scan.
bodhakamf(ikā-)n. awakening, arousing View this entry on the original dictionary page scan.
bodhakamf(ikā-)n. causing to know, explaining, teaching, instructing, a teacher, instructor View this entry on the original dictionary page scan.
bodhakamf(ikā-)n. (in fine compositi or 'at the end of a compound') denoting, indicating, signifying ( bodhakatva -tva- n.) View this entry on the original dictionary page scan.
bodhakam. a spy, informer View this entry on the original dictionary page scan.
bodhakam. Name of a man (plural his descendants) View this entry on the original dictionary page scan.
bodhakam. of a poet View this entry on the original dictionary page scan.
bodhakaramf(ī-)n. one who wakens or rouses or teaches or informs View this entry on the original dictionary page scan.
bodhakaram. "awakener", a minstrel who wakes a prince in the morning with music View this entry on the original dictionary page scan.
bodhakatvan. bodhaka
bodhaprakriyāf. Name of work View this entry on the original dictionary page scan.
bodhāyanakalpavivaraṇan. Name of work View this entry on the original dictionary page scan.
bodhipakṣadharmam. a quality belonging to (or a constituent of) perfect intelligence View this entry on the original dictionary page scan.
bodhipakṣadharmanirdeśam. Name of work View this entry on the original dictionary page scan.
bodhipakṣikamfn. belonging to perfect intelligence (with dharma-, m. equals pakṣa-dh- ). View this entry on the original dictionary page scan.
bodhisattvapakṣanirdeśam. Name of work View this entry on the original dictionary page scan.
bodhisattvapiṭakamn. Name of work View this entry on the original dictionary page scan.
bodhisattvāvadānakalpalatāf. Name of work View this entry on the original dictionary page scan.
bollakam. (bahu-b-) a great talker (confer, compare Hindi bolnā-,to speak) . View this entry on the original dictionary page scan.
bradhnacakran. the zodiac View this entry on the original dictionary page scan.
brahmacakran. " brahmā-'s wheel", the circle of the universe View this entry on the original dictionary page scan.
brahmacakran. Name of a particular magical circle View this entry on the original dictionary page scan.
brahmaduṣakamfn. falsifying the Vedic texts View this entry on the original dictionary page scan.
brahmaghātakam. a Brahman-killer View this entry on the original dictionary page scan.
brahmaikyaprakaraṇan. Name of work View this entry on the original dictionary page scan.
brahmajātakan. Name of work View this entry on the original dictionary page scan.
brāhmakan. equals -brahmaṇā kṛtam- (saṃjñāyām-) gaRa kulālādi- View this entry on the original dictionary page scan.
brahmakaivartapurāṇan. Name of a purāṇa-. View this entry on the original dictionary page scan.
brahmakalāf. Name of dākṣāyaṇī- who dwells in the heart of men View this entry on the original dictionary page scan.
brahmakalpamfn. like brahmā- View this entry on the original dictionary page scan.
brahmakalpam. the cosmic period of brahmā- View this entry on the original dictionary page scan.
brahmakalpam. Name of work View this entry on the original dictionary page scan.
brahmakāṇḍan. the inner portion of the veda- which relates to sacred knowledge or the knowledge of brahma- (= jñāna-k-,and opp. to karma-k- q.v), View this entry on the original dictionary page scan.
brahmakāṇḍan. Name of work (or chapter of a work) of bhartṛ-hari- View this entry on the original dictionary page scan.
brahmakanya(prob.) m. Clerodendrum Siphonantus View this entry on the original dictionary page scan.
brahmakanyakam. (prob.) idem or '(prob.) m. Clerodendrum Siphonantus ' View this entry on the original dictionary page scan.
brahmakanyakāf. Ruta Graveolens View this entry on the original dictionary page scan.
brahmakanyakāf. Name of sarasvatī- View this entry on the original dictionary page scan.
brahmakaram. an impost paid to the Brahmanical class View this entry on the original dictionary page scan.
brahmakāramfn. making or offering prayers View this entry on the original dictionary page scan.
brahmakāraṇavādam. Name of work View this entry on the original dictionary page scan.
brāhmakārikāf. plural Name of particular kārikā-s View this entry on the original dictionary page scan.
brahmakarmann. the office of the brahman- (id est presiding priest) or of the Brahmans View this entry on the original dictionary page scan.
brahmakarmapradāyakam. Name of kṛṣṇa- View this entry on the original dictionary page scan.
brahmakarmaprakāśakam. Name of kṛṣṇa- View this entry on the original dictionary page scan.
brahmakarmapustakan. Name of a manual on ceremonies View this entry on the original dictionary page scan.
brahmakarmasamādhimfn. occupied with or meditating upon the one self-existent Spirit View this entry on the original dictionary page scan.
brahmakāṣṭham. Thespesia Populneoides View this entry on the original dictionary page scan.
brahmakāyam. plural Name of a particular class of deities View this entry on the original dictionary page scan.
brahmakāyikamfn. belonging to the brahma-kāya-s ( ) . View this entry on the original dictionary page scan.
brahmaketum. Name of a man View this entry on the original dictionary page scan.
brahmakhaṇḍan. Name of View this entry on the original dictionary page scan.
brahmakilbiṣan. an offence against Brahmans View this entry on the original dictionary page scan.
brahmakileya(?) m. Name of a man View this entry on the original dictionary page scan.
brahmakośam. the treasury of the brahma- id est of the sacred word or text, the entire collection of the veda-s View this entry on the original dictionary page scan.
brahmakośam. Name of atri- View this entry on the original dictionary page scan.
brahmakośīf. a species of plant (equals aja-modā-) View this entry on the original dictionary page scan.
brahmakṛtmfn. making or offering prayers (also applied to indra-, viṣṇu-, the marut-s etc.) View this entry on the original dictionary page scan.
brahmakṛtam. Name of a man gaRa śubhrādi-. View this entry on the original dictionary page scan.
brāhmakṛteyam. patronymic fr. brahma-kṛta- gaRa śubhrādi-.
brahmakṛti(br/ahma--) f. prayer, devotion View this entry on the original dictionary page scan.
brahmakṣatran. sg. and dual number Brahmans and kṣatriya-s View this entry on the original dictionary page scan.
brahmakṣatrasavam. plural Name of particular rites
brahmakṣetran. Name of a sacred district View this entry on the original dictionary page scan.
brahmakuṇḍan. Name of a sacred pool View this entry on the original dictionary page scan.
brahmakūrcan. a particular kind of penance (in which the 5 products of the cow are eaten; see pañcagavya-) View this entry on the original dictionary page scan.
brahmakūrcavidhim. Name of the 38th pariśiṣṭa- of the View this entry on the original dictionary page scan.
brahmakuśāf. a species of cumin View this entry on the original dictionary page scan.
brahmakuśāf. equals aja-modā- View this entry on the original dictionary page scan.
brahmakūṭam. a thoroughly learned Brahman View this entry on the original dictionary page scan.
brahmakūṭam. Name of a mountain, View this entry on the original dictionary page scan.
brahmalakṣaṇavākyārtham. Name of an abridgment of the vedānta-sudhā-rahasya-. View this entry on the original dictionary page scan.
brāhmaṇabhaktamfn. apportioned to Brahmans, View this entry on the original dictionary page scan.
brāhmaṇakam. a bad Brahman, a brāhmaṇaka- only by name View this entry on the original dictionary page scan.
brāhmaṇakam. a country inhabited by warlike brāhmaṇaka- ( brāhmaṇakīya kīya- mfn. ) View this entry on the original dictionary page scan.
brāhmaṇakalpam. plural the brāhmaṇa-s and kalpa-s (two kinds of Vedic texts) View this entry on the original dictionary page scan.
brāhmaṇakalpamfn. like a Brahman View this entry on the original dictionary page scan.
brāhmaṇakāmyāf. love for brāhmaṇa- View this entry on the original dictionary page scan.
brāhmaṇakārakamfn. making a person a brāhmaṇa- , on View this entry on the original dictionary page scan.
brāhmaṇakīyamfn. brāhmaṇaka
brāhmaṇakṛtam. Name of a man View this entry on the original dictionary page scan.
brāhmaṇakṛteyam. patronymic fr. prec. (f(ī-).) gaRa śārṅgaravādi-. View this entry on the original dictionary page scan.
brāhmaṇakulan. the house of a brāhmaṇa- View this entry on the original dictionary page scan.
brāhmaṇakumāram. a brāhmaṇa- boy View this entry on the original dictionary page scan.
brāhmaṇalakṣaṇan. Name of work View this entry on the original dictionary page scan.
brahmānandīyakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
brāhmaṇanindakamfn. reviling brāhmaṇa- View this entry on the original dictionary page scan.
brāhmaṇaputrakam. a Brahman boy View this entry on the original dictionary page scan.
brāhmaṇātmakamfn. belonging to brāhmaṇa- View this entry on the original dictionary page scan.
brāhmaṇātmakamfn. containing an account of the brāhmaṇa- View this entry on the original dictionary page scan.
brahmāṇḍakalpam. Name of Tantric work View this entry on the original dictionary page scan.
brahmāṇḍakapālam. the skull or hemisphere of the world, the inhabited earth View this entry on the original dictionary page scan.
brahmāṇḍakaṭāham. brahmāṇḍa
brahmapathakovidamfn. knowing the way to brahma- View this entry on the original dictionary page scan.
brahmaprakṛtikamfn. emanating from or originating in brahma- ( brahmaprakṛtikatva -tva- n.) View this entry on the original dictionary page scan.
brahmaprakṛtikatvan. brahmaprakṛtika
brahmapurakam. plural Name of a people View this entry on the original dictionary page scan.
brahmarakṣasn. a class of evil demons (see -rākṣasa-). View this entry on the original dictionary page scan.
brahmaśabdaśaktivādam. Name of work View this entry on the original dictionary page scan.
brahmāstrakalpam. Name of work View this entry on the original dictionary page scan.
brahmāstrakāryasādhanan. Name of work View this entry on the original dictionary page scan.
brahmāstrakavacamn. Name of work View this entry on the original dictionary page scan.
brahmasūtrakārikāf. Name of work View this entry on the original dictionary page scan.
brahmasūtrārthaprakāśikāf. Name of Comm. on the brahma-sūtra- View this entry on the original dictionary page scan.
brahmavaivartakan. "metamorphoses of brahmā-"(who is identified with kṛṣṇa-), Name of a purāṇa- (one of the most modern of the 18, containing prayers and invocations addressed to kṛṣṇa- with narratives about his loves for the gopī-s and rādhā- etc.) () View this entry on the original dictionary page scan.
brahmavaktṛm. a proclaimer or teacher of sacred knowledge View this entry on the original dictionary page scan.
brahmavarcasakāmamfn. desirous of holiness or sacred knowledge View this entry on the original dictionary page scan.
brāhmīśāntyavadhānakramam. Name of work View this entry on the original dictionary page scan.
brahmottarakhaṇḍan. brahmottara
bṛhaccāṇakyan. the larger collection of precepts by cāṇakya- (q.v) View this entry on the original dictionary page scan.
bṛhacchṛṅgāratilaka(hac-+ śṛ-), n. the larger śṛṅgāra-tilaka- View this entry on the original dictionary page scan.
bṛhadamarakośam. "the larger amara-koṣa-", Name of a particular recension of the amara- with interpolations. View this entry on the original dictionary page scan.
bṛhadambāśatakan. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyaka(also bṛhadāraṇya āraṇya- n. bṛhadāraṇyakopaniṣad k/opaniṣad- f.) n. Name of a celebrated upaniṣad- forming the last 5 prapāṭhaka-s or last 6 adhyāya-s of the śatapatha- brāhmaṇa- View this entry on the original dictionary page scan.
bṛhadāraṇyakabhāṣyan. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakabhāṣyaṭīkāf. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakabhāṣyavārttikan. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakāpaniṣadvārttikan. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakavārttikasāramn. (?) Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakaviṣayanirṇayam. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakavivekam. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakavyākhyāf. Name of work View this entry on the original dictionary page scan.
bṛhadāraṇyakopaniṣadf. bṛhadāraṇyaka
bṛhadāraṇyakopaniṣatkhaṇḍārtham. Name of work View this entry on the original dictionary page scan.
bṛhadbrahmotarakhaṇḍam. Name of a part of the skanda-purāṇa-. View this entry on the original dictionary page scan.
bṛhaḍdhakf. a large drum View this entry on the original dictionary page scan.
bṛhaddharmaprakāśam. "the large dharma-prakāśa-", Name of work View this entry on the original dictionary page scan.
bṛhadgaurīvratakathāf. bṛhadgaurīvrata
bṛhadratnakārikāf. Name of work View this entry on the original dictionary page scan.
bṛhajjātakan. Name of varāhamihira-'s larger work on nativities (see sv/aipa-jātaka-) View this entry on the original dictionary page scan.
bṛhajjātakan. of another work View this entry on the original dictionary page scan.
bṛhajjātakaślokavyākhyānan. of a metrical commentator or commentary by bhaṭṭotpala- on the former work View this entry on the original dictionary page scan.
bṛhajjīrakam. large cumin View this entry on the original dictionary page scan.
bṛhakam. Name of a deva-gandharva- View this entry on the original dictionary page scan.
bṛhallakṣahomam. a particular oblation View this entry on the original dictionary page scan.
bṛhannakf. a particular perfume View this entry on the original dictionary page scan.
bṛhannāṭakan. Name of a play (prob. the mahā-n-).
bṛhannāyakīdaṇḍakam. or n. (?) , Name of work View this entry on the original dictionary page scan.
bṛhaspaticakran. "cycle of bṛhas-pati-", the Hindu cycle of 60 years View this entry on the original dictionary page scan.
bṛhaspaticakran. a particular astrological diagram View this entry on the original dictionary page scan.
bṛhaspatipakṣataf. Name of work View this entry on the original dictionary page scan.
bṛhaspatisavakḷptif. Name of work View this entry on the original dictionary page scan.
bṛhatkośalakhaṇḍam. n. (?) Name of work View this entry on the original dictionary page scan.
bṛhatkośātakīf. a kind of gourd View this entry on the original dictionary page scan.
bṛhatṣoḍaśakāraṇapūjāf. Name of work View this entry on the original dictionary page scan.
bubhūṣakamfn. (fr. Desiderative of bhu-) wishing the welfare of, wishing to be of service to (genitive case or comp.) View this entry on the original dictionary page scan.
buddhacakṣusn. ,"Buddha's eye", Name of one of the 5 sorts of vision View this entry on the original dictionary page scan.
buddhakam. Name of a poet View this entry on the original dictionary page scan.
buddhakāpam. Name of the present buddha- era (which has already had 4 buddha-s, gautama- being the fourth). View this entry on the original dictionary page scan.
buddhakapālinīf. Name of one of the 6 goddesses of magic View this entry on the original dictionary page scan.
buddhakāyavarṇapariniṣpattyabhinirhārāf. a particular dhāraṇī- View this entry on the original dictionary page scan.
buddhakṣetran. Buddha's district, the country in which a Buddha appears View this entry on the original dictionary page scan.
buddhakṣetrapariśodhakan. Name of one of the 3 kinds of praṇidhāna- View this entry on the original dictionary page scan.
buddhakṣetravaralocanan. a particular samādhi- View this entry on the original dictionary page scan.
buddhāṇḍaka wrong reading for buddhaiḍūka- q.v View this entry on the original dictionary page scan.
buddhapakṣa(?) m. Name of a king View this entry on the original dictionary page scan.
buddharakṣitam. "guarded by Buddha", Name of a man View this entry on the original dictionary page scan.
buddharakṣitāf. Name of a woman, View this entry on the original dictionary page scan.
buddhāvataṃsakam. or n. (?) Name of work View this entry on the original dictionary page scan.
buddhicintakamfn. one who thinks wisely View this entry on the original dictionary page scan.
buddhilakṣaṇan. a sign of intellect or wisdom, View this entry on the original dictionary page scan.
buddhipūrvakamfn. (and buddhipūrvakam kam- ind.) equals prec. ( buddhipūrvakatva -tva- n. ) View this entry on the original dictionary page scan.
buddhipūrvakamind. buddhipūrvaka
buddhipūrvakatvan. buddhipūrvaka
buddhiśaktif. an intellectual faculty View this entry on the original dictionary page scan.
buddhividhvaṃsakamfn. destroying consciousness or reason View this entry on the original dictionary page scan.
buddhopāsakam. (f(ikā-).) a worshipper of buddha- View this entry on the original dictionary page scan.
budhakam. Name of a man View this entry on the original dictionary page scan.
budhakauśikam. Name of an author View this entry on the original dictionary page scan.
budhaprakāśam. Name of work View this entry on the original dictionary page scan.
budhāṣṭamīvratakālanirṇayam. Name of work View this entry on the original dictionary page scan.
cailakam. "clothed with a cela- (?)" , a mendicant (see celuka-.) View this entry on the original dictionary page scan.
cailakim. patronymic fr. c/elaka- Name of jīvala- View this entry on the original dictionary page scan.
cailāśakam. a kind of goblin feeding on moths View this entry on the original dictionary page scan.
caitakim. plural (fr. cetaka-) Name of a family View this entry on the original dictionary page scan.
caitrakam. equals trika- View this entry on the original dictionary page scan.
caitrakam. plural Name of a warrior tribe View this entry on the original dictionary page scan.
caitrakuṭīf. Name (also title or epithet) of a work on kṛt- suffixes (attributed to vara-ruci-) View this entry on the original dictionary page scan.
caitrakūṭīf. (fr. citra-kūṭa-) Name of a commentator or commentary on a grammatical work. View this entry on the original dictionary page scan.
caitrasakham. "friend of month caitra-", the god of love View this entry on the original dictionary page scan.
caitrīpakṣam. the dark half in caitra- View this entry on the original dictionary page scan.
caityakam. one of the 5 mountains surrounding the town giri-vraja-, . View this entry on the original dictionary page scan.
cak cl.1 P. A1. kati-, kate-, to be satiated or contented or satisfied ; to repel, resist ; to shine, (see kan-and kam-.) View this entry on the original dictionary page scan.
cakam. ( kan-?) Name of a nāga- priest (varia lectio cakka-) (see kuṭī--.) View this entry on the original dictionary page scan.
cākacakyan. equals ujjvala--, View this entry on the original dictionary page scan.
cakadrasee viś-- c-, parasmE-pada 991. View this entry on the original dictionary page scan.
cakana gaRa cūrṇādi- (vv.ll. cakkana-and cakvana-). View this entry on the original dictionary page scan.
cakāram. the letter or sound ca-. View this entry on the original dictionary page scan.
cakāram. the particle ca- View this entry on the original dictionary page scan.
cakās (see kāś-) cl.2 P. cakāsti- (3 plural sati- ; parasmE-pada sat- ; imperfect tense acakāt-,2. sg. kās-or kāt- ; imperative cakāddhi-, [ ]; kādhi- [on ]; perfect tense kāsāṃ cakāra-[ ] ; cl.1 A1.?3. dual number cakāśete- ), to shine, be bright: Causal cakāsayati- (Aorist acacakāsat-or acīc- ), to cause to shine, make bright View this entry on the original dictionary page scan.
cakāsmfn. shining View this entry on the original dictionary page scan.
cakāsitamfn. illuminated, splendid View this entry on the original dictionary page scan.
cakaṭyodanan. bad rice View this entry on the original dictionary page scan.
cakhvasmfn. (perfect tense P. parasmE-pada khan-?[ cakṣ- ], see kh/a-) displaying (?) View this entry on the original dictionary page scan.
cakitamfn. trembling, timid, frightened etc. (a-- negative"not staggering", as the gait ) View this entry on the original dictionary page scan.
cakitan. trembling, timidity, alarm etc. View this entry on the original dictionary page scan.
cakitāf. a metre of 4 x 16 syllables (see uc--, pra--.) View this entry on the original dictionary page scan.
cakitaSee cak-. View this entry on the original dictionary page scan.
cakitacakitamfn. greatly alarmed View this entry on the original dictionary page scan.
cakitacakitamind. with great alarm View this entry on the original dictionary page scan.
cakitagatimfn. walking timidly or hurriedly, View this entry on the original dictionary page scan.
cakitahṛdayamfn. faint-hearted View this entry on the original dictionary page scan.
cakitamind. tremblingly, with great alarm View this entry on the original dictionary page scan.
cakk cl.10 P. kkayati-, to suffer ; to give or inflict pain (?) View this entry on the original dictionary page scan.
cakka varia lectio for caka-. View this entry on the original dictionary page scan.
cakkalamfn. (for cakrala-) round, circular (?) View this entry on the original dictionary page scan.
cakkalakan. a series of 4 śloka-s (= caturbhiḥ kulaka-) (see cakra-bandha-.) View this entry on the original dictionary page scan.
cakkana varia lectio for cakana-. View this entry on the original dictionary page scan.
caknasam. ( knas-) View this entry on the original dictionary page scan.
cakoram. ( cak- ) the Greek partridge (Perdix rufa;fabled to subsist on moonbeams[ ; see ] , hence"an eye drinking the nectar of a moon-like face"is poetically called c- ;the eyes of the cakora- are said to turn red when they look on poisoned food on ) etc. View this entry on the original dictionary page scan.
cakoram. (plural) Name of a people View this entry on the original dictionary page scan.
cakoram. (sg.) of a prince View this entry on the original dictionary page scan.
cakoram. of a town (?) View this entry on the original dictionary page scan.
cakoradṛśmfn. having (eyes like those of the cakora- bird id est having) beautiful eyes View this entry on the original dictionary page scan.
cakorakam. in fine compositi or 'at the end of a compound' equals ra- (Perdix rufa) . View this entry on the original dictionary page scan.
cakoranetramf(ā-)n. idem or 'mfn. having (eyes like those of the cakora- bird id est having) beautiful eyes '
cakoravratan. "habit of a cakora- bird", enjoying the nectar of a moon-like face View this entry on the original dictionary page scan.
cakorāyaNom. A1. to act like the cakora- bird View this entry on the original dictionary page scan.
cakorīf. a female cakora- bird View this entry on the original dictionary page scan.
cakran. (Ved. rarely m.; gaRa ardharcādi-;fr. car-?;1. kṛ- ) the wheel (of a carriage, of the Sun's chariot[ ],of Time [ ]; kr/aṃ-car-,to drive in a carriage ) etc. View this entry on the original dictionary page scan.
cakran. a potter's wheel (see -bhrama-etc.) View this entry on the original dictionary page scan.
cakran. a discus or sharp circular missile weapon (especially that of viṣṇu-) View this entry on the original dictionary page scan.
cakran. an oil-mill View this entry on the original dictionary page scan.
cakran. a circle etc. (kalāpa--,"the circle of a peacock's tail") View this entry on the original dictionary page scan.
cakran. an astronomical circle (exempli gratia, 'for example' rāśi--,the zodiac) View this entry on the original dictionary page scan.
cakran. a mystical circle or diagram, View this entry on the original dictionary page scan.
cakran. equals -bandha- q.v View this entry on the original dictionary page scan.
cakran. a cycle, cycle of years or of seasons View this entry on the original dictionary page scan.
cakran. "a form of military array (in a circle)" See -vyūha- View this entry on the original dictionary page scan.
cakran. circular flight (of a bird) View this entry on the original dictionary page scan.
cakran. a particular constellation in the form of a hexagon View this entry on the original dictionary page scan.
cakran. a circle or depression of the body (for mystical or chiromantic purposes; 6 in number, one above the other, viz. 1. mūlādhāra-,the parts about the pubis;2. svādhiṣṭhāna-,the umbilical region;3. maṇi-pūra-,the pit of the stomach or epigastrium;4. anāhata-,the root of the nose;5. viśuddha-,the hollow between the frontal sinuses;6. ājñākhya-,the fontanelle or union of the coronal and sagittal sutures;various faculties and divinities are supposed to be present in these hollows) View this entry on the original dictionary page scan.
cakran. Name of a metre (equals -pāta-) View this entry on the original dictionary page scan.
cakran. a circle or a similar instrument (used in astronomy) View this entry on the original dictionary page scan.
cakran. (also m. ) a troop, multitude (krāvalī-, q.v) etc. View this entry on the original dictionary page scan.
cakran. the whole number of (in compound) View this entry on the original dictionary page scan.
cakran. a troop of soldiers, army, host (in fine compositi or 'at the end of a compound' f(ā-)., ) View this entry on the original dictionary page scan.
cakran. a number of villages, province, district View this entry on the original dictionary page scan.
cakran. (figuratively) range, department View this entry on the original dictionary page scan.
cakran. the wheel of a monarch's chariot rolling over his dominions, sovereignty, realm View this entry on the original dictionary page scan.
cakran. (plural) the winding of a river View this entry on the original dictionary page scan.
cakran. a whirlpool View this entry on the original dictionary page scan.
cakran. a crooked or fraudulent device (see cakrikā-) View this entry on the original dictionary page scan.
cakran. the convolutions or spiral marks of the śāla-grāma- or ammonite View this entry on the original dictionary page scan.
cakran. Name of a medicinal plant or drug View this entry on the original dictionary page scan.
cakran. of a tīrtha- View this entry on the original dictionary page scan.
cakram. the ruddy goose or Brahmany duck (Anas Casarca, called after its cries; see -vāk/a-) View this entry on the original dictionary page scan.
cakram. (plural) Name of a people View this entry on the original dictionary page scan.
cakram. (gaRa aśvādi-) Name of a man, , 1 Scholiast or Commentator View this entry on the original dictionary page scan.
cakram. of another man View this entry on the original dictionary page scan.
cakram. of a nāga- View this entry on the original dictionary page scan.
cakram. of one of skanda-'s attendants View this entry on the original dictionary page scan.
cakram. of a mountain View this entry on the original dictionary page scan.
cakf. a kind of Cyperus or another plant View this entry on the original dictionary page scan.
cakram. (dual number kriyau-) View this entry on the original dictionary page scan.
cakram. ([ confer, compare a--, aṣṭ/ā--, uccā--, /eka--, kāla--, --, daṇḍa--, dik--, dharma--, mahā--, mātṛ--, r/odha--, viṣṇu--, sa--, sapt/a--, hiraṇya--; tri--and sucakr/a-; confer, compare also, , Latin circus; Anglo-Saxon hveohl,Engl.wheel.]) View this entry on the original dictionary page scan.
cakrabālāf. Hibiscus cannabinus View this entry on the original dictionary page scan.
cakrabandham. a stanza artificially arranged in a diagram, View this entry on the original dictionary page scan.
cakrabandham. all that holds a wheel, togrther, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
cakrabandhamind. so as to fasten or bind in a particular way View this entry on the original dictionary page scan.
cakrabandhanāf. a kind of jasmine View this entry on the original dictionary page scan.
cakrabāndhavam. "friend of cakra-(-va1ka)birds (supposed to couple only in day-time)", the sun View this entry on the original dictionary page scan.
cakrabhaṅgam. break of a wheel View this entry on the original dictionary page scan.
cakrabhānum. Name of a Brahman View this entry on the original dictionary page scan.
cakrabhedinīf. "dividing the cakra-(-va1ka) couples (see -bāndhava-) ", night View this entry on the original dictionary page scan.
cakrabhramamfn. turning like a wheel View this entry on the original dictionary page scan.
cakrabhramam. equals mi- (varia lectio) View this entry on the original dictionary page scan.
cakrabhramaṇam. Name of a mountain View this entry on the original dictionary page scan.
cakrabhramif. rotation of a wheel View this entry on the original dictionary page scan.
cakrabhrāntif. rotation of the wheels (of a chariot) View this entry on the original dictionary page scan.
cakrabhṛtm. "discus-bearer", viṣṇu- View this entry on the original dictionary page scan.
cakracaram. plural "going in a circle", Name of a class of superhuman beings, View this entry on the original dictionary page scan.
cakracaram. "a juggler" (see cakrāṭa-) or"a potter" (Scholiast or Commentator) View this entry on the original dictionary page scan.
cakracaram. "circle-goer", one who goes by turns (to the houses of Brahmans, kṣatriya-s and vaiśya-s, scilicet for alms), (Scholiast or Commentator) View this entry on the original dictionary page scan.
cakracārinmfn. flying in a circle (a bird)
cakracūḍāmaṇim. "round jewel (in a coronet)", a honorific Name of View this entry on the original dictionary page scan.
cakracūḍāmaṇim. Name of the elder brother of the astronomer bala-bhadra- (17th century) View this entry on the original dictionary page scan.
cakracūḍāmaṇim. Name of a treatise. View this entry on the original dictionary page scan.
cakradaṃṣṭram. "having curved tusks", a hog (varia lectio vakr-). View this entry on the original dictionary page scan.
cakradantīf. Name of a plant View this entry on the original dictionary page scan.
cakradantībījam. "having seeds resembling those of the plant cakra-danti-", Name of a plant View this entry on the original dictionary page scan.
cakradattam. (equals -pāṇi-datta-), Name of an author View this entry on the original dictionary page scan.
cakradattanāmakagrantham. Name of work View this entry on the original dictionary page scan.
cakradevam. "having the wheel (of a war-chariot) for his deity", Name of a warrior View this entry on the original dictionary page scan.
cakradhanusm. Name of a ṛṣi-, View this entry on the original dictionary page scan.
cakradharamfn. or m. bearing a wheel, wheel-bearer (once -dhāra-) View this entry on the original dictionary page scan.
cakradharamfn. equals -bhṛt- View this entry on the original dictionary page scan.
cakradharamfn. driving in a carriage (?,"a snake"or"a governor"Scholiast or Commentator; see ) View this entry on the original dictionary page scan.
cakradharam. a sovereign, emperor, iii, xii View this entry on the original dictionary page scan.
cakradharam. governor of a province View this entry on the original dictionary page scan.
cakradharam. equals caraka- View this entry on the original dictionary page scan.
cakradharam. a snake View this entry on the original dictionary page scan.
cakradharam. a village tumbler (see cakrāṭa-) View this entry on the original dictionary page scan.
cakradharam. Name of a man View this entry on the original dictionary page scan.
cakradharam. of other men etc. View this entry on the original dictionary page scan.
cakradharam. of a locality View this entry on the original dictionary page scan.
cakradhārafor -dhara- q.v View this entry on the original dictionary page scan.
cakradhārāf. the periphery of a wheel View this entry on the original dictionary page scan.
cakradhāraṇan. an axle, View this entry on the original dictionary page scan.
cakradharmanm. Name of a vidyā-dhara- prince View this entry on the original dictionary page scan.
cakrādhivāsinm. "abode for cakra-(-va1ka) birds", the orange-tree View this entry on the original dictionary page scan.
cakradīpikāf. "diagram-illuminator", Name of a work View this entry on the original dictionary page scan.
cakradṛśmfn. "circular-eyed", Name of an asura- View this entry on the original dictionary page scan.
cakradundubhyamfn. relating to a wheel and to a drum View this entry on the original dictionary page scan.
cakradvāram. Name of a mountain View this entry on the original dictionary page scan.
cakragajam. Cassia Tora View this entry on the original dictionary page scan.
cakragaṇḍum. a round pillow View this entry on the original dictionary page scan.
cākragartakamfn. fr. cakra-garta- View this entry on the original dictionary page scan.
cakragatif. rotation, revolution View this entry on the original dictionary page scan.
cakragoptṛm. dual number "wheel-protectors"two men whose business is to preserve the wheels of a carriage from damage (see -rakṣa-.) View this entry on the original dictionary page scan.
cakragrahaṇīf. "army-keeper", a rampart (Scholiast or Commentator) . View this entry on the original dictionary page scan.
cakraguccham. "having circular clusters", Jonesia aśoka- View this entry on the original dictionary page scan.
cakragulmam. "having a circular excretion", a camel View this entry on the original dictionary page scan.
cakrahastam. (equals -pāṇi-) idem or 'm. (see -bhṛt-) viṣṇu-.' View this entry on the original dictionary page scan.
cakrahradam. Name of a lake View this entry on the original dictionary page scan.
cakrāhvam. equals hvaya- () View this entry on the original dictionary page scan.
cakrāhvam. equals kra-gaja- View this entry on the original dictionary page scan.
cakrāhvāf. See krāṅkā-. View this entry on the original dictionary page scan.
cakrāhvayam. equals kra-hvaya- View this entry on the original dictionary page scan.
cakrajātif. equals -bandha-. View this entry on the original dictionary page scan.
cakrajīvakam. "living by his wheel", a potter View this entry on the original dictionary page scan.
cakrajīvinm. idem or 'm. "living by his wheel", a potter ' View this entry on the original dictionary page scan.
cakrakamfn. resembling a wheel or circle, circular View this entry on the original dictionary page scan.
cakrakam. a kind of serpent (see cakra-maṇḍalin-) View this entry on the original dictionary page scan.
cakrakam. Dolichos biflorus View this entry on the original dictionary page scan.
cakrakam. Name of a ṛṣi- View this entry on the original dictionary page scan.
cakrakan. a particular way of fighting (varia lectio citraka-) View this entry on the original dictionary page scan.
cakrakan. arguing in a circle View this entry on the original dictionary page scan.
cakrakāf. a kind of plant having great curative properties (white Abrus ) View this entry on the original dictionary page scan.
cakrakan. a crooked or fraudulent device, . View this entry on the original dictionary page scan.
cakrakam. (also) the ring on an umbrella, View this entry on the original dictionary page scan.
cakrākāramf(ā-)n. disc-shaped (the earth) View this entry on the original dictionary page scan.
cakrakārakan. the perfume unguis odoratus View this entry on the original dictionary page scan.
cakrakāśrayam. arguing in a circle View this entry on the original dictionary page scan.
cakrākī varia lectio for krāṅkī-. View this entry on the original dictionary page scan.
cakrākṛtimfn. equals kāra- View this entry on the original dictionary page scan.
cakrakulyāf. a kind of fern (citra-parṇī-) View this entry on the original dictionary page scan.
cakralamfn. (see cakkala-) crisp, curled (barbara-) View this entry on the original dictionary page scan.
cakralāf. a kind of Cyperus View this entry on the original dictionary page scan.
cakralakṣaṇāf. Cocculus cordifolius View this entry on the original dictionary page scan.
cakralakṣaṇikāf. idem or 'f. Cocculus cordifolius ' View this entry on the original dictionary page scan.
cakralatāmrafor -talāmra- View this entry on the original dictionary page scan.
cakrālum. equals kratalāmra- View this entry on the original dictionary page scan.
cakramandam. Name of a nāga- View this entry on the original dictionary page scan.
cakramaṇḍalinm. the Boa constrictor View this entry on the original dictionary page scan.
cakramardam. equals -gaja- View this entry on the original dictionary page scan.
cakramardakam. idem or 'm. equals -gaja- ' View this entry on the original dictionary page scan.
cakramardikāf. Name of a wife of līlāditya- View this entry on the original dictionary page scan.
cakramāsajamfn. stopping the wheels (of a chariot) View this entry on the original dictionary page scan.
cakramaṭham. Name of a college (built in a circular form by cakra-varman-) View this entry on the original dictionary page scan.
cakramauli"having a circular diadem", Name of a rākṣasa-
cakramaulinmfn. having the wheels turned upwards View this entry on the original dictionary page scan.
cakramedinīfor -bhedinī- View this entry on the original dictionary page scan.
cakramelakaName of a locality in Kashmir View this entry on the original dictionary page scan.
cakramīmāṃsāf. Name of work View this entry on the original dictionary page scan.
cakramukham. equals -daṃṣṭra- View this entry on the original dictionary page scan.
cakramusalamfn. (a battle) carried on with the discus and club (see 5648) . View this entry on the original dictionary page scan.
cakrāṇa perfect tense A1. parasmE-pada 1. kṛ- q.v View this entry on the original dictionary page scan.
cakranābhif. the nave of a wheel View this entry on the original dictionary page scan.
cakraṇadīf. equals -nadī- gaRa girinady-ādi-. View this entry on the original dictionary page scan.
cakranadīf. (gaRa girinady-ādi-) Name of a river View this entry on the original dictionary page scan.
cakranakham. equals -kāraka- View this entry on the original dictionary page scan.
cakranāmanm. equals -hvaya- View this entry on the original dictionary page scan.
cakranāmanm. a pyritic ore of iron (mākṣika-) View this entry on the original dictionary page scan.
cakranārāyaṇīsaṃhitāf. Name of work View this entry on the original dictionary page scan.
cakranāyakam. the leader of a troop View this entry on the original dictionary page scan.
cakranāyakam. equals -kāraka- View this entry on the original dictionary page scan.
cakranemif. "wheel-felly", Name of one of the mothers attending on skanda- View this entry on the original dictionary page scan.
cakrāṅgam. "curved-neck", a gander View this entry on the original dictionary page scan.
cakrāṅgam. the cakra-(-va1ka) bird View this entry on the original dictionary page scan.
cakrāṅgam. "wheel-limbed (see kra-pāda-) ", a carriage View this entry on the original dictionary page scan.
cakrāṅgan. "disc-shaped", a parasol
cakrāṅgāf. equals ṅkā-, Cocculus tomentosus View this entry on the original dictionary page scan.
cakrāṅgan. Helleborus niger View this entry on the original dictionary page scan.
cakrāṅgan. Cocculus tomentosus View this entry on the original dictionary page scan.
cakrāṅgan. Rubia munjista View this entry on the original dictionary page scan.
cakrāṅgan. Enhydra Heloncha View this entry on the original dictionary page scan.
cakrāṅgan. the plant karkaṭa-śṛṅgī- View this entry on the original dictionary page scan.
cakrāṅganāf. the female of the cakra-(-va1ka) bird View this entry on the original dictionary page scan.
cakrāṅgīf. equals ṅkī-, a goose View this entry on the original dictionary page scan.
cakraṇitambam. equals cakr/a-nitamba- View this entry on the original dictionary page scan.
cakranitambam. equals cakr/a-ṇitamba- gaRa girinady-ādi-. View this entry on the original dictionary page scan.
cakrāṅkāf. Cocculus tomentosus (varia lectio krāhvā-) View this entry on the original dictionary page scan.
cakrāṅkāf. Cyperus pertenuis View this entry on the original dictionary page scan.
cakrāṅkīf. equals ṅgī-, a goose View this entry on the original dictionary page scan.
cakrāṅkitāf. a kind of plant View this entry on the original dictionary page scan.
cakrāṅkitapādamfn. having the feet marked with a wheel, . View this entry on the original dictionary page scan.
cakrāṅkitapāṇipādatalatāf. having the palms of hands and feet marked with a wheel (one of the 32 signs of perfection), View this entry on the original dictionary page scan.
cakrapādam. "wheel-footed", a carriage View this entry on the original dictionary page scan.
cakrapādam. "circular-footed", an elephant View this entry on the original dictionary page scan.
cakrapadmāṭam. equals -gaja- View this entry on the original dictionary page scan.
cakrapakṣam. a goose, View this entry on the original dictionary page scan.
cakrapālam. the superintendent of a province View this entry on the original dictionary page scan.
cakrapālam. one who carries a discus View this entry on the original dictionary page scan.
cakrapālam. a circle View this entry on the original dictionary page scan.
cakrapālam. the horizon View this entry on the original dictionary page scan.
cakrapālam. Name of a poet View this entry on the original dictionary page scan.
cakrapālitam. Name of a man. View this entry on the original dictionary page scan.
cakrapāṇim. "discus-handed", viṣṇu- View this entry on the original dictionary page scan.
cakrapāṇim. (ṇin-) View this entry on the original dictionary page scan.
cakrapāṇim. Name of a medical author View this entry on the original dictionary page scan.
cakrapāṇidattam. idem or 'm. Name of a medical author' View this entry on the original dictionary page scan.
cakrapāṇinfor ṇi- q.v View this entry on the original dictionary page scan.
cakraparivyādham. Cathartocarpus fistula View this entry on the original dictionary page scan.
cakraparṇīf. equals -kulyā- View this entry on the original dictionary page scan.
cakrapātam. a metre of 4 x 14 syllables. View this entry on the original dictionary page scan.
cakrapatham. a road for wheels, carriage-road, View this entry on the original dictionary page scan.
cakraphalan. a missile weapon (kind of discus) View this entry on the original dictionary page scan.
cakrapuran. Name of a town (built by cakra-mardikā- ) View this entry on the original dictionary page scan.
cakrapuṣkariṇīf. Name of a sacred tank at Benares View this entry on the original dictionary page scan.
cakraradam. equals -daṃṣṭra- View this entry on the original dictionary page scan.
cakrarājam. Name of a mystical diagram View this entry on the original dictionary page scan.
cakrarakṣam. dual number equals -goptṛ- View this entry on the original dictionary page scan.
cakraratnan. an excellent wheel or disk (one of the 7 treasures of a king), View this entry on the original dictionary page scan.
cakrārdhacakravālaa semicircle View this entry on the original dictionary page scan.
cakrasāhvayam. the cakra-(-va1ka) bird View this entry on the original dictionary page scan.
cakrasakthamfn. bow-legged View this entry on the original dictionary page scan.
cakrasaṃjñan. tin View this entry on the original dictionary page scan.
cakrasaṃvaram. Name of a buddha- (vajra-ṭīka-) View this entry on the original dictionary page scan.
cakraśatapattraName of a plant View this entry on the original dictionary page scan.
cakrasenam. Name of a son of tārā-candra- and father of siṃha- View this entry on the original dictionary page scan.
cakrasenāf. Name of a princess View this entry on the original dictionary page scan.
cakrāśmanm. a sling for throwing stones, . View this entry on the original dictionary page scan.
cakraśreṇīf. Odina pinnata (bearing a curved fruit) View this entry on the original dictionary page scan.
cakrasvāminm. (see -bhṛt-) viṣṇu-. View this entry on the original dictionary page scan.
cakrasvastikanandyāvartam. "having the wheel the svastika- and the nandy-āvarta- emblems", Name of buddha- View this entry on the original dictionary page scan.
cakrāṭam. (equals kra-cara-) a juggler, snake-catcher, snake-charmer View this entry on the original dictionary page scan.
cakrāṭam. a knave, cheat View this entry on the original dictionary page scan.
cakrāṭam. a gold coin, Dinar View this entry on the original dictionary page scan.
cakratailan. oil prepared from the cakra-(- gaja- ?) plant View this entry on the original dictionary page scan.
cakratalāmram. a kind of mango tree View this entry on the original dictionary page scan.
cakrātim. plural Name of a people (vakrātapa- edition Calc.) View this entry on the original dictionary page scan.
cakratīrthan. Name of a tīrtha- (see cakra-) etc. View this entry on the original dictionary page scan.
cakratuṇḍam. (kr/a--) "circular-beaked", a kind of mythical being View this entry on the original dictionary page scan.
cakratuṇḍam. a kind of fish View this entry on the original dictionary page scan.
cakravāḍam. fire View this entry on the original dictionary page scan.
cakravāḍam. the mountain-range cakra-vāla- View this entry on the original dictionary page scan.
cakravāḍan. "a circle", or"a troop, multitude" View this entry on the original dictionary page scan.
cakravadgatimfn. turning like a wheel View this entry on the original dictionary page scan.
cakravākam. the cakra- bird (Anas Casarca;the couples are supposed to be separated and to mourn during night) etc. View this entry on the original dictionary page scan.
cakravākaf(ī-). the female of the cakra-(vāka-) bird View this entry on the original dictionary page scan.
cakravākabandhum. equals kra-bāndhava- View this entry on the original dictionary page scan.
cakravākamayamfn. consisting of cakra- birds View this entry on the original dictionary page scan.
cakravākavatīf. "abounding in cakra-vāka-s", (probably) Name of a river gaRa ajirādi- View this entry on the original dictionary page scan.
cakravākinmfn. filled with cakra-vāka-s View this entry on the original dictionary page scan.
cakravākopakūjitamfn. made resonant with the cooing or cry of the cakra-vāka- View this entry on the original dictionary page scan.
cakravālan. (fr. -vāḍa-) a circle View this entry on the original dictionary page scan.
cakravālan. equals la-yamaka- View this entry on the original dictionary page scan.
cakravālam. n. a mass, multitude, number, assemblage etc. View this entry on the original dictionary page scan.
cakravālam. Name of a mythical range of mountains (encircling the orb of the earth and being the limit of light and darkness) : (dri-) View this entry on the original dictionary page scan.
cakravāladhim. "curved-tail", a dog (see vakr-.) View this entry on the original dictionary page scan.
cakravālakan. a kind of rhetorical figure, View this entry on the original dictionary page scan.
cakravālātmanf. Name of a goddess View this entry on the original dictionary page scan.
cakravālayamakan. a kind of artificial stanza (as ) View this entry on the original dictionary page scan.
cakrāvalīf. a number, multitude View this entry on the original dictionary page scan.
cakravarmanm. Name of a king of Kashmir View this entry on the original dictionary page scan.
cakravartaSee -vṛtta-. View this entry on the original dictionary page scan.
cakrāvartam. whirling or rotatory motion View this entry on the original dictionary page scan.
cakravartinmfn. rolling everywhere without obstruction View this entry on the original dictionary page scan.
cakravartinm. a ruler the wheels of whose chariot roll everywhere without obstruction, emperor, sovereign of the world, ruler of a cakra- (or country described as extending from sea to sea; 12 princes beginning with bharata- are especially considered as cakravartin-s) etc. View this entry on the original dictionary page scan.
cakravartinmfn. supreme, holding the highest rank among (genitive case or in compound) View this entry on the original dictionary page scan.
cakravartinm. Chenopodium album View this entry on the original dictionary page scan.
cakravartinm. Name of the author of a commentator or commentary on , View this entry on the original dictionary page scan.
cakravartinm. Nardostachys jaṭāmāṃsi- View this entry on the original dictionary page scan.
cakravartinm. equals alaktaka- View this entry on the original dictionary page scan.
cakravartinīf. the fragrant plant jantukā- View this entry on the original dictionary page scan.
cakravartitāf. the state of a universal emperor View this entry on the original dictionary page scan.
cakravartitvan. idem or 'f. the state of a universal emperor ' View this entry on the original dictionary page scan.
cakravatmfn. furnished with wheels, wheeled View this entry on the original dictionary page scan.
cakravatmfn. armed with a discus View this entry on the original dictionary page scan.
cakravatmfn. circular View this entry on the original dictionary page scan.
cakravatm. an oil-grinder View this entry on the original dictionary page scan.
cakravatm. Name of viṣṇu- View this entry on the original dictionary page scan.
cakravatm. a sovereign, emperor View this entry on the original dictionary page scan.
cakravatm. Name of a mountain View this entry on the original dictionary page scan.
cakravatn. a chariot View this entry on the original dictionary page scan.
cakravatind. like a wheel, in rotation View this entry on the original dictionary page scan.
cakravāṭam. a limit, boundary View this entry on the original dictionary page scan.
cakravāṭam. a lamp-stand View this entry on the original dictionary page scan.
cakravāṭam. engaging in an action (?, kriyāroha-) View this entry on the original dictionary page scan.
cakravātam. a whirlwind View this entry on the original dictionary page scan.
cakravimalaName of a plant View this entry on the original dictionary page scan.
cakravṛddhif. interest upon interest View this entry on the original dictionary page scan.
cakravṛddhif. View this entry on the original dictionary page scan.
cakravṛddhif. wages for transporting goods in a carriage, 156. View this entry on the original dictionary page scan.
cakravṛttamfn. (kr/a--) turned on a potter's wheel View this entry on the original dictionary page scan.
cakravṛttamfn. (a-cakravarta-,for vṛtta- negative) (see kru-v-.) View this entry on the original dictionary page scan.
cakravyūham. any circular array of troops (see also 3108) View this entry on the original dictionary page scan.
cakravyūham. Name of a kiṃnara- prince View this entry on the original dictionary page scan.
cakrayānan. any wheel-carriage View this entry on the original dictionary page scan.
cakrayodhinm. "discus-fighter", Name of a dānava- View this entry on the original dictionary page scan.
cakrāyodhyam. "not to be conquered by a discus"Name of a prince View this entry on the original dictionary page scan.
cakrayogam. applying a splint or similar instrument by means of pulleys (in case of dislocation of the thigh) View this entry on the original dictionary page scan.
cakrāyudham. "whose weapon is the discus", viṣṇu- or kṛṣṇa- View this entry on the original dictionary page scan.
cakrendrakam. a kind of mustard View this entry on the original dictionary page scan.
cakreśam. (equals kra-vartin-) sovereign of the world View this entry on the original dictionary page scan.
cakreśvaram. "lord of the discus", viṣṇu- View this entry on the original dictionary page scan.
cakreśvaram. "lord of the troops", bhairava- View this entry on the original dictionary page scan.
cakreśvaram. equals śa- View this entry on the original dictionary page scan.
cakreśvarīf. one of the vidyā-devī-s (executing the orders of the 1st arhat-) View this entry on the original dictionary page scan.
cakf. a wheel (instrumental case sg. kr/iyā-; genitive case dual number kry/os-) View this entry on the original dictionary page scan.
cakind. in compound View this entry on the original dictionary page scan.
cakf. of kr/a- q.v View this entry on the original dictionary page scan.
cakrimfn. ( Va1rtt. 3) doing, effecting (with accusative), active View this entry on the original dictionary page scan.
cakrimfn. (or cakrin-?) Name of a man (see uru-c/akri-.) View this entry on the original dictionary page scan.
cakrībhūto be made circular or bent (a bow) View this entry on the original dictionary page scan.
cakrikāf. a troop, multitude View this entry on the original dictionary page scan.
cakrikam. a discus-bearer View this entry on the original dictionary page scan.
cakrikam. (equals kraka-) Dolichos biflorus View this entry on the original dictionary page scan.
cakrikāf. See kraka-. View this entry on the original dictionary page scan.
cakrīkṛto make round or circular, curve or bend (a bow) View this entry on the original dictionary page scan.
cakrinmfn. having wheels View this entry on the original dictionary page scan.
cakrinmfn. driving in a carriage View this entry on the original dictionary page scan.
cakrinmfn. bearing a discus, or (m.)"discus-bearer", kṛṣṇa- View this entry on the original dictionary page scan.
cakrinm. a potter View this entry on the original dictionary page scan.
cakrinm. an oil-grinder View this entry on the original dictionary page scan.
cakrinm. Name of śiva- View this entry on the original dictionary page scan.
cakrinm. a sovereign of the world, king View this entry on the original dictionary page scan.
cakrinm. the governor of a province (grāma-jālika-; grāmayājin-,"one who offers sacrifices for a whole village") View this entry on the original dictionary page scan.
cakrinm. a kind of juggler or tumbler who exhibits tricks with a discus or a wheel (jālika-bhid-) View this entry on the original dictionary page scan.
cakrinm. an informer (sūcaka-) View this entry on the original dictionary page scan.
cakrinm. a cheat, rogue View this entry on the original dictionary page scan.
cakrinm. a snake View this entry on the original dictionary page scan.
cakrinm. the cakra-(-va1ka) bird View this entry on the original dictionary page scan.
cakrinm. an ass View this entry on the original dictionary page scan.
cakrinm. a crow. View this entry on the original dictionary page scan.
cakrinm. equals kra-gaja- View this entry on the original dictionary page scan.
cakrinm. "Name of a man"(?) See c/akri- View this entry on the original dictionary page scan.
cakrinm. Dalbergia ujjeinensis View this entry on the original dictionary page scan.
cakrinm. equals kra-kāraka- View this entry on the original dictionary page scan.
cakrinm. plural Name of a vaiṣṇava- sect (see sa--.) View this entry on the original dictionary page scan.
cakrīvatmfn. () furnished with wheels, wheeled View this entry on the original dictionary page scan.
cakrīvatmfn. driving in a carriage View this entry on the original dictionary page scan.
cakrīvatm. an ass View this entry on the original dictionary page scan.
cakrīvatm. Name of a prince View this entry on the original dictionary page scan.
cakrīvatn. a carriage View this entry on the original dictionary page scan.
cakriyamfn. belonging to a wheel or carriage View this entry on the original dictionary page scan.
cakriyamfn. going on a carriage, being on a journey (genitive case plural yāṇām-;fr. cakrin-and - ) View this entry on the original dictionary page scan.
cakrollāsam. Name of work View this entry on the original dictionary page scan.
cakrottham. a kind of mustard View this entry on the original dictionary page scan.
cakru equals kr/a- "a wheel", only in compound View this entry on the original dictionary page scan.
cakrumfn. doing effecting View this entry on the original dictionary page scan.
cakruvṛttamfn. circular, (a-- negative) View this entry on the original dictionary page scan.
cakṛvatn. (for vas- perfect tense P. parasmE-pada) a perfect form (of any verb) View this entry on the original dictionary page scan.
cak (a reduplicated form of kāś- equals kśā-;in the non-conjugational tenses khyā-is substituted ;some perfect tense forms, however, are found) cl.2 A1. c/aṣṭe- (2. dual number cakṣathe- ; perfect tense parasmE-pada c/akṣāṇa- [ a-- negative ];rarely P. imperfect tense 2. sg. acakṣas- plural acakṣma- ;Ved. infinitive mood c/akṣase- ), to appear, become visible ; to see, look at, observe, notice ; to tell, inform ; to take any one (accusative) for (accusative)
cakṣam. a false friend View this entry on the original dictionary page scan.
cakṣann. dual number the eyes View this entry on the original dictionary page scan.
cakṣaṇan. appearing, appearance, aspect View this entry on the original dictionary page scan.
cakṣaṇan. speaking, saying View this entry on the original dictionary page scan.
cakṣaṇan. (for jakṣ-?) eating a relish to promote drinking (see viśv/a--; abhi--and prati-c/akṣ-; vi-cakṣaṇ/a-.) View this entry on the original dictionary page scan.
cakṣaṇim. an illuminator View this entry on the original dictionary page scan.
cakṣasn. radiance, clearness View this entry on the original dictionary page scan.
cakṣasn. (of the sea) View this entry on the original dictionary page scan.
cakṣasn. look, sight, eye View this entry on the original dictionary page scan.
cakṣasn. (ase-) dative case infinitive mood cakṣ- q.v View this entry on the original dictionary page scan.
cakṣasm. a teacher, spiritual instructor View this entry on the original dictionary page scan.
cakṣasm. "teacher of the gods", bṛhaspati- (see /apāka--, īya--, upāk/a--, ghor/a--, viśv/a--, s/ūra--, sv/ar--; uru--, duś--, nṛ--and su-c/akṣ-.) View this entry on the original dictionary page scan.
cakṣorākṣamf(ī-)n. equals ra-dṛś- View this entry on the original dictionary page scan.
cakṣum. the eye View this entry on the original dictionary page scan.
cakṣum. (in fine compositi or 'at the end of a compound' ) View this entry on the original dictionary page scan.
cakṣum. Name of a prince View this entry on the original dictionary page scan.
cakṣum. (for vakṣu-?) the Oxus river View this entry on the original dictionary page scan.
cakṣūin compound for kṣus-. View this entry on the original dictionary page scan.
cakṣuḥin compound for kṣus-. View this entry on the original dictionary page scan.
cakṣuḥpathaSee kṣuṣ-p-. View this entry on the original dictionary page scan.
cakṣuḥpīḍāf. pain of the eyes View this entry on the original dictionary page scan.
cakṣuḥśravasm. "using the eyes for ears", a snake View this entry on the original dictionary page scan.
cakṣuḥśrotramfn. possessing sight and hearing, View this entry on the original dictionary page scan.
cakṣuḥśrutim. idem or 'm. "using the eyes for ears", a snake ' (see dṛk-ś-.) View this entry on the original dictionary page scan.
cakṣūkṛ View this entry on the original dictionary page scan.
cakṣunirodham. equals kṣur-n- View this entry on the original dictionary page scan.
cakṣupīḍanamfn. causing pain to the eye View this entry on the original dictionary page scan.
cakṣurin compound for kṣus-. View this entry on the original dictionary page scan.
cakṣūrāgam. equals kṣūṣ-prīti- View this entry on the original dictionary page scan.
cakṣurapetamfn. one who has lost his eyes, blind View this entry on the original dictionary page scan.
cakṣurbahalam. Odina pinnata View this entry on the original dictionary page scan.
cakṣurbhṛtmfn. promoting sight View this entry on the original dictionary page scan.
cakṣurdāmfn. giving sight View this entry on the original dictionary page scan.
cakṣurdānan. "gift of sight", the ceremony of anointing the eyes of an image at the time of consecration View this entry on the original dictionary page scan.
cakṣurgocaramfn. coming within the range of the eye View this entry on the original dictionary page scan.
cakṣurgrahaṇan. morbid affection of the eyes, . View this entry on the original dictionary page scan.
cakṣurhanmfn. (m. accusative -haṇam-; Nominal verb plural -hanas-) killing with a look View this entry on the original dictionary page scan.
cakṣurindriyan. the organ of sight View this entry on the original dictionary page scan.
cakṣurloka(c/akṣ-) mfn. seeing with the eyes View this entry on the original dictionary page scan.
cakṣurmalan. the excretion of the eyes View this entry on the original dictionary page scan.
cakṣurmantra(c/akṣ-) mfn. bewitching with the eye View this entry on the original dictionary page scan.
cakṣurmayamfn. resembling the eye View this entry on the original dictionary page scan.
cakṣurmukha(c/akṣ-) mfn. having eyes in the mouth (?) View this entry on the original dictionary page scan.
cakṣurmuṣmfn. "robbing the sight", blinding the eyes View this entry on the original dictionary page scan.
cakṣurnimita(c/akṣ-) mfn. fixed by (a measure taken by) the eye View this entry on the original dictionary page scan.
cakṣurnirodham. (equals kṣu-n-) a cover or a hindrance for the eyesight (varia lectio) View this entry on the original dictionary page scan.
cakṣūrogam. disease of the eye (varia lectio kṣu-r-). View this entry on the original dictionary page scan.
cakṣurvahanam. equals -bahala- View this entry on the original dictionary page scan.
cakṣurvanyamfn. suffering from disease of the eyes View this entry on the original dictionary page scan.
cakṣurvardhanikāf. "refreshing the eyes", Name of a river View this entry on the original dictionary page scan.
cakṣurviṣayam. the range of sight (locative case e-,"in the presence of") View this entry on the original dictionary page scan.
cakṣurviṣayam. a visible object View this entry on the original dictionary page scan.
cakṣuśin comp, for kṣus-. View this entry on the original dictionary page scan.
cakṣuṣin compound for kṣus-. View this entry on the original dictionary page scan.
cakṣusmfn. seeing View this entry on the original dictionary page scan.
cakṣusmfn.
cakṣusm. Name of a marut- View this entry on the original dictionary page scan.
cakṣusm. of a ṛṣi- (with the patronymic mānava-, author of ) View this entry on the original dictionary page scan.
cakṣusm. of another ṛṣi- (with the patronymic saurya-, author of ) View this entry on the original dictionary page scan.
cakṣusm. of a son of anu- View this entry on the original dictionary page scan.
cakṣusf. Name of a river View this entry on the original dictionary page scan.
cakṣusn. light, clearness View this entry on the original dictionary page scan.
cakṣusn. the act of seeing (dative case infinitive mood equals kṣase-) View this entry on the original dictionary page scan.
cakṣusn. aspect View this entry on the original dictionary page scan.
cakṣusn. faculty of seeing, sight etc. View this entry on the original dictionary page scan.
cakṣusn. a look View this entry on the original dictionary page scan.
cakṣusn. the eye etc. (often in fine compositi or 'at the end of a compound' see a--, /a-ghora--, /a-dabdha--,etc.) View this entry on the original dictionary page scan.
cakṣusn. prajāpates trīṇi cakṣūṃṣi-,"the 3 eyes of prajā-pati-", Name of a sāman- View this entry on the original dictionary page scan.
cakṣusn. mitrā-varuṇayoś cakṣuḥ-,"the eye of mitra- and varuṇa-" (see ), another sāman- View this entry on the original dictionary page scan.
cakṣusn. equals kṣur-bahala- View this entry on the original dictionary page scan.
cakṣuṣamfn. in fine compositi or 'at the end of a compound' "the eye" See sa-- View this entry on the original dictionary page scan.
cakṣuṣam. Name of a son of ripu- (varia lectio cākṣ-) View this entry on the original dictionary page scan.
cakṣuścitmfn. collecting the faculty of sight View this entry on the original dictionary page scan.
cakṣuṣkāma(c/akṣ-) mfn. wishing for the faculty of seeing View this entry on the original dictionary page scan.
cakṣuṣkarṇam. equals kṣuḥ-śravas- View this entry on the original dictionary page scan.
cakṣuṣmatmfn. (c/akṣ-) endowed with the faculty of sight, furnished with eyes, seeing etc. View this entry on the original dictionary page scan.
cakṣuṣmatmfn. representing the eye View this entry on the original dictionary page scan.
cakṣuṣmattāf. the faculty of sight View this entry on the original dictionary page scan.
cakṣuṣmattvan. idem or 'f. the faculty of sight ' View this entry on the original dictionary page scan.
cakṣuṣpāmfn. protecting the eyesight View this entry on the original dictionary page scan.
cakṣuṣpatham. the range of sight View this entry on the original dictionary page scan.
cakṣuṣpatim. the lord of the eyes View this entry on the original dictionary page scan.
cakṣuṣprītif. delight of the eyes. View this entry on the original dictionary page scan.
cakṣuṣṭasind. away from the eye View this entry on the original dictionary page scan.
cakṣuṣṭvan. the state or condition of the eye View this entry on the original dictionary page scan.
cakṣuṣyamfn. pleasing to the eyes, wholesome for the eyes or the eyesight View this entry on the original dictionary page scan.
cakṣuṣyamfn. agreeable to the eyes, pleasing, good-looking, beautiful View this entry on the original dictionary page scan.
cakṣuṣyamfn. "being in any one's (instrumental case) range of sight "and"dear to any one (instrumental case) " View this entry on the original dictionary page scan.
cakṣuṣyam. a kind of collyrium (extracted from Amomum antorhiza) View this entry on the original dictionary page scan.
cakṣuṣyam. Pandanus odoratissimus View this entry on the original dictionary page scan.
cakṣuṣyam. Hyperanthera Moringa View this entry on the original dictionary page scan.
cakṣuṣyam. also Name of other plants (puṇḍarīka-, kanaka-) View this entry on the original dictionary page scan.
cakṣuṣyan. two kinds of collyrium (kharparī-tuttha-and sauvīrāñjana-) View this entry on the original dictionary page scan.
cakṣuṣyan. the small shrub prapauṇḍarīka- View this entry on the original dictionary page scan.
cakṣuṣyāf. a kind of collyrium (calx of brass or a blue stone) View this entry on the original dictionary page scan.
cakṣuṣyan. Pandanus odoratissimus View this entry on the original dictionary page scan.
cakṣuṣyan. Glycine labialis View this entry on the original dictionary page scan.
cakṣuṣyan. equals kṣurbahala- View this entry on the original dictionary page scan.
cakvana varia lectio for cakana-. View this entry on the original dictionary page scan.
caladaṅgakam. "of a palpitating body", the fish Ophiocephalus aurantiacus View this entry on the original dictionary page scan.
cālakam. a restive elephant (said of a person ) View this entry on the original dictionary page scan.
cālakam. "id."and" equals cākrika- " View this entry on the original dictionary page scan.
calakarṇam. (in astronomy) the changeable hypothenuse ("the true distance of a planet from the earth") View this entry on the original dictionary page scan.
calaketum. (in astronomy) Name of a moving ketu- View this entry on the original dictionary page scan.
calakuṇḍalam. Name of a man () View this entry on the original dictionary page scan.
calanakam. n. a short petticoat (worn by dancing girls, etc.) View this entry on the original dictionary page scan.
calaprakṛtimfn. of unsteady or wanton nature View this entry on the original dictionary page scan.
cālukyavikramakālam. Name (also title or epithet) of an era established by the Western cālukya- king vikramāditya- VI; (its first year corresponds to the expired śaka- year 998 = D. 1076-77). View this entry on the original dictionary page scan.
camakam. Name of a man View this entry on the original dictionary page scan.
camakasūktan. "the hymn containing came- ", Name of on View this entry on the original dictionary page scan.
camakasūktan. see nam-. View this entry on the original dictionary page scan.
camakasūktaSee cama-. View this entry on the original dictionary page scan.
camarakam. a bee View this entry on the original dictionary page scan.
cāmarapuṣpakam. Saccharum spontaneum View this entry on the original dictionary page scan.
cāmīkaraprakhyamfn. gold-like View this entry on the original dictionary page scan.
campakam. Michelia Campaka (bearing a yellow fragrant flower) etc. View this entry on the original dictionary page scan.
campakam. a kind of perfume View this entry on the original dictionary page scan.
campakam. a particular part of the bread-fruit View this entry on the original dictionary page scan.
campakam. Name of a man View this entry on the original dictionary page scan.
campakam. of a relation of the jaina- meru-tuṅga- View this entry on the original dictionary page scan.
campakam. of a country View this entry on the original dictionary page scan.
campakan. the flower of the Campaka tree etc. View this entry on the original dictionary page scan.
campakan. the fruit of a variety of the plantain View this entry on the original dictionary page scan.
campakāf. Name of a town, View this entry on the original dictionary page scan.
campakacaturdaśīf. "the 14th day in the light half of jyaiṣṭha-", Name of a festival. View this entry on the original dictionary page scan.
campakadeśam. the Campaka country. View this entry on the original dictionary page scan.
campakagandham. "Campaka-fragrance", a kind of incense (varia lectio dhi-or dhin-) View this entry on the original dictionary page scan.
campakalatāf. Name of a woman, View this entry on the original dictionary page scan.
campakālum. the bread-fruit tree View this entry on the original dictionary page scan.
campakamālāf. a metre of 4 x 10 syllables View this entry on the original dictionary page scan.
campakamālāf. Name of a woman View this entry on the original dictionary page scan.
campakanātham. Name of an author. View this entry on the original dictionary page scan.
campakaprabhum. Name of kalhaṇa-'s father. View this entry on the original dictionary page scan.
campakapuran. Name of a town, View this entry on the original dictionary page scan.
campakarambhāf. a kind of plantain View this entry on the original dictionary page scan.
campakāraṇyan. "Campaka forest", Name of a place of pilgrimage View this entry on the original dictionary page scan.
campakaśreṣṭhikathānakan. Name (also title or epithet) of a tale. View this entry on the original dictionary page scan.
campakavatīf. Name of a wood in magadha- (vv.ll. -v-and valī-) View this entry on the original dictionary page scan.
campakavatīf. of a town, 5, 0/1 (varia lectio)
campakāvatī varia lectio for ka-v- (see ) View this entry on the original dictionary page scan.
campakavyavahārikathāf. Name of a tale (about the merchant Campaka). View this entry on the original dictionary page scan.
campakolbam. equals lu- View this entry on the original dictionary page scan.
campakośafor kolba- View this entry on the original dictionary page scan.
campakundam. a kind of fish View this entry on the original dictionary page scan.
cāmpeyakan. a filament (especially of a lotus) View this entry on the original dictionary page scan.
campopalakṣitamfn. "marked by campā-", dwelling in campā- and its vicinity View this entry on the original dictionary page scan.
camūnāyakam. idem or 'm. (in fine compositi or 'at the end of a compound') ' View this entry on the original dictionary page scan.
caṇakam. the chick-pea View this entry on the original dictionary page scan.
caṇakam. Name of cāṇakya-'s father View this entry on the original dictionary page scan.
caṇakam. of a village View this entry on the original dictionary page scan.
caṇakāf. linseed View this entry on the original dictionary page scan.
cāṇakam. plural of kya- gaRa kaṇvādi-. View this entry on the original dictionary page scan.
caṇakalavaṇan. pease with salt, sour pease View this entry on the original dictionary page scan.
caṇakaloṇīf. (for -lavaṇī-) idem or 'n. pease with salt, sour pease ' View this entry on the original dictionary page scan.
caṇakāmlakan. equals ka-lavaṇa- View this entry on the original dictionary page scan.
caṇakāmlavārn. acid water drops on cicer leaves View this entry on the original dictionary page scan.
caṇakātmajam. " caṇaka-'s son", cāṇakya- View this entry on the original dictionary page scan.
cāṇakīnamfn. fit for (being sown) with the chick-pea (caṇaka-) View this entry on the original dictionary page scan.
cāṇakyamfn. made of chick-peas View this entry on the original dictionary page scan.
cāṇakyamfn. composed by cāṇakya- View this entry on the original dictionary page scan.
cāṇakyam. (gaRa gargādi-) patronymic fr. caṇaka- (son of caṇin- ), Name of a minister of candra-gupta- (said to have destroyed the nanda- dynasty;reputed author of -śloka-[q.v.],"the Machiavelli of India") View this entry on the original dictionary page scan.
cāṇakyamūlakan. a kind of radish (kauṭilya-) View this entry on the original dictionary page scan.
cāṇakyaślokam. plural cāṇakya-'s śloka-s on morals and principles of government View this entry on the original dictionary page scan.
cañcupuṭaka equals ṭa- View this entry on the original dictionary page scan.
candakamfn. pleasing View this entry on the original dictionary page scan.
candakam. the moon View this entry on the original dictionary page scan.
candakam. moonlight View this entry on the original dictionary page scan.
candakam. varia lectio for draka- q.v View this entry on the original dictionary page scan.
caṇḍakāpālikam. Name of a teacher, (see ṣaṇḍ-.) View this entry on the original dictionary page scan.
candakapuṣpafor candana-p- View this entry on the original dictionary page scan.
caṇḍakaram. "hot-rayed", the sun View this entry on the original dictionary page scan.
caṇḍakarāyaNom. rāyate-, to resemble the sun View this entry on the original dictionary page scan.
caṇḍakarmanm. Name of a rākṣasa- View this entry on the original dictionary page scan.
caṇḍakauśikam. Name of a son of kakṣīvat- View this entry on the original dictionary page scan.
caṇḍakauśikan. Name of a drama View this entry on the original dictionary page scan.
caṇḍaketum. Name of a man View this entry on the original dictionary page scan.
caṇḍakiraṇam. equals -kara- View this entry on the original dictionary page scan.
caṇḍakolāhalāf. a kind of musical instrument View this entry on the original dictionary page scan.
cāṇḍālakan. anything made by a caṇḍāla- gaRa kulālādi- View this entry on the original dictionary page scan.
cāṇḍālakam. Name of a man View this entry on the original dictionary page scan.
caṇḍālakandam. Name of a bulbous plant View this entry on the original dictionary page scan.
cāṇḍālaki patronymic fr. caṇḍāla- View this entry on the original dictionary page scan.
caṇḍālavallakīf. the caṇḍāla- or common lute View this entry on the original dictionary page scan.
candanakam. Name of a man View this entry on the original dictionary page scan.
candanapuṣpakan. cloves View this entry on the original dictionary page scan.
candanodakan. equals na-rasa- View this entry on the original dictionary page scan.
candanodakadundubhim. Name of bhava- View this entry on the original dictionary page scan.
caṇḍapotakam. Name of an elephant View this entry on the original dictionary page scan.
caṇḍaśaktim. "of impetuous valour", Name of a daitya- View this entry on the original dictionary page scan.
caṇḍātakan. a short petticoat View this entry on the original dictionary page scan.
caṇḍātakan. see caṇḍāntika-. View this entry on the original dictionary page scan.
caṇḍatuṇḍakam. "powerful-beaked", Name of a son of the bird garuḍa- View this entry on the original dictionary page scan.
caṇḍikāśatakan. "100 stanzas in praise of caṇḍikā-", Name of a poem (ascribed to bāṇa-). View this entry on the original dictionary page scan.
candrābhavaktramfn. moon-faced View this entry on the original dictionary page scan.
candracūḍāṣṭakan. Name of a hymn. View this entry on the original dictionary page scan.
candradakṣiṇa(dr/a--) mfn. offering anything bright or gold in sacrifice View this entry on the original dictionary page scan.
candradhvajaketum. Name of a samādhi- View this entry on the original dictionary page scan.
candraguptakam. the king candra-gupta- (of pāṭali-putra-) View this entry on the original dictionary page scan.
candrajanakam. "moon-progenitor", the sea View this entry on the original dictionary page scan.
candrakam. the moon (in fine compositi or 'at the end of a compound' f(ikā-).) View this entry on the original dictionary page scan.
candrakam. a circle or ring shaped like the moon View this entry on the original dictionary page scan.
candrakam. a spot similar to the moon (in fine compositi or 'at the end of a compound' f(ikā-).) View this entry on the original dictionary page scan.
candrakam. the eye in a peacock's tail View this entry on the original dictionary page scan.
candrakam. a finger-nail View this entry on the original dictionary page scan.
candrakam. Name of a fish (varia lectio daka- ) View this entry on the original dictionary page scan.
candrakam. Name of a poet View this entry on the original dictionary page scan.
candrakam. of an owl View this entry on the original dictionary page scan.
candrakan. black pepper View this entry on the original dictionary page scan.
cāndrakamfn. lunar, View this entry on the original dictionary page scan.
cāndrakan. dried ginger View this entry on the original dictionary page scan.
candrakalāf. a digit or 1/16 of the moon's disc (each digit is personified as a female divinity, ), the crescent on the day before or after the new moon View this entry on the original dictionary page scan.
candrakalāf. the mark of a finger-nail resembling the crescent before or after new moon View this entry on the original dictionary page scan.
candrakalāf. the fish Pimelodus Vacha View this entry on the original dictionary page scan.
candrakalāf. a kind of drum View this entry on the original dictionary page scan.
candrakalāf. (in music) a kind of measure View this entry on the original dictionary page scan.
candrakalāf. Name of a drama View this entry on the original dictionary page scan.
candrakālānalan. a kind of diagram View this entry on the original dictionary page scan.
candrakālānalacakran. idem or 'n. a kind of diagram' View this entry on the original dictionary page scan.
candrakalātantran. Name of work View this entry on the original dictionary page scan.
candrakamalākaram. Name of work View this entry on the original dictionary page scan.
candrakāntamfn. lovely as the moon, View this entry on the original dictionary page scan.
candrakāntam. "moon-loved", the moon-stone (a gem supposed to be formed from the congelation of the moon's rays and to dissolve under the influence of its light) etc. View this entry on the original dictionary page scan.
candrakāntam. n. the white eatable water-lily (blossoming during night) View this entry on the original dictionary page scan.
candrakāntan. sandalwood View this entry on the original dictionary page scan.
candrakāntāf. the wife of the moon View this entry on the original dictionary page scan.
candrakāntan. night View this entry on the original dictionary page scan.
candrakāntan. Name of a surāṅganā- View this entry on the original dictionary page scan.
candrakāntafn. Name of a town View this entry on the original dictionary page scan.
candrakāntamaṇimayamfn. made of the gem candra-kānta- View this entry on the original dictionary page scan.
candrakāntamayamfn. idem or 'mfn. made of the gem candra-kānta- ' View this entry on the original dictionary page scan.
candrakāntaratnamayamfn. idem or 'mfn. idem or 'mfn. made of the gem candra-kānta- ' ' View this entry on the original dictionary page scan.
candrakāntif. the brilliancy or lustre of the moon, moonlight View this entry on the original dictionary page scan.
candrakāntif. Name of the moon's disc on the ninth day View this entry on the original dictionary page scan.
candrakāntim. Name of a hero of kālikā- View this entry on the original dictionary page scan.
candrakāntīyaNom. yati-, to resemble the moon-stone (candra-kānta-) View this entry on the original dictionary page scan.
candrakāṭukim. Name of a man View this entry on the original dictionary page scan.
candrakavatm. "having eyes in the tail", -a peacock View this entry on the original dictionary page scan.
candrakavim. Name of a poet View this entry on the original dictionary page scan.
candrakeśam. Name of a hero of kālikā-, View this entry on the original dictionary page scan.
candrakesarinm. idem or 'm. Name of a hero of kālikā-, ' View this entry on the original dictionary page scan.
candraketum. Name of a son of lakṣmaṇa- View this entry on the original dictionary page scan.
candraketum. of several other men View this entry on the original dictionary page scan.
candraketum. of a vidyādhara- View this entry on the original dictionary page scan.
candraketum. of a prince of cakora- (slain by an emissary of king śūdraka-) View this entry on the original dictionary page scan.
candraketum. of a prince (emissary of king śūdrika-)
candraketum. of a hero of kālikā-, View this entry on the original dictionary page scan.
candrakinm. equals ka-vat- View this entry on the original dictionary page scan.
candrakīrtim. Name of a prince of ujjayinī- View this entry on the original dictionary page scan.
candrakīrtim. of a sūri- of the jaina-s. View this entry on the original dictionary page scan.
candrakitamfn. (gaRa tārakādi-) furnished with brilliant moon-like spots (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
candrakośam. Name of a lexicon, View this entry on the original dictionary page scan.
candrakrīḍam. (in music) a kind of measure. View this entry on the original dictionary page scan.
candrakṣāntam. Name of a man. View this entry on the original dictionary page scan.
candrakṣayam. "waning of the moon", new moon View this entry on the original dictionary page scan.
candrakulan. Name of a town View this entry on the original dictionary page scan.
candrakulyāf. Name of a river in Kashmir View this entry on the original dictionary page scan.
candrakumāraśikharan. Name of a place View this entry on the original dictionary page scan.
candrakuṇḍam. Name of a pond in kāma-rūpa- View this entry on the original dictionary page scan.
candrakūṭam. Name of a mountain in kāma-rūpa- View this entry on the original dictionary page scan.
candralauhakan. idem or 'n. idem or 'n. silver ' ' View this entry on the original dictionary page scan.
candralohakan. silver View this entry on the original dictionary page scan.
candraprakāśam. Name of work View this entry on the original dictionary page scan.
candrārdhakṛtaśekharamfn. one who has adorned his forehead with a crescent mark View this entry on the original dictionary page scan.
candraśakaīam. n. the half-moon, View this entry on the original dictionary page scan.
candratārakan. sg. the moon and the stars View this entry on the original dictionary page scan.
candravaktrāf. Name of a town. View this entry on the original dictionary page scan.
candrāvataṃsakam. Name of a man View this entry on the original dictionary page scan.
cāndrāyaṇabhaktamfn. inhabited by cāndrāyaṇa-s gaRa aiṣukāry-ādi-. View this entry on the original dictionary page scan.
candrodayamakaradhvajam. Name of a medicinal preparation View this entry on the original dictionary page scan.
capalakamfn. fickle, inconsiderate View this entry on the original dictionary page scan.
capalātmakamfn. of a fickle nature View this entry on the original dictionary page scan.
caphaṭṭakam. (onomatopoetic (i.e. formed from imitation of sounds) ) Name of a king gaRa kurv-ādi- ( and ) View this entry on the original dictionary page scan.
caphaṭṭakam. See cāphaṭṭaki-. View this entry on the original dictionary page scan.
cāphaṭṭakim. patronymic fr. caphaṭṭaka- gaRa taulvaly-ādi-. View this entry on the original dictionary page scan.
cāphaṭṭakyam. idem or 'm. patronymic fr. caphaṭṭaka- gaRa taulvaly-ādi-.' gaRa kurv-ādi- () View this entry on the original dictionary page scan.
cappaṭṭakam. Name of a ṛṣi- gaRa kurv-ādi- () View this entry on the original dictionary page scan.
cāppaṭṭakyam. patronymic fr. cappaṭṭaka- gaRa kurv-ādi- () . View this entry on the original dictionary page scan.
cāracakṣusmfn. equals -dṛś- View this entry on the original dictionary page scan.
cāracakṣusn. a spy employed like an eye View this entry on the original dictionary page scan.
carakam. a wanderer, wandering religious student View this entry on the original dictionary page scan.
carakam. a spy View this entry on the original dictionary page scan.
carakam. a kind of ascetic View this entry on the original dictionary page scan.
carakam. a kind of medicinal plant View this entry on the original dictionary page scan.
carakam. Name of a muni- and physician (the Serpent-king śeṣa-, who was the recipient of the āyur-veda-;once on visiting the earth and finding it full of sickness he became moved with pity and determined to become incarnate as the son of a muni- for alleviating disease;he was called caraka- because he had visited the earth as a kind of spy or cara-;he then composed a new book on medicine, based on older works of agni-veśa- and other pupils of ātreya- ) View this entry on the original dictionary page scan.
carakam. Name of a lexicographer View this entry on the original dictionary page scan.
carakam. plural (see ) Name of a branch of the black yajur-veda- (the practises and rites-enjoined by which are different in some respects from those in ) on and View this entry on the original dictionary page scan.
carakam. Name of an evil spirit View this entry on the original dictionary page scan.
cārakamfn. in fine compositi or 'at the end of a compound' proceeding View this entry on the original dictionary page scan.
cārakamfn. ( car-, Causal) setting in motion View this entry on the original dictionary page scan.
cārakamfn. composed by caraka- View this entry on the original dictionary page scan.
cārakam. a spy () and View this entry on the original dictionary page scan.
cārakam. ( car-, Causal ) a driver, herdsman (see go--) View this entry on the original dictionary page scan.
cārakam. equals bhojaka- View this entry on the original dictionary page scan.
cārakam. an associate, companion (saṃcāraka-) View this entry on the original dictionary page scan.
cārakam. a fetter View this entry on the original dictionary page scan.
cārakam. a prison View this entry on the original dictionary page scan.
cārakam. Buchanania latifolia View this entry on the original dictionary page scan.
cārakam. journey (of buddha-) View this entry on the original dictionary page scan.
cārakam. a cock-roach View this entry on the original dictionary page scan.
carakabhāṣyan. Name of another commentator or commentary on by kṛṣṇa-. View this entry on the original dictionary page scan.
carakācāryam. a teacher of the caraka-s View this entry on the original dictionary page scan.
carakādhvaryum. idem or 'm. a teacher of the caraka-s ' (generally plural) View this entry on the original dictionary page scan.
carakagrantham. caraka-'s book (on med.) View this entry on the original dictionary page scan.
carakatantran. idem or 'm. caraka-'s book (on med.)' View this entry on the original dictionary page scan.
carakatantravyākhyāf. Name of a commentator or commentary on by hari-candra-. View this entry on the original dictionary page scan.
cārakatrirātram. a particular ceremony lasting three days (prescribed by caraka- or by the caraka-s?) View this entry on the original dictionary page scan.
carakhaṇḍan. (in astronomy) the amount of the ascensional difference View this entry on the original dictionary page scan.
carakīf. a kind of venomous fish View this entry on the original dictionary page scan.
cārakīṇamfn. fit for a wandering religious student (c/araka-) View this entry on the original dictionary page scan.
caramakālam. the last moments, hour of death View this entry on the original dictionary page scan.
caramakṣmābhṛtm. the western ("earth-supporter"or) mountain View this entry on the original dictionary page scan.
caraṇakan. a small foot, View this entry on the original dictionary page scan.
caraṇakamalan. "foot-lotus", a beautiful foot View this entry on the original dictionary page scan.
caraṇakisalayan. idem or 'n. "foot-lotus", a beautiful foot ' View this entry on the original dictionary page scan.
caraṇodakan. equals ṇāmṛta- View this entry on the original dictionary page scan.
cārāyaṇakamfn. derived from the cārāyaṇa-s View this entry on the original dictionary page scan.
carcakam. repetition of a word (in reciting the veda-) (plural) View this entry on the original dictionary page scan.
carcakamālāf. a rosary View this entry on the original dictionary page scan.
caritrabandhakam. n. a friendly pledge View this entry on the original dictionary page scan.
cāritrakavacamfn. cased in the armour of good conduct View this entry on the original dictionary page scan.
carmacaṭakam. a bat View this entry on the original dictionary page scan.
carmacaṭakāf. idem or 'm. a bat ' View this entry on the original dictionary page scan.
carmacitrakan. white leprosy View this entry on the original dictionary page scan.
carmakāram. a worker in leather, shoemaker (offspring of a caṇḍāla- woman by a fisherman ;or of a vaideha- female by a niṣāda- ;or of a niṣāda- woman ) View this entry on the original dictionary page scan.
carmakārakam. a shoemaker View this entry on the original dictionary page scan.
carmakārālukam. a kind of bulbous plant
carmakaraṇan. working in skins or leather View this entry on the original dictionary page scan.
carmakārīf. a shoemaker's wife View this entry on the original dictionary page scan.
carmakārīf. Mimosa abstergens View this entry on the original dictionary page scan.
carmakārinm. idem or 'm. a shoemaker ' View this entry on the original dictionary page scan.
carmakāriṇīf. a woman on the second day of her courses. View this entry on the original dictionary page scan.
carmakartam. a piece of skin or leather View this entry on the original dictionary page scan.
carmakāryan. working in leather or skins View this entry on the original dictionary page scan.
carmakaśā(or -kaṣā-) f. Name of a plant (Mimosa abstergens ;a kind of perfume ) (equals saptalā-). View this entry on the original dictionary page scan.
carmakāṣṭhamayamfn. made of leather and wood View this entry on the original dictionary page scan.
carmakāṣṭhikāf. "made of leather and wood", a whip View this entry on the original dictionary page scan.
carmakhaṇḍan. equals -karta- View this entry on the original dictionary page scan.
carmakhaṇḍikam. plural Name of a people View this entry on the original dictionary page scan.
carmakīlam. n. "skin-excrescence", a wart View this entry on the original dictionary page scan.
carmakīlam. excrescences considered as a kind of hemorrhoids, . View this entry on the original dictionary page scan.
carmakṛtm. equals -kāraka- View this entry on the original dictionary page scan.
carmakūpam. a leathern bottle View this entry on the original dictionary page scan.
carmaprasevakam. equals -puṭa- View this entry on the original dictionary page scan.
carmapuṭakam. a leathern pipe View this entry on the original dictionary page scan.
carmārakam. equals rmānurañjana-
carmāvakartanan. "act of cutting leather", equals ma-karaṇa- View this entry on the original dictionary page scan.
carmāvakartinm. "leather-cutter", = ma-kṛt- View this entry on the original dictionary page scan.
carmāvakarttṛm. idem or 'm. "leather-cutter", = ma-kṛt- ' View this entry on the original dictionary page scan.
cārucaryāśatakan. Name of work View this entry on the original dictionary page scan.
cārunālakan. red lotus. View this entry on the original dictionary page scan.
cāruvaktramfn. equals -mukha- View this entry on the original dictionary page scan.
cāruvaktram. Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
carvitapātrakan. idem or 'n. a spitting-pot ' View this entry on the original dictionary page scan.
caṣakamn. (gaRa ardharcādi-) a cup, wineglass (in fine compositi or 'at the end of a compound' f(ā-). ) View this entry on the original dictionary page scan.
caṣakam. spirituous liquor ("honey") View this entry on the original dictionary page scan.
caṣakam. a second Scholiast or Commentator on View this entry on the original dictionary page scan.
caṣakāyaNom. A1. yate-, to become a cup, View this entry on the original dictionary page scan.
cāṣavaktram. "jay-faced", Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
cāṣavaktram. plural a class of spirits, . View this entry on the original dictionary page scan.
caṭakam. a sparrow View this entry on the original dictionary page scan.
caṭakam. Name of a poet View this entry on the original dictionary page scan.
caṭakam. plural "sparrows", a nickname of vaiśampāyana-'s school (varia lectio for caraka-) View this entry on the original dictionary page scan.
caṭakāf. (gaṇa-s ajādi-and kṣipakādi-) a hen-sparrow View this entry on the original dictionary page scan.
caṭakāf. a young hen-sparrow Va1rtt. 2 View this entry on the original dictionary page scan.
caṭakāf. Turdus macrourus (śyāmā-) View this entry on the original dictionary page scan.
caṭakāf. equals -śiras- View this entry on the original dictionary page scan.
caṭakāf. of ka- q.v View this entry on the original dictionary page scan.
cātakam. the bird Cucculus melanoleucus (said to subsist on rain-drops) etc. View this entry on the original dictionary page scan.
cāṭakadeśam. Name of a country View this entry on the original dictionary page scan.
cāṭakairam. (fr. caṭakā- ) a young sparrow View this entry on the original dictionary page scan.
caṭakakāf. diminutive fr. ṭakā- View this entry on the original dictionary page scan.
cātakānandanam. " cātaka-'s delight", the rainy season View this entry on the original dictionary page scan.
caṭakāśirasn. the root of long pepper View this entry on the original dictionary page scan.
cātakāṣṭakan. the 8 verses on the cātaka- bird. View this entry on the original dictionary page scan.
cāṭakāyanam. patronymic fr. caṭaka- gaRa 1. naḍādi-. View this entry on the original dictionary page scan.
cātakīf. the female of the cātaka- bird View this entry on the original dictionary page scan.
cātakim. Name of a man View this entry on the original dictionary page scan.
caṭakikāf. equals kakā- View this entry on the original dictionary page scan.
caṭitakam. a crack, rent, 411. View this entry on the original dictionary page scan.
catuḥsāhasrakamf(ikā-)n. consisting of 4000 View this entry on the original dictionary page scan.
catuḥśālakan. idem or 'm. a building with 4 halls ' View this entry on the original dictionary page scan.
catuḥsauvarṇaka mfn. having the weight of four suvarṇa-s, . View this entry on the original dictionary page scan.
catuḥsraktimfn. (c/at-) quadrangular (said of the vedi-) View this entry on the original dictionary page scan.
catuḥsraktif. (scilicet vedi-) equals uttara-vedi- View this entry on the original dictionary page scan.
catuḥsuvarṇakamfn. having the weight of four suvarṇa-s, . View this entry on the original dictionary page scan.
caturakamf(ikā-)n. clever, skilful
caturakam. Name of a jackal (see mahā--) View this entry on the original dictionary page scan.
cāturakamfn. flattering View this entry on the original dictionary page scan.
cāturakamfn. visible View this entry on the original dictionary page scan.
cāturakamfn. governing View this entry on the original dictionary page scan.
cāturakam. a small round pillow View this entry on the original dictionary page scan.
caturakramam. (in music) a kind of measure. View this entry on the original dictionary page scan.
caturakṣamf(-)n. four-eyed View this entry on the original dictionary page scan.
cāturakṣa(fr. cat-) a cast of dice with 4 dots View this entry on the original dictionary page scan.
caturakṣaramfn. (c/at-) consisting of 4 syllables View this entry on the original dictionary page scan.
caturakṣaran. a combination of 4 syllables View this entry on the original dictionary page scan.
caturakṣaraśasind. in numbers of 4 syllables View this entry on the original dictionary page scan.
caturaṅgabalādhyakṣam. the commander-in-chief of a complete army View this entry on the original dictionary page scan.
caturaṅgakrīḍāf. playing at chess View this entry on the original dictionary page scan.
caturaśrakamf(ā-)n. four-cornered, forming a quadrangular figure View this entry on the original dictionary page scan.
caturaśrakam. a particular posture (in dancing) View this entry on the original dictionary page scan.
caturasrakafor -aśraka-. View this entry on the original dictionary page scan.
caturaṣṭakamfn. having 4 days called aṣṭakā-s View this entry on the original dictionary page scan.
cāturbhadrakan. idem or 'n. (fr. cat-) a collection of 4 medicinal plants ' View this entry on the original dictionary page scan.
caturdaśakamfn. the 14th View this entry on the original dictionary page scan.
caturdvīpacakravartinm. the sovereign of the 4 dvīpa-s View this entry on the original dictionary page scan.
caturhotrakafor cāturhotra- q.v View this entry on the original dictionary page scan.
caturjātakan. idem or 'n. equals cāt- ' View this entry on the original dictionary page scan.
cāturjātakan. idem or 'n. an aggregate of 4 substances ' (see kaṭu--). View this entry on the original dictionary page scan.
caturmahārājakāyikam. plural (equals cāt-) "belonging to the attendance of those 4 great kings", Name of a class of deities View this entry on the original dictionary page scan.
cāturmahārājakāyika(plural) equals cat- View this entry on the original dictionary page scan.
cāturmāsakamfn. one who performs the cāturmāsya- sacrifices Va1rtt. 5. View this entry on the original dictionary page scan.
cāturmāsyakārikāf. Name of work View this entry on the original dictionary page scan.
caturthabhaktakṣapaṇan. fasting so as to take only every 4th meal View this entry on the original dictionary page scan.
caturthakamfn. the 4th View this entry on the original dictionary page scan.
caturthakamfn. returning every 4th day (a fever), quartan, View this entry on the original dictionary page scan.
caturthakam. (in music) a kind of measure View this entry on the original dictionary page scan.
cāturthakamfn. appearing every 4th day, quartan (fever)
caturthakālamfn. equals lika- View this entry on the original dictionary page scan.
caturthakālam. "4th meal" View this entry on the original dictionary page scan.
caturthakālamind. at the 4th meal-time id est at the evening of every 2nd day (of any one's fasting) View this entry on the original dictionary page scan.
caturthakāleind. idem or 'ind. at the 4th meal-time id est at the evening of every 2nd day (of any one's fasting) ' View this entry on the original dictionary page scan.
caturthakālikamfn. one who takes only every 4th meal View this entry on the original dictionary page scan.
cāturthakārirasam. a medicine for keeping off quartan ague. View this entry on the original dictionary page scan.
caturvaktramf(ā-)n. four-faced View this entry on the original dictionary page scan.
caturvaktram. Name of brahmā- View this entry on the original dictionary page scan.
caturvaktram. of a dānava- View this entry on the original dictionary page scan.
caturvaktram. of an attendant of durgā- View this entry on the original dictionary page scan.
caturvibhaktamfn. divided into 4 parts
cāturviṃśakafr. caturviṃś/a- q.v View this entry on the original dictionary page scan.
caturviṃśatidaṇḍakastavam. Name of work View this entry on the original dictionary page scan.
caturviṃśatyakṣaramf(ā-)n. (c/at-) having 24 syllables View this entry on the original dictionary page scan.
caturviṃśatyakṣaramfn. having 24 syllables, View this entry on the original dictionary page scan.
caturvinśakamfn. consisting of 24 View this entry on the original dictionary page scan.
caturvyavasitayamakan. a kind of yamaka- (in which the four quarters of a stanza are homophonous), View this entry on the original dictionary page scan.
catuścakram. Name of a sacrifice View this entry on the original dictionary page scan.
catuścakram. of a phenomenon in the sky View this entry on the original dictionary page scan.
catuścakran. Name of a mystical diagram,
catuscatvāriṃśadakṣaramfn. having 44 syllables, View this entry on the original dictionary page scan.
catuṣpādakamf(ikā-)n. consisting of 4 pāda-s View this entry on the original dictionary page scan.
catuṣpakṣa(c/at-) mf(ā-)n. furnished with 4 posts View this entry on the original dictionary page scan.
catuṣpathakṛtāśayam. "having made its abode on a cross-way", a kind of ghost View this entry on the original dictionary page scan.
catustriṃśadakṣaramf(ā-)n. (c/at-) containing 34 syllables View this entry on the original dictionary page scan.
catustriṃśajjātakajñam. "knowing 34 jātaka-s", Name of a buddha- View this entry on the original dictionary page scan.
catvārakan. a collection of four, View this entry on the original dictionary page scan.
catvāriṃśadakṣaramf(ā-)n. consisting of 40 syllables, . View this entry on the original dictionary page scan.
cauḍakarmann. equals caula-k- View this entry on the original dictionary page scan.
caulakarmann. idem or 'mfn. in fine compositi or 'at the end of a compound' (gaRa cūrṇādi-) See cūlā-.' View this entry on the original dictionary page scan.
caulakāyana patronymic fr. cūlaka- View this entry on the original dictionary page scan.
cauradhvajabaddhakam. a notorious thief. View this entry on the original dictionary page scan.
caurakam. the perfume coraka- View this entry on the original dictionary page scan.
caurakaf. (gaRa manojñādi-) equals rakarman- View this entry on the original dictionary page scan.
caurakarmann. thievery, theft View this entry on the original dictionary page scan.
caurakayāind. [instr.clandestinely, in the back of(genitive case)] View this entry on the original dictionary page scan.
caurakilbiṣan. the crime or guilt of a thief, . View this entry on the original dictionary page scan.
caurasyakulan. a gang of thieves , View this entry on the original dictionary page scan.
cauryakan. equals ra-karman- View this entry on the original dictionary page scan.
cāyakamfn. View this entry on the original dictionary page scan.
cayakamfn. equals caye kuśala- gaRa ākarṣādi-. View this entry on the original dictionary page scan.
cayanakārikāf. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ceḍakam. equals ḍa-, ib-. View this entry on the original dictionary page scan.
celakam. for chel- View this entry on the original dictionary page scan.
celakam. Name of a man (see c/ailaki-) View this entry on the original dictionary page scan.
celakamn. equals cela- in fine compositi or 'at the end of a compound' a bad representative of. View this entry on the original dictionary page scan.
celakaṇṭhinmfn. for śveta-k- View this entry on the original dictionary page scan.
celaknopamind. so as to wet the clothes (rain) View this entry on the original dictionary page scan.
celanirṇejakam. a washerman View this entry on the original dictionary page scan.
celaprakṣālakam. idem or 'm. a washerman ' View this entry on the original dictionary page scan.
celāśakam. "clothes-eater", a moth View this entry on the original dictionary page scan.
cerakam. (equals mīmāṃsaka-?) View this entry on the original dictionary page scan.
ceṣṭakamfn. making effort or exertion View this entry on the original dictionary page scan.
ceṣṭakam. a kind of fish (equals ṭa-) View this entry on the original dictionary page scan.
ceṣṭakam. a kind of coitus. View this entry on the original dictionary page scan.
ceṣṭāpṛthaktvanivartinmfn. to be (or being) carried out by separate (repeated) acts, View this entry on the original dictionary page scan.
cetakamfn. causing to think View this entry on the original dictionary page scan.
cetakamfn. sentient View this entry on the original dictionary page scan.
ceṭakam. a servant, slave (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
ceṭakam. a paramour View this entry on the original dictionary page scan.
cetakaetc. See View this entry on the original dictionary page scan.
cetakīf. equals tanikā- View this entry on the original dictionary page scan.
cetakīf. Jasminum grandiflorum View this entry on the original dictionary page scan.
cetanakāf. equals nikā- View this entry on the original dictionary page scan.
cetanakīf. equals nikā- View this entry on the original dictionary page scan.
cetanāṣṭakan. Name of work View this entry on the original dictionary page scan.
cetasakam. plural Name of a people View this entry on the original dictionary page scan.
chādakamfn. covering View this entry on the original dictionary page scan.
chādakamfn. any obscuring object (as a cloud) View this entry on the original dictionary page scan.
chādakaetc. See View this entry on the original dictionary page scan.
chāgakan. herd of goats View this entry on the original dictionary page scan.
chāgakarṇam. "goat-ear", Tectona grandis View this entry on the original dictionary page scan.
chagalakam. a he-goat View this entry on the original dictionary page scan.
chāgalakam. a kind of fish View this entry on the original dictionary page scan.
chāgalakṣaṇan. Name of śukla-yajurveda-pariśiṣṭa- ii. View this entry on the original dictionary page scan.
chakāram. the letter or sound cha-. View this entry on the original dictionary page scan.
chalakamfn. delusive View this entry on the original dictionary page scan.
chalakārakamfn. practising fraud
chalakārinmfn. idem or 'mfn. practising fraud ' View this entry on the original dictionary page scan.
chalitakam. Name of a man View this entry on the original dictionary page scan.
chalitakan. See lika-. View this entry on the original dictionary page scan.
chalitakayogam. plural Name of a kalā- (q.v) View this entry on the original dictionary page scan.
chāṇakam. a particular mixed caste, View this entry on the original dictionary page scan.
chandaḥprakaraṇan. a chapter on metre View this entry on the original dictionary page scan.
chandaḥprakāśam. Name of work View this entry on the original dictionary page scan.
chandakamfn. in fine compositi or 'at the end of a compound' "charming" See sarva-- View this entry on the original dictionary page scan.
chandakam. Name of śākya-muni-'s charioteer View this entry on the original dictionary page scan.
chandaka1. & 2. View this entry on the original dictionary page scan.
chandakanivartanan. " candaka-'s return", Name of a caitya-, View this entry on the original dictionary page scan.
chandakapātanam. a hypocrite View this entry on the original dictionary page scan.
chāndasakan. the being familiar with the Vedic hymns, gaRa manojñādi-. View this entry on the original dictionary page scan.
chandaspakṣa(ch/and-) mf(ā-)n. borne aloft on the wings of desire View this entry on the original dictionary page scan.
chandogamāhakim. Name of a teacher View this entry on the original dictionary page scan.
chandomatrikakudm. Name of a try-aha- rite View this entry on the original dictionary page scan.
chattracakran. (in astrology) a kind of diagram. View this entry on the original dictionary page scan.
chattrakam. a parasol-shaped temple in honour of śiva- View this entry on the original dictionary page scan.
chattrakam. a parasol-shaped bee-hive (see chāttr-) View this entry on the original dictionary page scan.
chattrakam. Asteracantha longifolia View this entry on the original dictionary page scan.
chattrakam. a mushroom View this entry on the original dictionary page scan.
chattrakam. a kingfisher View this entry on the original dictionary page scan.
chattrakan. a parasol View this entry on the original dictionary page scan.
chattrakan. a small parasol View this entry on the original dictionary page scan.
chattrakan. a mushroom View this entry on the original dictionary page scan.
chattrakan. candied sugar View this entry on the original dictionary page scan.
chāttrakan. equals ra-- gaRa manojñādi- View this entry on the original dictionary page scan.
chāttrakan. equals ra-, a kind of honey View this entry on the original dictionary page scan.
chattrapuṣpakam. "parasol flowered", the tilaka- tree View this entry on the original dictionary page scan.
chāttravyaṃsakam. a knavish pupil gaRa mayūra-vyamasakādi-. View this entry on the original dictionary page scan.
chāyakamfn. (said of demons) causing nightmare (?) View this entry on the original dictionary page scan.
chāyānāṭakan. a small drama or one imitative of another (as the dhūtāṅgada-). View this entry on the original dictionary page scan.
chedakamfn. in fine compositi or 'at the end of a compound' cutting off View this entry on the original dictionary page scan.
chedakam. the denominator of a fraction View this entry on the original dictionary page scan.
chedakam. see granthi--. View this entry on the original dictionary page scan.
chedakaramfn. making incisions View this entry on the original dictionary page scan.
chedakaram. a wood-cutter View this entry on the original dictionary page scan.
chedyakan. drawing, projection View this entry on the original dictionary page scan.
chedyakādhyāyam. Name of View this entry on the original dictionary page scan.
chelakam. (fr. chagal-) a he-goat View this entry on the original dictionary page scan.
chidakam. "thunderbolt"or"diamond" (see ) View this entry on the original dictionary page scan.
chidrakarṇamfn. having the ears bored View this entry on the original dictionary page scan.
chikkākārakamfn. causing sneezing View this entry on the original dictionary page scan.
chindakam. Name of a race, View this entry on the original dictionary page scan.
chinnabhaktamfn. "having one's meals interrupted", starving View this entry on the original dictionary page scan.
chinnakamfn. "having a little cut off." View this entry on the original dictionary page scan.
chinnakarṇamfn. having the ears shortened (as animals) View this entry on the original dictionary page scan.
chinnakarṇamf(ī-)n. () View this entry on the original dictionary page scan.
chinnakataramfn. (Comparative degree) Va1rtt. 5. View this entry on the original dictionary page scan.
chinnakeśamfn. having the hair cut View this entry on the original dictionary page scan.
chinnamastakāf. "decapitated", a headless form of durgā- View this entry on the original dictionary page scan.
chinnamastakīkṛto decapitate View this entry on the original dictionary page scan.
chinnapakṣa(nn/a-.) mfn. having the wings torn off. View this entry on the original dictionary page scan.
chinnatarakamfn. (Comparative degree) equals chinnaka-tara-, vArttika 1 and 2 View this entry on the original dictionary page scan.
chismakam. Name of a prince, (varia lectio for śiśuka-). View this entry on the original dictionary page scan.
cicchakti(-śak-) f. mental power View this entry on the original dictionary page scan.
cidacicchaktiyuktamfn. having power (śakti-) over mind and matter View this entry on the original dictionary page scan.
cidātmakamfn. consisting of pure thought View this entry on the original dictionary page scan.
cidratnacaṣakaName of work View this entry on the original dictionary page scan.
cihaṇakantham. Name of a town View this entry on the original dictionary page scan.
cihnakan. a small mark View this entry on the original dictionary page scan.
cihnakārinmfn. marking View this entry on the original dictionary page scan.
cihnakārinmfn. wounding View this entry on the original dictionary page scan.
cihnakārinmfn. frightful View this entry on the original dictionary page scan.
cikīrṣakamfn. idem or 'mfn. ( kṛ- Desiderative) wishing to do ' on View this entry on the original dictionary page scan.
cikitsakamfn. (fr. Desiderative) a physician (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
cikkaṇakanthan. Name of a town gaRa cihaṇādi- (varia lectio citk-). View this entry on the original dictionary page scan.
cikurakalāpam. a mass of hair, tuft of hair View this entry on the original dictionary page scan.
cikurapakṣam. idem or 'm. idem or 'm. a mass of hair, tuft of hair ' ' View this entry on the original dictionary page scan.
cilimīnakam. equals licima- View this entry on the original dictionary page scan.
cillabhakṣyāf. a kind of vegetable perfume View this entry on the original dictionary page scan.
cillakam. equals citraka- q.v View this entry on the original dictionary page scan.
cillakāf. a cricket View this entry on the original dictionary page scan.
cīllakāf. equals cīrī-vāka- View this entry on the original dictionary page scan.
cīnakam. plural the Chinese View this entry on the original dictionary page scan.
cīnakam. sg. Panicum miliaceum View this entry on the original dictionary page scan.
cīnakam. (cīṇaka-) Paddh. View this entry on the original dictionary page scan.
cīnakam. fennel View this entry on the original dictionary page scan.
cīnakam. a kind of camphor View this entry on the original dictionary page scan.
cīnakarkaṭikāf. a kind of gourd (also cīṇa-- ) View this entry on the original dictionary page scan.
cīnakarpūram. a kind of camphor View this entry on the original dictionary page scan.
ciñcāṭaka varia lectio for ñcoṭ- View this entry on the original dictionary page scan.
ciñcoṭakam. the plant krauñcādana- View this entry on the original dictionary page scan.
cintakamfn. in fine compositi or 'at the end of a compound' one who thinks or reflects upon, familiar with (exempli gratia, 'for example' daiva--, vaṃśa--,etc., qq. vv.) View this entry on the original dictionary page scan.
cintakam. an overseer View this entry on the original dictionary page scan.
cintakam. Name of the 23rd kalpa- period View this entry on the original dictionary page scan.
cintakam. see kārya--, graha--, megha--. View this entry on the original dictionary page scan.
cipiṭakam. flattened rice View this entry on the original dictionary page scan.
cirajīvakam. "long-lived", the jīvaka- tree View this entry on the original dictionary page scan.
cīrakāf. a public announcement on a slip of paper View this entry on the original dictionary page scan.
cirakālamfn. belonging to a remote time (a-- negative) View this entry on the original dictionary page scan.
cirakālamind. for a long time View this entry on the original dictionary page scan.
cirakālapālitamfn. protected for a long time View this entry on the original dictionary page scan.
cirakālātind. ablative on account of the long time passed since View this entry on the original dictionary page scan.
cirakālāyaind. dative case for a long time to come View this entry on the original dictionary page scan.
cirakālikamfn. of long standing, old, long-continued, chronic View this entry on the original dictionary page scan.
cirakālīnamfn. idem or 'mfn. of long standing, old, long-continued, chronic ' View this entry on the original dictionary page scan.
cirakālopārjitamfn. equals cira-saṃcita- View this entry on the original dictionary page scan.
cirakāramfn. working slowly View this entry on the original dictionary page scan.
cirakārimfn. idem or 'mfn. working slowly ' , 9539. View this entry on the original dictionary page scan.
cirakārikamfn. idem or 'mfn. idem or 'mfn. working slowly ', 9539.' , 9483; 9534 ff.; 9547. View this entry on the original dictionary page scan.
cirakārinmfn. idem or 'mfn. idem or 'mfn. idem or 'mfn. working slowly ', 9539.', 9483; 9534 ff.; 9547.' , (also ri--and -tva-,abstr.) View this entry on the original dictionary page scan.
cirakārinmfn. making slow progress View this entry on the original dictionary page scan.
cīrakhaṇḍam. a piece of cloth View this entry on the original dictionary page scan.
cirakīrtim. Name of the founder of a religious sect View this entry on the original dictionary page scan.
cirakriyamfn. equals -kāra- View this entry on the original dictionary page scan.
cirakṛtamfn. long practised View this entry on the original dictionary page scan.
cirāntakam. Name of a son of garuḍa- View this entry on the original dictionary page scan.
cirasevakam. an old servant View this entry on the original dictionary page scan.
cīrṇakarkaṭīfor cīna-k- equals ṭikā- View this entry on the original dictionary page scan.
citācūḍakan. "funeral pile mark", a sepulchre View this entry on the original dictionary page scan.
citiśaktif. equals cic-chakti- View this entry on the original dictionary page scan.
citkaṇakanthaSee cikk-. View this entry on the original dictionary page scan.
citradaṇḍakam. the cotton plant = View this entry on the original dictionary page scan.
citrakam. a painter View this entry on the original dictionary page scan.
citrakam. equals tra-kāya- (cillaka-,C) View this entry on the original dictionary page scan.
citrakam. a kind of snake View this entry on the original dictionary page scan.
citrakam. (in algebra) the 8th unknown quantity View this entry on the original dictionary page scan.
citrakam. Plumbago zeylanica, View this entry on the original dictionary page scan.
citrakam. Ricinus communis View this entry on the original dictionary page scan.
citrakam. Name of a son (of vṛṣṇi- or pṛśni- ;of dhṛta-rāṣṭra- ) View this entry on the original dictionary page scan.
citrakam. of a nāga- View this entry on the original dictionary page scan.
citrakam. (plural) of a people, View this entry on the original dictionary page scan.
citrakan. a mark (only in fine compositi or 'at the end of a compound'"marked or characterised by" ) View this entry on the original dictionary page scan.
citrakan. a sectarial mark on the forehead View this entry on the original dictionary page scan.
citrakan. a painting View this entry on the original dictionary page scan.
citrakan. a particular manner of fighting (see tra-hasta-), 15979 (varia lectio cakraka-)
citrakan. Name of a wood near the mountain raivataka-, 8952. View this entry on the original dictionary page scan.
citrakambalam. a variegated carpet or cloth (used as an elephant's housing) View this entry on the original dictionary page scan.
citrakāṇḍālīf. Cissus quadrangularis View this entry on the original dictionary page scan.
citrakaṇṭakam. "having variegated thorns", Asteracantha longifolia or Tribulus lanuginosus View this entry on the original dictionary page scan.
citrakaṇṭham. "speckled-throat", a pigeon View this entry on the original dictionary page scan.
citrakaram. () a painter (son of an architect by a śūdra- woman ;or by a gāndhikī- Paddh.) View this entry on the original dictionary page scan.
citrakāram. equals -kara- View this entry on the original dictionary page scan.
citrakāram. "wonder", astonishment View this entry on the original dictionary page scan.
citrakarmann. any extraordinary act, wonderful deed View this entry on the original dictionary page scan.
citrakarmann. magic View this entry on the original dictionary page scan.
citrakarmann. painting (in Prakrit) (varia lectio) View this entry on the original dictionary page scan.
citrakarmann. a painting, picture View this entry on the original dictionary page scan.
citrakarmanmfn. devoted to various occupations View this entry on the original dictionary page scan.
citrakarmanm. equals -kara- View this entry on the original dictionary page scan.
citrakarmanm. "working wonders", a magician View this entry on the original dictionary page scan.
citrakarmanm. Dalbergia oujeinensis View this entry on the original dictionary page scan.
citrakarmavidmfn. skilled in the art of painting View this entry on the original dictionary page scan.
citrakarmavidmfn. skilled in magic View this entry on the original dictionary page scan.
citrakarṇam. "speckled-ear", Name of a camel View this entry on the original dictionary page scan.
citrakathamfn. full of varied converse, View this entry on the original dictionary page scan.
citrakathālāpasukhamfn. happy in telling charming stories View this entry on the original dictionary page scan.
citrakavitvan. the art of composing verses called citra- (q.v) View this entry on the original dictionary page scan.
citrakāyam. "striped-body", a tiger or panther View this entry on the original dictionary page scan.
citrakeśatāf. the having beautiful hair (one of the 80 minor marks of a buddha-), View this entry on the original dictionary page scan.
citraketum. Name of a son (of garuḍa- ;of vasiṣṭha- ;of kṛṣṇa-, x, 61, 12;of lakṣmaṇa-, ix, 11, 12;of devabhāga-, 24, 39) View this entry on the original dictionary page scan.
citraketum. of a sūrasena- king, View this entry on the original dictionary page scan.
citrakolam. "spotted-breast", a kind of lizard View this entry on the original dictionary page scan.
citrakriyāf. equals -kṛtya- View this entry on the original dictionary page scan.
citrakṛtmfn. astonishing View this entry on the original dictionary page scan.
citrakṛtm. equals -kara- View this entry on the original dictionary page scan.
citrakṛtm. Dalbergia oujeinensis View this entry on the original dictionary page scan.
citrakṛtyan. painting View this entry on the original dictionary page scan.
citrakṣatramfn. whose dominion is brilliant (agni-) (vocative case) View this entry on the original dictionary page scan.
citrakūlāf. a kind of Croton View this entry on the original dictionary page scan.
citrakuṇḍalam. Name of a son of dhṛta-rāṣṭra- View this entry on the original dictionary page scan.
citrakuṣṭhan. white or spotted leprosy. View this entry on the original dictionary page scan.
citrakūṭam. "wonderful peak", Name of a hill and district (the modern Citrakote or Catarkot near Ka1mta1, situated on the river Paisuni about 50 miles S.E. of the Bandah in Bundelkhund;first habitation of the exiled rāma- and lakṣmaṇa-, crowded with temples as the holiest spot of rāma-'s worshippers) View this entry on the original dictionary page scan.
citrakūṭam. a pleasure-hill View this entry on the original dictionary page scan.
citrakūṭan. Name of a town View this entry on the original dictionary page scan.
citrakūṭāf. Name of a river View this entry on the original dictionary page scan.
citrakūṭamāhātmyan. "glory of Citrakote", Name of work View this entry on the original dictionary page scan.
citralekhakam. equals -kara- (not in ) View this entry on the original dictionary page scan.
citramekhalaka View this entry on the original dictionary page scan.
citramekhalakam. equals -piccha- View this entry on the original dictionary page scan.
citrapadakramamind. at a good or brisk pace View this entry on the original dictionary page scan.
citrapakṣam. "speckled-wing" equals -tanu- View this entry on the original dictionary page scan.
citrapakṣam. a kind of pigeon (see -kaṇṭha-) View this entry on the original dictionary page scan.
citrapakṣam. Name of a demon causing head-ache View this entry on the original dictionary page scan.
citrapakṣmatāf. the having beautiful eyelashes (confer, compare - keśatā-), View this entry on the original dictionary page scan.
citrapattrakam. "having variegated feathers", a peacock View this entry on the original dictionary page scan.
citraphalakam. a tablet for painting View this entry on the original dictionary page scan.
citraphalakam. a painting and (in Prakrit) View this entry on the original dictionary page scan.
citraphalakam. and (in fine compositi or 'at the end of a compound' f(ā-).) View this entry on the original dictionary page scan.
citrapicchakam. idem or 'm. equals -pattraka- ' View this entry on the original dictionary page scan.
citrapriyakathamfn. speaking various kind words View this entry on the original dictionary page scan.
citrarañjakan. tin View this entry on the original dictionary page scan.
citraśākāpūpabhakṣyavikārakriyāf. the art of preparing various kinds of pot-herbs, sweetmeats and other eatables (one of the 64 kalā-s). View this entry on the original dictionary page scan.
citraśīrṣakam. "speckled-head", a kind of venomous insect View this entry on the original dictionary page scan.
cittakalitamfn. "calculated in one's mind", anticipated View this entry on the original dictionary page scan.
cittakhedam. grief View this entry on the original dictionary page scan.
cittāpahārakamfn. equals tta-hārin- View this entry on the original dictionary page scan.
cittarakṣinmfn. equals -cārin- View this entry on the original dictionary page scan.
cīvarabhajakam. distributor of monks' dresses View this entry on the original dictionary page scan.
cīvaragopakam. the keeper of monks' dresses View this entry on the original dictionary page scan.
cīvarakarmann. arranging a monk's dress (before a journey), (see ) View this entry on the original dictionary page scan.
cīvarakarṇikam. n. lappet of a monk's robe View this entry on the original dictionary page scan.
cocakan. the bark of cinnamon View this entry on the original dictionary page scan.
cocakan. bark View this entry on the original dictionary page scan.
codakamfn. impelling View this entry on the original dictionary page scan.
codakam. direction, invitation View this entry on the original dictionary page scan.
codakam. (in grammar) equals pari-graha- q.v
codakam. View this entry on the original dictionary page scan.
codakam. asker, objectioner, pupil View this entry on the original dictionary page scan.
coḍaka -colaka-, a jacket View this entry on the original dictionary page scan.
coḍakarṇam. "projecting-ear", Name of a man View this entry on the original dictionary page scan.
colakam. (equals coḍaka-) a jacket View this entry on the original dictionary page scan.
colakam. a cuirass View this entry on the original dictionary page scan.
colakam. plural the cola-s View this entry on the original dictionary page scan.
colakan. bark View this entry on the original dictionary page scan.
colakinm. a cuirassier View this entry on the original dictionary page scan.
colakinm. "sheathed", a bamboo shoot View this entry on the original dictionary page scan.
colakinm. the orange tree View this entry on the original dictionary page scan.
colakinm. the wrist View this entry on the original dictionary page scan.
colapaṭṭakam. a piece of cloth worn (by jaina-s) round the middle of the body,
copakaSee gale--. View this entry on the original dictionary page scan.
corakam. a thief. View this entry on the original dictionary page scan.
corakam. Trigonella corniculata View this entry on the original dictionary page scan.
corakam. a kind of perfume View this entry on the original dictionary page scan.
corakabandhamind. so as to tie in a particular way View this entry on the original dictionary page scan.
corakaṇṭakam. a kind of grass (the seeds of which stick in the clothes) View this entry on the original dictionary page scan.
corakaraṇan. calling anyone a thief View this entry on the original dictionary page scan.
coritakan. anything stolen, View this entry on the original dictionary page scan.
coritakan. petty theft View this entry on the original dictionary page scan.
cūḍaka in fine compositi or 'at the end of a compound' equals ḍā- (-karaṇa-) View this entry on the original dictionary page scan.
cūḍakaa well View this entry on the original dictionary page scan.
cūḍakāf. Name of an apsaras- View this entry on the original dictionary page scan.
cūḍālakṣaṇan. tonsure View this entry on the original dictionary page scan.
cūḍāpakṣāvadānan. Name of View this entry on the original dictionary page scan.
cūḍārakam. Name of a man, (plural) his descendants gaRa upakādi- (paṇḍ- ) View this entry on the original dictionary page scan.
cūḍitakaSee cūlit-. View this entry on the original dictionary page scan.
cukrakan. sorrel View this entry on the original dictionary page scan.
cukrakaf. equals kra-vedhaka- View this entry on the original dictionary page scan.
cukravedhakan. a kind of sour rice-gruel View this entry on the original dictionary page scan.
culakafor luka- q.v View this entry on the original dictionary page scan.
culaka(ā-) See luka-. View this entry on the original dictionary page scan.
cūlakamfn. in fine compositi or 'at the end of a compound' a crest (cūḍā-) View this entry on the original dictionary page scan.
cūlitakam. Name of a poet, View this entry on the original dictionary page scan.
cullakīf. a kind of water-pot View this entry on the original dictionary page scan.
cullakīf. equals lukin- View this entry on the original dictionary page scan.
cullakīf. Name of a race View this entry on the original dictionary page scan.
cumbakamfn. one who kisses much View this entry on the original dictionary page scan.
cumbakamfn. "one who has read much", superficial View this entry on the original dictionary page scan.
cumbakamfn. knavish, roguish View this entry on the original dictionary page scan.
cumbakam. equals -maṇi- View this entry on the original dictionary page scan.
cumbakam. the upper part of a balance View this entry on the original dictionary page scan.
cumbakan. a parallel passage View this entry on the original dictionary page scan.
cumbakamaṇim. a loadstone View this entry on the original dictionary page scan.
cupadāsakaSee cupa-. View this entry on the original dictionary page scan.
cūrṇakam. a kind of ṣaṣṭika- grain View this entry on the original dictionary page scan.
cūrṇakam. chalk-like paleness View this entry on the original dictionary page scan.
cūrṇakam. grain fried and pounded View this entry on the original dictionary page scan.
cūrṇakan. fragrant powder View this entry on the original dictionary page scan.
cūrṇakan. a kind of easy prose (expounding the purport of a foregoing verse ) View this entry on the original dictionary page scan.
cūrṇakan. grain fried and pounded View this entry on the original dictionary page scan.
cūrṇakan. a kind of cake View this entry on the original dictionary page scan.
cūrṇakāram. a lime-burner (kind of mixed caste) View this entry on the original dictionary page scan.
cūrṇakeśam. equals -kuntala- View this entry on the original dictionary page scan.
cūrṇakhaṇḍam. n. a pebble, gravel View this entry on the original dictionary page scan.
cūrṇakṛtm. (for ṇi-k-?) Name of śaṃkarācārya- View this entry on the original dictionary page scan.
cūrṇakuntalam. a lock of hair View this entry on the original dictionary page scan.
cūtakam. the mango tree View this entry on the original dictionary page scan.
cūtakam. a small well (equals cūḍaka-) View this entry on the original dictionary page scan.
cyutakaSee akṣara-mātra--. View this entry on the original dictionary page scan.
cyutapathakam. "deviated from the path", Name of a pupil of śākyamuni-, View this entry on the original dictionary page scan.
dāḍakam. tooth, tusk (see dāḍhā-). View this entry on the original dictionary page scan.
dadhibhakṣam. food prepared from d/adhi- View this entry on the original dictionary page scan.
dadhibhakṣamfn. eating d- View this entry on the original dictionary page scan.
dadhīcakṣupasaṃvādam. dialogue between dadhīca- and kṣupa-saṃvāda- View this entry on the original dictionary page scan.
dadhimaṇḍodakamfn. idem or 'mfn. having whey as liquid (an ocean) ' View this entry on the original dictionary page scan.
dadhipṛṣātakaName of a mixture made with d/adhi- View this entry on the original dictionary page scan.
dadhipūpakam. Name of a cake made of d/adhi- View this entry on the original dictionary page scan.
dadhisaktum. plural barley-meal with d/adhi-, View this entry on the original dictionary page scan.
dadhivaktraSee -mukha-. View this entry on the original dictionary page scan.
dādhreyakam. a patronymic (also plural) View this entry on the original dictionary page scan.
dāḍimabhakṣaṇam. "liking and eating pomogranates", parrot View this entry on the original dictionary page scan.
dāḍimapattrakam. Soyimida Febrifuga or Amoora Rohitaka View this entry on the original dictionary page scan.
dagdhakākam. "inauspicious crow", a raven View this entry on the original dictionary page scan.
dagdhakilbiṣamfn. one whose sins are burnt away or destroyed, View this entry on the original dictionary page scan.
dagdhavarṇakaName of a grass View this entry on the original dictionary page scan.
dagdheṣṭakāf. a burnt brick View this entry on the original dictionary page scan.
dāhakamf(ī-)n. burning, setting on fire View this entry on the original dictionary page scan.
dāhakam. Plumbago Zeylanica. View this entry on the original dictionary page scan.
dāhakāṣṭhan. a kind of Agallochum used as a perfume View this entry on the original dictionary page scan.
dahanakarmann. the act of burning View this entry on the original dictionary page scan.
dahanaketanam. "mark of burning", smoke View this entry on the original dictionary page scan.
dahanopakaraṇan. the means for cauterising View this entry on the original dictionary page scan.
daharakamfn. short (day), View this entry on the original dictionary page scan.
dāhātmakamf(ikā-)n. of an inflammable nature, easily kindled or burning View this entry on the original dictionary page scan.
dainaṃdinadānakāṇḍamn. Name of work View this entry on the original dictionary page scan.
daityāntakam. " daitya-s. destroyer" View this entry on the original dictionary page scan.
daivacintakam. "reflecting on fate", astrologer, Name of śiva- View this entry on the original dictionary page scan.
daivacintakam. fatalist View this entry on the original dictionary page scan.
daivahatakamfn. idem or 'mfn. stricken by destiny, ill-fated ' : cursed by destiny View this entry on the original dictionary page scan.
daivahatakan. a blow of destiny, View this entry on the original dictionary page scan.
daivahatakan. cursed Destiny. , View this entry on the original dictionary page scan.
daivajñadīpakalikāf. Name of work View this entry on the original dictionary page scan.
daivajñajātakan. Name of work View this entry on the original dictionary page scan.
daivajñakalānidhim. Name of work View this entry on the original dictionary page scan.
daivakamf(ī-)n. (in fine compositi or 'at the end of a compound') equals daiva-, a deity (see sa--) View this entry on the original dictionary page scan.
daivakarmann. oblations to the gods, religious rite View this entry on the original dictionary page scan.
daivakīf. equals devakī-, the mother of kṛṣṇa- View this entry on the original dictionary page scan.
daivakīnandanam. Name of an author View this entry on the original dictionary page scan.
daivakīnandanam. varia lectio for devakī-n- View this entry on the original dictionary page scan.
daivakovidamfn. acquainted with the destinies of men View this entry on the original dictionary page scan.
daivakovidamf. (ā-) a fatalist, fortune-teller View this entry on the original dictionary page scan.
daivakṛtamfn. caused by divine power or nature, natural (opp. to,"artificial") View this entry on the original dictionary page scan.
daivakṣatrim. patronymic fr. deva-kṣatra- View this entry on the original dictionary page scan.
daivalakam. equals devalaka- View this entry on the original dictionary page scan.
daivalekhakam. fortune-teller, astrologer View this entry on the original dictionary page scan.
daivamānuṣakamfn. belonging to gods and men View this entry on the original dictionary page scan.
daivarājakamfn. made by deva-rāja- gaRa kalālādi- View this entry on the original dictionary page scan.
daivarakṣitamfn. (for 2.See 2. daiva-) guarded by the gods View this entry on the original dictionary page scan.
daivarakṣitam. patronymic deva-- ratha- (also plural) View this entry on the original dictionary page scan.
daivasakamf(ikā-)n. (fr. divasa-) happening in one day View this entry on the original dictionary page scan.
daivatakāṇḍan. Name of View this entry on the original dictionary page scan.
daivayātavakamf(ī-)n. inhabited by the daivayātava-s gaRa rājanyādi-. View this entry on the original dictionary page scan.
daivopahataka() mfn. struck by fate, ill-fated (see daiva-h-). View this entry on the original dictionary page scan.
dakan. equals ud-, water View this entry on the original dictionary page scan.
dakan. see dagārgala-. View this entry on the original dictionary page scan.
dakalāvaṇikamfn. prepared with water and salt View this entry on the original dictionary page scan.
akāram. the letter - View this entry on the original dictionary page scan.
dakāram. the letter or sound d-. View this entry on the original dictionary page scan.
dakarākṣasam. a water- rākṣasa- View this entry on the original dictionary page scan.
akkārīf. the cāṇḍāla- lute View this entry on the original dictionary page scan.
dakodaran. a dropsical belly (see udak-) View this entry on the original dictionary page scan.
dak cl.1 P. (imperative 2. plural d/akṣatā-) to act to the satisfaction of (dative case ) ; A1. d/akṣate- (parasmE-pada d/akṣamāṇa-; perfect tense dadakṣe-) to be able or strong, ; to grow, increase ; to act quickly ; to go, ; to hurt : Causal dakṣ/ayati- (Aorist adadakṣa-), to make able or strong View this entry on the original dictionary page scan.
dakṣamf(ā-)n. able, fit, adroit, expert, clever, dexterous, industrious, intelligent etc. View this entry on the original dictionary page scan.
dakṣamf(ā-)n. strong, heightening or strengthening the intellectual faculties (soma-), ix f. View this entry on the original dictionary page scan.
dakṣamf(ā-)n. passable (the Ganges) View this entry on the original dictionary page scan.
dakṣamf(ā-)n. suitable View this entry on the original dictionary page scan.
dakṣamf(ā-)n. right (opposed to left) View this entry on the original dictionary page scan.
dakṣam. ability, fitness, mental power, talent (see -krat/u-), strength of will, energy, disposition View this entry on the original dictionary page scan.
dakṣam. evil disposition View this entry on the original dictionary page scan.
dakṣam. a particular form of temple View this entry on the original dictionary page scan.
dakṣam. a general lover View this entry on the original dictionary page scan.
dakṣam. a cock View this entry on the original dictionary page scan.
dakṣam. Name of a plant View this entry on the original dictionary page scan.
dakṣam. fire View this entry on the original dictionary page scan.
dakṣam. śiva-'s bull View this entry on the original dictionary page scan.
dakṣam. Name of an āditya- (identified with prajā-pati- ;father of kṛttikā- ) View this entry on the original dictionary page scan.
dakṣam. Name of one of the prajā-pati-s ( etc. ;born from brahmā-'s right thumb etc.;or from a-ja-,"the unborn";or son of pra-cetas- or of the of 10 pra-cetasa-s, whence called prācetasa- ;father of 24 daughters by pra-sūti- etc.;of 50 [or 60 ;or 44 ] daughters of whom 27 become the Moon's wives, forming the lunar asterisms, and 13 [or 17 ;or 8 ]those of kaśyapa-, becoming by this latter the mothers of gods, demons, men, and animals, while 10 are married to dharma- etc.;celebrating a great sacrifice [hence dakṣa sy/ayana-,"Name of a sacrifice" ] to obtain a son, he omitted, with the disapproval of dadhīca-,to invite śiva-, who ordered vīra-bhadra- to spoil the sacrifice [identified with viṣṇu-] ,= ;named among the viśve-devā-s ; . [ ] etc.) View this entry on the original dictionary page scan.
dakṣam. Name of a son of garuḍa- View this entry on the original dictionary page scan.
dakṣam. of a man with the patronymic pārvati- View this entry on the original dictionary page scan.
dakṣam. of a law-giver etc. View this entry on the original dictionary page scan.
dakṣam. of a son of uśī-nara- View this entry on the original dictionary page scan.
dakṣam. of one of the 5 kānyakubja- Brahmans from whom the Bengal Brahmansare said to have sprung View this entry on the original dictionary page scan.
dakṣāf. the earth View this entry on the original dictionary page scan.
dakṣam. see a-tūta--, din/a--, samān/a- View this entry on the original dictionary page scan.
dakṣam. su-d/akṣa- View this entry on the original dictionary page scan.
dakṣam. mārga-dakṣaka- View this entry on the original dictionary page scan.
dakṣam. dākṣāy/an- View this entry on the original dictionary page scan.
dakṣam. ; Latin dex-ter ; Gothic taiksvs. View this entry on the original dictionary page scan.
dakṣādhvaram. equals kṣa-yajña- View this entry on the original dictionary page scan.
dakṣādhvaradhvaṃsakṛtm. idem or 'm. equals kṣa-yajña-prabhañana- ' View this entry on the original dictionary page scan.
dakṣādhvaradhvaṃsanam. idem or 'm. idem or 'm. equals kṣa-yajña-prabhañana- ' ' View this entry on the original dictionary page scan.
dakṣādhvaradhvansakam. equals kṣa-yajña-prabhañana- View this entry on the original dictionary page scan.
dakṣajāf. "daughter", durgā-
dakṣajāf. plural the Moon's wives View this entry on the original dictionary page scan.
dakṣajām. equals kṣātmajā-p- View this entry on the original dictionary page scan.
dakṣajāpatim. "lord of durgā-", śiva- View this entry on the original dictionary page scan.
dākṣakamfn. inhabited by the dākṣi-s (gaRa rājanyādi-) View this entry on the original dictionary page scan.
dākṣakan. a number of descendants of dakṣa- View this entry on the original dictionary page scan.
dakakanyāf. a daughter of View this entry on the original dictionary page scan.
dakakanyāf. durgā- View this entry on the original dictionary page scan.
dakakratum. du kr/ad/u-d/akṣau- View this entry on the original dictionary page scan.
dakakratumfn. able-minded View this entry on the original dictionary page scan.
dakṣamakhamathanari.,"destruction of dadhīca-'s sacrifice", Name of f. View this entry on the original dictionary page scan.
dakṣamathanam. "destroyer of dadhīca-", śiva- View this entry on the original dictionary page scan.
dakṣāṇḍan. a hen's egg View this entry on the original dictionary page scan.
dakṣaṇidhanan. Name of a sāman- View this entry on the original dictionary page scan.
dakṣanidhanan. equals nidh-. View this entry on the original dictionary page scan.
dakṣapatim. (d/akṣ-) lord of the faculties View this entry on the original dictionary page scan.
dakṣapatim. see 56, 2. View this entry on the original dictionary page scan.
dakṣapitṛ(d/akṣ-) m. "id."or,"having dadhīca- as father"(mitra- & varuṇa-, the gods etc.), vi-viii (dual number tarā- plural taras-) (plural tāras-) View this entry on the original dictionary page scan.
dakṣaputraSee -sāvarṇa-. View this entry on the original dictionary page scan.
dakṣārim. " dadhīca-'s foe", śiva-. View this entry on the original dictionary page scan.
dakṣasmfn. able, dexterous View this entry on the original dictionary page scan.
dakṣasmfn. . View this entry on the original dictionary page scan.
dakṣasādhanamfn. effective of cleverness View this entry on the original dictionary page scan.
dakṣaśāpam. "curse of dadhīca-", Name of View this entry on the original dictionary page scan.
dakṣasāvarṇam. Name of the 9th manu- ; -putra sāv- or simply -putra- View this entry on the original dictionary page scan.
dakṣasāvarṇim. idem or 'm. Name of the 9th manu- ; -putra sāv- or simply -putra- ' View this entry on the original dictionary page scan.
dakṣasmṛtif. Name of a law-book View this entry on the original dictionary page scan.
dakṣasthamf(ā-)n. being (on the right id est) south View this entry on the original dictionary page scan.
dakṣasutam. a son of dadhīca-, god (see -pitṛ-) View this entry on the original dictionary page scan.
dakṣasutāf. a daughter of dadhīca- View this entry on the original dictionary page scan.
dakṣasutaf. plural the Moon's wives View this entry on the original dictionary page scan.
dakṣat dakṣi- See dah-. View this entry on the original dictionary page scan.
dakṣatāf. dexterity, ability View this entry on the original dictionary page scan.
dakṣatāti(d/akṣ-) f. idem or 'f. dexterity, ability ' View this entry on the original dictionary page scan.
dakṣātmajāpatim. "lord of dadhīca-'s daughters", the Moon View this entry on the original dictionary page scan.
dakṣavihitāf. durgā- View this entry on the original dictionary page scan.
dakṣavihitāf. (scilicet gāthā-) a song composed by dadhīca- View this entry on the original dictionary page scan.
dakṣavṛdhmfn. rejoicing in cleverness View this entry on the original dictionary page scan.
dakṣayajñam. dakṣa-'s sacrifice View this entry on the original dictionary page scan.
dakṣayajñaprabhañjanam. "destroyer of dadhīca-'s sacrifice", śiva- View this entry on the original dictionary page scan.
dakṣayajñavidhvaṃsam. equals kṣa-makha-manthana- Name of View this entry on the original dictionary page scan.
dakṣayajñavidhvaṃsanan. Name of View this entry on the original dictionary page scan.
dakṣayajñavināśinīf. durgā- View this entry on the original dictionary page scan.
dākṣāyaṇabhaktan. district inhabited by dākṣa-s (gaRa aiṣukāryādi-). View this entry on the original dictionary page scan.
dakṣāyyamfn. to be satisfied by skill, . View this entry on the original dictionary page scan.
daksehiṇāvartamfn. turning (from the left) to the right (a conch-shell ; kuṇḍala- ;a fruit ;a woman's navel ) View this entry on the original dictionary page scan.
daksehiṇāvartamfn. moving in the southern course (the sun) View this entry on the original dictionary page scan.
daksehiṇāvartam. a conch-shell opening to the right View this entry on the original dictionary page scan.
dakṣeśvaraliṅgan. Name of a liṅga-, View this entry on the original dictionary page scan.
dakṣim. plural Name of a family View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. (also ṇ/a- ) (declined as a pronoun when denoting relative position ["right"or,"southern"] etc.; see ;but not necessarily in ablative and locative case sg. m. n.[ ṇe- ] and Nominal verb plural m.;except ) able, clever, dexterous (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. right (not left) etc. (ṇaṃ parī-,"to walk round a person with the right side towards him"; maṃkṛ-,"to place any one on the right side as a mark of respect", ) View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. south, southern (as being on the right side of a person looking eastward), situated to the south, turned or directed southward etc. View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. coming from south (wind) View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. (with āmnāya-) the southern sacred text (of the tāntrika-s), View this entry on the original dictionary page scan.
dakṣiṇamf(ā-)n. straightforward, candid, sincere, pleasing, compliant View this entry on the original dictionary page scan.
dakṣiṇam. the right (hand or arm) View this entry on the original dictionary page scan.
dakṣiṇam. the horse on the, right side of the pole of a carriage, View this entry on the original dictionary page scan.
dakṣiṇam. śiva- View this entry on the original dictionary page scan.
dakṣiṇam. or n. the south View this entry on the original dictionary page scan.
dakṣiṇan. the righthand or higher doctrine of the śākta-s View this entry on the original dictionary page scan.
dakṣiṇāf. (scilicet go-),"able to calve and give milk", a prolific cow, good milch-cow View this entry on the original dictionary page scan.
dakṣiṇāf. a fee or present to the officiating priest (consisting originally of a cow see ). etc. View this entry on the original dictionary page scan.
dakṣiṇāf. Donation to the priest (personified along with brahmaṇas-pati-, indra-, and soma-, ;authoress of ;wife of Sacrifice[ ],both being children of ruci- and ākūti-, ) View this entry on the original dictionary page scan.
dakṣiṇāf. reward View this entry on the original dictionary page scan.
dakṣiṇāf. (offered to the guru-) View this entry on the original dictionary page scan.
dakṣiṇāf. (ṇām ā-- diś-,"to thank"; Causal "to earn thanks", ) View this entry on the original dictionary page scan.
dakṣiṇāf. a gift, donation (see abhaya--, prāṇa--) View this entry on the original dictionary page scan.
dakṣiṇāf. (scilicet diś-) the south, Deccan View this entry on the original dictionary page scan.
dakṣiṇāf. a figure of durgā- having the right side prominent View this entry on the original dictionary page scan.
dakṣiṇāf. completion of any rite (pra-tiṣṭhā-) View this entry on the original dictionary page scan.
dakṣiṇāf. of ṇa- q.v View this entry on the original dictionary page scan.
dakṣiṇāind. (old. instrumental case) on the right or south () , on the right side of or southward from (ablative : ) (also d/akṣ-) View this entry on the original dictionary page scan.
dakṣiṇāf. View this entry on the original dictionary page scan.
dakṣiṇābandham. "bondage of ritual reward", one of the 3 states of bondage (in sāṃkhya- philosophy) View this entry on the original dictionary page scan.
dakṣiṇābdhim. the southern ocean (varia lectio for ṇāpatha-). View this entry on the original dictionary page scan.
dakṣiṇabhāgam. the southern hemisphere (ṇa bh-, ) View this entry on the original dictionary page scan.
dakṣiṇābhimukhamf(ā-)n. having the face turned southwards View this entry on the original dictionary page scan.
dakṣiṇābhimukhamf(ā-)n. flowing southwards View this entry on the original dictionary page scan.
dakṣiṇābhimukhasthitamfn. standing with the face southwards View this entry on the original dictionary page scan.
dakṣiṇācm(accusative ṇāñcam-)fn. southward View this entry on the original dictionary page scan.
dakṣiṇācalam. "southern mountain", the Malaya range View this entry on the original dictionary page scan.
dakṣiṇācāramfn. upright in conduct View this entry on the original dictionary page scan.
dakṣiṇācāramfn. equals rin- View this entry on the original dictionary page scan.
dakṣiṇācāratantran. Name of a Tantric work. View this entry on the original dictionary page scan.
dakṣiṇācārinmfn. worshipping śakti- according to the right-hand ritual View this entry on the original dictionary page scan.
dakṣiṇācaritantran. equals ra-t-. View this entry on the original dictionary page scan.
dakṣiṇadaghSee -s/ad-. View this entry on the original dictionary page scan.
dakṣiṇādeśanan. (ṇād-) thanksgiving View this entry on the original dictionary page scan.
dakṣiṇādeśanāf. View this entry on the original dictionary page scan.
dakṣiṇādhipatim. the lord of the Deccan View this entry on the original dictionary page scan.
dakṣiṇadhurīṇamfn. harnessed on the right side of the pole View this entry on the original dictionary page scan.
dakṣiṇādvāran. a door on the south View this entry on the original dictionary page scan.
dakṣiṇādvāramfn. having a door on the south View this entry on the original dictionary page scan.
dakṣiṇadvārikamfn. (an asterism) propitious to a military expedition to the south View this entry on the original dictionary page scan.
dakṣiṇādvātam. the south wind View this entry on the original dictionary page scan.
dakṣiṇāgavif. plural the cows given as a sacrificial fee View this entry on the original dictionary page scan.
dakṣiṇāgnim. the southern fire of the altar (= anvāhārya-p/acana-) View this entry on the original dictionary page scan.
dakṣiṇāgramfn. having the points turned to the south View this entry on the original dictionary page scan.
dakṣiṇāhiind. far to the right or in the south (of, ablative ), View this entry on the original dictionary page scan.
dakṣiṇaiḥind. instrumental case to the right [ confer, compare Lithuanian de4szine7 f."the right hand."] View this entry on the original dictionary page scan.
dakṣiṇajānvaknamfn. having the right knee bent View this entry on the original dictionary page scan.
dakṣiṇājyotis(d/akṣ-) mfn. brilliant by the sacrificial gift View this entry on the original dictionary page scan.
dakṣiṇākālam. the time of receiving the sacrificial fee View this entry on the original dictionary page scan.
dakṣiṇakālikāf. a form of durgā- worshipped by the tāntrika-s View this entry on the original dictionary page scan.
dakṣiṇakālīmāhātmyan. Name of work View this entry on the original dictionary page scan.
dakṣiṇākapardaSee ṇat/as-k-. View this entry on the original dictionary page scan.
dakṣiṇalipif. the southern way of writing View this entry on the original dictionary page scan.
dakṣiṇālipi varia lectio for ṇa-l-. View this entry on the original dictionary page scan.
dakṣiṇam(am-) ind. to the right View this entry on the original dictionary page scan.
dakṣiṇamānasan. Name of a tīrtha- near Benares. View this entry on the original dictionary page scan.
dakṣiṇamārgam. the southern course (of a planet), . View this entry on the original dictionary page scan.
dakṣiṇāmukhamf(ī-)n. standing with the face to the right or south View this entry on the original dictionary page scan.
dakṣiṇāmūrtim. a Tantric form of śiva- View this entry on the original dictionary page scan.
dakṣiṇāmūrtim. Name of a copyist of the 17th cent. View this entry on the original dictionary page scan.
dakṣiṇāmūrtimantram. Name of View this entry on the original dictionary page scan.
dakṣiṇāmūrtiprayogam. Name of a chapter of View this entry on the original dictionary page scan.
dakṣiṇāmūrtisaṃhitāf. Name of work View this entry on the original dictionary page scan.
dakṣiṇāmūrtistava m. 10 verses ascribed to śaṃkara- (explained by viśva-rūpa- or sureśvara- in a commentary with gloss by rāma-tīrtha-) View this entry on the original dictionary page scan.
dakṣiṇāmūrtistotran. 10 verses ascribed to śaṃkara- (explained by viśva-rūpa- or sureśvara- in a commentary with gloss by rāma-tīrtha-) View this entry on the original dictionary page scan.
dakṣiṇāmūrtyupaniṣadf. Name of an View this entry on the original dictionary page scan.
dakṣiṇāntikāf. Name of a metre. View this entry on the original dictionary page scan.
dakṣiṇānyāyamfn. equals ṇato-ny- View this entry on the original dictionary page scan.
dakṣiṇāpadamf(ī-)n. having the feet towards the south, View this entry on the original dictionary page scan.
dakṣiṇapañcālamfn. belonging or relating to the southern pañcāla-s (realm) View this entry on the original dictionary page scan.
dakṣiṇapāñcālakamfn. equals -pañcāla- View this entry on the original dictionary page scan.
dakṣiṇāparamf(ā-)n. southwestern View this entry on the original dictionary page scan.
dakṣiṇāparābhimukhamfn. turned to the south-west View this entry on the original dictionary page scan.
dakṣiṇapaścārdham. ( Va1rtt. 3 ) the south-western side View this entry on the original dictionary page scan.
dakṣiṇapaścātind. ( Va1rtt. 2 ) south-west from (genitive case) View this entry on the original dictionary page scan.
dakṣiṇapaścimamf(ā-)n. southwestern View this entry on the original dictionary page scan.
dakṣiṇāpatham. path of the dakṣiṇā- cow, (between the śālā- and the sadas-) View this entry on the original dictionary page scan.
dakṣiṇāpaṭham. (ṇa-saṃcara- ) the southern region, Deccan : View this entry on the original dictionary page scan.
dakṣiṇāpaṭham. See ṇābdhi-. View this entry on the original dictionary page scan.
dākṣiṇāpathakamf(ī-)n. relating to dakṣiṇā-patha- (gaRa dhūmādi-). View this entry on the original dictionary page scan.
dakṣiṇāpathikamfn. belonging to the Deccan View this entry on the original dictionary page scan.
dakṣiṇāpavargamfn. terminating in the south View this entry on the original dictionary page scan.
dakṣiṇaprācīf. equals -pūrvā- View this entry on the original dictionary page scan.
dakṣiṇāprāgagramfn. having the points turned to the south-east View this entry on the original dictionary page scan.
dakṣiṇāpraharaṇa(ṇ/ā--) mfn. hurled to the right View this entry on the original dictionary page scan.
dakṣiṇaprākpravaṇamfn. sloping south-eastwards View this entry on the original dictionary page scan.
dakṣiṇāprañcmfn. directed towards the south-east, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
dakṣiṇāpraṣṭim. the horse harnessed on the right side of the yoke-horses View this entry on the original dictionary page scan.
dakṣiṇāpratīcīf. south-west View this entry on the original dictionary page scan.
dakṣiṇāpratīcīf. (with diś-) View this entry on the original dictionary page scan.
dakṣiṇāpratigraham. Name (also title or epithet) of particular mantra-s, View this entry on the original dictionary page scan.
dakṣiṇāpratyacmf(tīcī-)n. "south-western" View this entry on the original dictionary page scan.
dakṣiṇāpratyagapavargamfn. terminating in the south-west View this entry on the original dictionary page scan.
dakṣiṇāpratyakind. south-westwards, 1 View this entry on the original dictionary page scan.
dakṣiṇāpratyakpravaṇamfn. sloping south-westwards View this entry on the original dictionary page scan.
dakṣiṇāpravaṇamfn. sloping down southwards, View this entry on the original dictionary page scan.
dakṣiṇāpravaṇa(ṇ/ā-) mf(ā-)n. sloping southwards View this entry on the original dictionary page scan.
dakṣiṇapūrvamf(ā-)n. ( ) south-eastern View this entry on the original dictionary page scan.
dakṣiṇapūrvāf. (scilicet diś-) the south-east View this entry on the original dictionary page scan.
dakṣiṇapūrvakamfn. equals rva- View this entry on the original dictionary page scan.
dakṣiṇapūrvārdham. the south-eastern side, View this entry on the original dictionary page scan.
dakṣiṇapūrvāyatamf(ā-)n. extending south-eastward View this entry on the original dictionary page scan.
dakṣiṇapūrveṇaind. instrumental case south-east from (accusative), View this entry on the original dictionary page scan.
dakṣiṇarāḍhāf. southern rāḍhā- (in Bengal) View this entry on the original dictionary page scan.
dakṣiṇāranyan. "southern forest", Name of a forest View this entry on the original dictionary page scan.
dakṣiṇārdham. the right or southern side View this entry on the original dictionary page scan.
dakṣiṇārdhāparārdham. equals ṇa-pascardha- View this entry on the original dictionary page scan.
dakṣiṇārdhapaścārdham. equals ṇa-p- View this entry on the original dictionary page scan.
dakṣiṇārdhapūruvārdham. equals ṇa-p-, View this entry on the original dictionary page scan.
dakṣiṇārdhyamfn. being on the right or southern side View this entry on the original dictionary page scan.
dakṣiṇārdhyapūrvārdhyamfn. being on the south-western side View this entry on the original dictionary page scan.
dakṣiṇārha(ṇā-) mfn. deserving the sacrificial fee View this entry on the original dictionary page scan.
dakṣiṇārusmfn. wounded on the right side View this entry on the original dictionary page scan.
dakṣiṇāśāf. "southern quarter" View this entry on the original dictionary page scan.
dakṣiṇasadmfn. sitting on the right or southern side View this entry on the original dictionary page scan.
dakṣiṇasadmfn. (ṇā-s-) ix, 35 View this entry on the original dictionary page scan.
dakṣiṇasadmfn. (ṇa-dhak- Nominal verb fr. -dogh- ) View this entry on the original dictionary page scan.
dakṣiṇāsadSee ṇa-s-. View this entry on the original dictionary page scan.
dakṣiṇāsaṃcaram. See -patha-. View this entry on the original dictionary page scan.
dakṣiṇāśāpatim. "lord of dakṣiṇa-", yama- View this entry on the original dictionary page scan.
dakṣiṇāśāratif. "delight of dakṣiṇa-", canopy View this entry on the original dictionary page scan.
dakṣiṇasavyamfn. dual number right and left View this entry on the original dictionary page scan.
dakṣiṇāśrasmfn. having the head southwards View this entry on the original dictionary page scan.
dakṣiṇāśroṇif. the right buttock View this entry on the original dictionary page scan.
dakṣiṇastham. "standing on the right of his master", a charioteer View this entry on the original dictionary page scan.
dakṣiṇātind. ablative from or on the right side View this entry on the original dictionary page scan.
dakṣiṇātind. from the south, southward View this entry on the original dictionary page scan.
dakṣiṇātSee ṇa-. View this entry on the original dictionary page scan.
dakṣiṇataḥsadmfn. ṇa-s- View this entry on the original dictionary page scan.
dakṣiṇatasind. () from the right or south, on the right side or southward from (genitive case) etc. (with as-or bhū-,"to stand at the right side of. assist", ;with kṛ- equals ṇena-with kṛ- ;with pur/astāt-or ras-,south-east )
dakṣiṇataskapardamfn. wearing the braid on the right side of the head View this entry on the original dictionary page scan.
dakṣiṇataskapardamfn. (ṇā-k- ) View this entry on the original dictionary page scan.
dakṣiṇataupacāramfn. having the entrance on the south View this entry on the original dictionary page scan.
dakṣiṇataupavītinmfn. wearing the sacred thread on the right, iii, 17, 11 View this entry on the original dictionary page scan.
dakṣiṇātinayana(ṇāt-) m. the mantra- with which the dakṣiṇā- cows are driven southwards View this entry on the original dictionary page scan.
dakṣiṇatonyāyamfn. where the southern direction is the rule View this entry on the original dictionary page scan.
dakṣiṇatrāind. on the right side View this entry on the original dictionary page scan.
dakṣiṇātsadmfn. sitting to the south View this entry on the original dictionary page scan.
dakṣiṇatvan. uprightness, honesty View this entry on the original dictionary page scan.
dakṣiṇātvan. the state of the sacrificial gift View this entry on the original dictionary page scan.
dākṣiṇātyakamf(tyikā-)n. dākṣiṇātya
dakṣiṇāvacaramfn. (an embryo) moving in the right part (of the womb) View this entry on the original dictionary page scan.
dakṣiṇāvahmf(Nominal verb -v/āṭ-)n. being borne to the right of the fire (the ladle) View this entry on the original dictionary page scan.
dakṣiṇāvarjamind. with the exception of the sacrificial gift, View this entry on the original dictionary page scan.
dakṣiṇāvartakamf(ikā-)n. turned to the right or southwards
dakṣiṇāvartakīf. Tragia involucrata View this entry on the original dictionary page scan.
dakṣiṇāvatmfn. (d/akṣ-) giving sacrificial presents (indra-, ) View this entry on the original dictionary page scan.
dakṣiṇāvatmfn. abounding in sacrificial re-wards (sacrifice) View this entry on the original dictionary page scan.
dakṣiṇāvrittamfn. twisted from the left to the right View this entry on the original dictionary page scan.
dakṣiṇāvṛtmfn. turning or going round to the right, (the ladle) View this entry on the original dictionary page scan.
dakṣiṇāyanan. "southward way", way to yama-'s quarter View this entry on the original dictionary page scan.
dakṣiṇāyanan. "sun's progress south of the equator", the winter half-year View this entry on the original dictionary page scan.
dakṣiṇāyanamfn. situated in the sun's winter course (as an asterism) View this entry on the original dictionary page scan.
dakṣiṇāyugyam. the right yoke-horse View this entry on the original dictionary page scan.
dakṣiṇeind. locative case on the right side View this entry on the original dictionary page scan.
dakṣiṇenaind. instrumental case on the right or south (), on the right side of or southward from (accusative; ) etc. (with kṛ-,to place or leave on the right ) View this entry on the original dictionary page scan.
dakṣiṇermamfn. broken on the right side (a cart) View this entry on the original dictionary page scan.
dakṣiṇermanmfn. (1 26) equals ṇālrus- View this entry on the original dictionary page scan.
dakṣiṇetaramfn. "other than right", left View this entry on the original dictionary page scan.
dakṣiṇetif. (equals ṇāyana-) the sun's progress south of the equator View this entry on the original dictionary page scan.
dakṣiṇīkṛ equals ṇena- with kṛ- to give anything (accusative) as a sacrificial fee View this entry on the original dictionary page scan.
dakṣiṇitind. with the right hand View this entry on the original dictionary page scan.
dakṣiṇitind. see pra--. View this entry on the original dictionary page scan.
dakṣiṇīyamfn. () equals ṇy/a- View this entry on the original dictionary page scan.
dakṣiṇīyamfn. venerable View this entry on the original dictionary page scan.
dakṣiṇīyamfn. see a--. View this entry on the original dictionary page scan.
dakṣiṇodagdvāramf(ā-)n. having doors north and south View this entry on the original dictionary page scan.
dakṣiṇopakramamfn. beginning on the right, View this entry on the original dictionary page scan.
dakṣiṇottānamfn. having the right hand turned upwards View this entry on the original dictionary page scan.
dakṣiṇottānamfn. (the hands) of which the right is turned upwards View this entry on the original dictionary page scan.
dakṣiṇottaramf(ā-)n. having the right lying on the other (the two hands) View this entry on the original dictionary page scan.
dakṣiṇottaramf(ā-)n. right and left View this entry on the original dictionary page scan.
dakṣiṇottaramf(ā-)n. southern and northern View this entry on the original dictionary page scan.
dakṣiṇottaramf(ā-)n. (in compound) View this entry on the original dictionary page scan.
dakṣiṇottarāyāmamfn. idem or 'mf(ā-)n. extending from south to north, north; 875/876; 903a/b; 9, 141 3/5' View this entry on the original dictionary page scan.
dakṣiṇottarāyatamf(ā-)n. extending from south to north, north; 875/876; 903a/b; 9, 141 3/5 View this entry on the original dictionary page scan.
dakṣiṇottarinmfn. overhanging on the right side View this entry on the original dictionary page scan.
dakṣiṇyamfn. () worthy of the sacrificial fee, fit for a sacrificial gift View this entry on the original dictionary page scan.
dakṣiṇyamfn. see a--. View this entry on the original dictionary page scan.
dakṣumfn. burning, blazing View this entry on the original dictionary page scan.
dakṣusmfn. burning, blazing View this entry on the original dictionary page scan.
dalāḍhakam. Pistia Stratiotes, Jasminum multiflorum or pubescens, wild sesamum, Mesua ferrea, Acacia Sirissa View this entry on the original dictionary page scan.
dalāḍhakam. red chalk View this entry on the original dictionary page scan.
dalāḍhakam. foam or sea-foam View this entry on the original dictionary page scan.
dalāḍhakam. a ditch View this entry on the original dictionary page scan.
dalāḍhakam. the head of a village View this entry on the original dictionary page scan.
dalāḍhakam. an elephant's ear View this entry on the original dictionary page scan.
dalāḍhakam. a hurricane View this entry on the original dictionary page scan.
dālakaSee rajju-- View this entry on the original dictionary page scan.
ḍalakaSee ḍall- View this entry on the original dictionary page scan.
dalakapāṭam. a folded petal or leaf. View this entry on the original dictionary page scan.
dālakim. Name of a preceptor View this entry on the original dictionary page scan.
dalakomalathe lotus View this entry on the original dictionary page scan.
dalakośam. a kind of jasmine View this entry on the original dictionary page scan.
dalamodakam. petal-honey View this entry on the original dictionary page scan.
dalavīṭakan. Name of an ear-ornament View this entry on the original dictionary page scan.
dālbhyakam. Name of an ancient sage View this entry on the original dictionary page scan.
ḍallakan. a dūlī- carried on men's shoulders by means of a stick and ropes like the beam and strings of a balance (also ḍalaka- ) View this entry on the original dictionary page scan.
ḍallakam. Name of a man View this entry on the original dictionary page scan.
damakamfn. ( ) in fine compositi or 'at the end of a compound' taming, a tamer View this entry on the original dictionary page scan.
dāmakaṇṭham. "having a rope round neck", Name of a man View this entry on the original dictionary page scan.
dāmakaṇṭham. plural his descendants (gaRa upakādi-). View this entry on the original dictionary page scan.
damakartṛm. a ruler View this entry on the original dictionary page scan.
damanakam. Artemisia indica View this entry on the original dictionary page scan.
damanakam. Name of a man View this entry on the original dictionary page scan.
damanakam. of a jackal View this entry on the original dictionary page scan.
damanakam. (n.?) Name of a metre of 4 times 6 short syllables View this entry on the original dictionary page scan.
damanakam. of another of 4 lines of 10 short syllables and one long each. View this entry on the original dictionary page scan.
dambhakamfn. in fine compositi or 'at the end of a compound' deceiving View this entry on the original dictionary page scan.
daṃśakamfn. "biting" See dṛḍha--, mṛga-- View this entry on the original dictionary page scan.
daṃśakam. "a tooth" See puru-- View this entry on the original dictionary page scan.
daṃśakam. a gad-fly View this entry on the original dictionary page scan.
daṃśakam. a common fly View this entry on the original dictionary page scan.
daṃśakam. Name of a prince of kampana- View this entry on the original dictionary page scan.
daṃśamaśakan. sg. gad-flies and gnats View this entry on the original dictionary page scan.
daṃśamaśakan. (in compound) and View this entry on the original dictionary page scan.
dānadharmakathanan. Name of work on alms-giving. View this entry on the original dictionary page scan.
dānadinakaram. Name of work View this entry on the original dictionary page scan.
dānakan. a paltry gift View this entry on the original dictionary page scan.
dānakāf. a particular coin = 4 paṇa- Scholiast or Commentator View this entry on the original dictionary page scan.
dānakāf. Name of a drama. View this entry on the original dictionary page scan.
dānakalpatarum. Name of work View this entry on the original dictionary page scan.
dānakāma(d/ā-) mfn. fond of giving, liberal View this entry on the original dictionary page scan.
dānakamalākaram. Name of work View this entry on the original dictionary page scan.
dānakaumudīf. Name of work View this entry on the original dictionary page scan.
dānakaustubhamn. Name of work View this entry on the original dictionary page scan.
dānakelikaumudīf. Name of work View this entry on the original dictionary page scan.
dānakhaṇḍan. Name of part 1 of hemādri-'s work View this entry on the original dictionary page scan.
dānakriyākaumudīf. Name of work View this entry on the original dictionary page scan.
dānakusumāñjalim. Name of work View this entry on the original dictionary page scan.
dānapaṭṭakan. a deed of donation, View this entry on the original dictionary page scan.
dānaprakaraṇan. Name of work View this entry on the original dictionary page scan.
dānaprakāśam. Name of work View this entry on the original dictionary page scan.
daṇḍacakran. equals -sthāna- View this entry on the original dictionary page scan.
daṇḍacakran. Name of a mythical weapon View this entry on the original dictionary page scan.
daṇḍaḍhakf. Name of a drum or gong on which the hours are struck View this entry on the original dictionary page scan.
daṇḍadhārakamfn. "rod-bearer", administering justice View this entry on the original dictionary page scan.
daṇḍakam. Name of a bhoja- (varia lectio kya-). View this entry on the original dictionary page scan.
daṇḍakam. (gaRa ṛśyādi-) (n. gaRa ardharcādi-) in fine compositi or 'at the end of a compound' "a staff" See tri-- View this entry on the original dictionary page scan.
daṇḍakam. a handle (of a parasol) View this entry on the original dictionary page scan.
daṇḍakam. the beam (of a plough) View this entry on the original dictionary page scan.
daṇḍakam. the staff of a banner View this entry on the original dictionary page scan.
daṇḍakam. ( ) Name of a plant View this entry on the original dictionary page scan.
daṇḍakam. a row, line View this entry on the original dictionary page scan.
daṇḍakam. a class of metres the stanzas of which may extend from 4 x 27 to 4X 999 syllables View this entry on the original dictionary page scan.
daṇḍakam. a kind of spasm View this entry on the original dictionary page scan.
daṇḍakam. (ḍākhya-) 171/172 View this entry on the original dictionary page scan.
daṇḍakam. Name of work relating to View this entry on the original dictionary page scan.
daṇḍakam. Name of a son of ikṣvāku- (whose country was laid waste by the curse of bhārgava-, whose daughter he had violated;his kingdom in consequence became the raṇya-) xii (allusion only) (varia lectio dāṇḍakya-) View this entry on the original dictionary page scan.
daṇḍakam. ṇḍa- View this entry on the original dictionary page scan.
daṇḍakam. Name of a silly man View this entry on the original dictionary page scan.
daṇḍakam. of an asura- View this entry on the original dictionary page scan.
daṇḍakam. plural the inhabitants of raṇya- View this entry on the original dictionary page scan.
daṇḍakan. equals raṇya- (plural) View this entry on the original dictionary page scan.
daṇḍakāf. idem or 'n. equals raṇya- (plural)' xiii (colophon) View this entry on the original dictionary page scan.
daṇḍakākafor dagdha-k- View this entry on the original dictionary page scan.
daṇḍakalan. Name of a metre. View this entry on the original dictionary page scan.
daṇḍakālasakam. a kind of dysentery View this entry on the original dictionary page scan.
daṇḍakalitavatind. like one driven by a stick View this entry on the original dictionary page scan.
daṇḍakamaṇḍalum. a jar with a handle View this entry on the original dictionary page scan.
daṇḍakamaṇḍalum. . View this entry on the original dictionary page scan.
daṇḍakandakam. Name of a bulb View this entry on the original dictionary page scan.
daṇḍakapālinmfn. carrying a staff and a skull View this entry on the original dictionary page scan.
daṇḍakāraṇyan. the daṇḍaka- forest in the Deccan View this entry on the original dictionary page scan.
daṇḍakāraṇyaprasthānan. Name of View this entry on the original dictionary page scan.
daṇḍakarmann. punishment View this entry on the original dictionary page scan.
daṇḍakartṛm. a punisher. View this entry on the original dictionary page scan.
daṇḍakāsanan. lying prostrate on the ground View this entry on the original dictionary page scan.
daṇḍakāṣṭhan. a wooden staff View this entry on the original dictionary page scan.
daṇḍakāvanan. equals raṇya- View this entry on the original dictionary page scan.
daṇḍaketum. Name of a man View this entry on the original dictionary page scan.
dāṇḍakim. patronymic fr. daṇḍaka- View this entry on the original dictionary page scan.
dāṇḍakim. plural Name of a tribe belonging to the tri-garta-s View this entry on the original dictionary page scan.
dāṇḍakīyam. a prince of the dāṇḍaki-s View this entry on the original dictionary page scan.
daṇḍakūlam. plural Name of a people View this entry on the original dictionary page scan.
daṇḍakuśa m. plural Name of a people View this entry on the original dictionary page scan.
dāṇḍakyam. Name of a prince (varia lectio daka-). View this entry on the original dictionary page scan.
daṇḍanāyakam. "rod-applier", a judge View this entry on the original dictionary page scan.
daṇḍanāyakam. equals -mukha- View this entry on the original dictionary page scan.
daṇḍanāyakam. Name of an attendant of the Sun View this entry on the original dictionary page scan.
daṇḍanāyakapuruṣam. a policeman View this entry on the original dictionary page scan.
daṇḍapakakam. Name of a position of the hands, View this entry on the original dictionary page scan.
daṇḍapālakam. superintendent of punishment or judicature See pṛthivī-- View this entry on the original dictionary page scan.
daṇḍapālakam. a door-keeper View this entry on the original dictionary page scan.
daṇḍapālakam. Name of a fish View this entry on the original dictionary page scan.
daṇḍapāśakam. "holding a noose to catch offenders", a policeman
daṇḍāpatānakam. tetanus View this entry on the original dictionary page scan.
daṇḍapiṅgalakam. plural Name of a people to the north of madhya-deśa- View this entry on the original dictionary page scan.
daṇḍāraka in fine compositi or 'at the end of a compound' the pole of a well (or ḍāraka-,"stick and spokes of a water-wheel"?) View this entry on the original dictionary page scan.
daṇḍavṛkṣakam. Tithymalus antiquorum View this entry on the original dictionary page scan.
dāṇḍāyanasthalakamf(ī-)n. relating to sthalī- (gaRa dhūmādi-). View this entry on the original dictionary page scan.
dantabījakam. equals ja- View this entry on the original dictionary page scan.
dantadhāvanakam. Name of a tree View this entry on the original dictionary page scan.
dantadhāvanaprakaraṇan. Name of View this entry on the original dictionary page scan.
dantaghāṭakam. equals -kāra- () . View this entry on the original dictionary page scan.
dantaharṣakam. equals -karṣaṇa- View this entry on the original dictionary page scan.
dāntaka mf(ī-)n. idem or 'mf(ī-)n. (fr. danta-) made of ivory ' View this entry on the original dictionary page scan.
dantaka in fine compositi or 'at the end of a compound' "a tooth" See a--, kṛmi--, śyāva-- View this entry on the original dictionary page scan.
dantakam. a projection in a rock View this entry on the original dictionary page scan.
dantakam. "a pin projecting from a wall" See nāga-- View this entry on the original dictionary page scan.
dantakamfn. paying attention to one's teeth View this entry on the original dictionary page scan.
dantakāram. an ivory worker View this entry on the original dictionary page scan.
dantakarṣaṇam. "teeth-injuring", the lime View this entry on the original dictionary page scan.
dantakaśam. the tusk of an elephant compared to a flower-cup, View this entry on the original dictionary page scan.
dantakāṣṭhan. a small piece of the wood (of particular trees) used for cleaning the teeth View this entry on the original dictionary page scan.
dantakāṣṭhan. cleaning the teeth with the danta-kāṣṭha-, 4996 View this entry on the original dictionary page scan.
dantakāṣṭham. Name of various trees the wood of which is used for cleaning the teeth (Flacourtia sapida ;Asclepias gigantea, Ficus indica, Acacia Catech, Pongamia glabra, Terminalia alata) View this entry on the original dictionary page scan.
dantakāṣṭhābhakṣaṇan. "omitting to use the d- ", Name of View this entry on the original dictionary page scan.
dantakāṣṭhakam. N. Tabernaemontana coronaria View this entry on the original dictionary page scan.
dantakrūram. Name of a prince, . View this entry on the original dictionary page scan.
dantakumāram. of a man. View this entry on the original dictionary page scan.
dantakūraName of a place View this entry on the original dictionary page scan.
dantalekhakam. one who lives by painting the teeth on View this entry on the original dictionary page scan.
dantapattrakan. a kind of jasmine (its petals being compared to the teeth) View this entry on the original dictionary page scan.
dantaprakṣālanan. equals -dhāva- View this entry on the original dictionary page scan.
dantaprakṣālanapavanam. View this entry on the original dictionary page scan.
dantapuppuṭakam. View this entry on the original dictionary page scan.
dantauṣṭhakamfn. paying attention to one's teeth and lips View this entry on the original dictionary page scan.
dantavakram. Name of a karūṣa- prince (also called vakradanta-and vakra-;described as a dānava- or asura-) View this entry on the original dictionary page scan.
dantavaktrafor -vakra-. View this entry on the original dictionary page scan.
dantaveṣṭakam. idem or 'n. the gums (dual number"the gums of the upper and lower jaw") (of an elephant) , tumour of the gums, ' , 11 View this entry on the original dictionary page scan.
dantaveṣṭakam. dual number the gums of the upper and lower, jaw View this entry on the original dictionary page scan.
dantivaktram. "elephant-faced", gaṇeśa-, . View this entry on the original dictionary page scan.
dantoṣṭhakafor tauṣṭh-, View this entry on the original dictionary page scan.
danturakamfn. having prominent teeth View this entry on the original dictionary page scan.
danturakam. plural Name of a people (east of madhya-deśa-), View this entry on the original dictionary page scan.
dapharakhānam. Zaphar Khan (Sultan), View this entry on the original dictionary page scan.
dārakamf(ikā-)n. breaking, tearing, splitting (see loha--and śatru--) View this entry on the original dictionary page scan.
dārakam. a hog View this entry on the original dictionary page scan.
dārakam. Name of kṛṣṇa-'s charioteer (see dāruka-) View this entry on the original dictionary page scan.
dārakam. (rather connected with 2. dāra-than with dṛ-) a boy, son, child View this entry on the original dictionary page scan.
dārakam. young animal View this entry on the original dictionary page scan.
dārakam. dual number (akau-) a boy and girl View this entry on the original dictionary page scan.
darakamfn. timid, aftaid, View this entry on the original dictionary page scan.
dārakācāryam. "boy-preceptor", schoolmaster View this entry on the original dictionary page scan.
darakaṇṭikāf. "little-thorn", Asparagus racemosa View this entry on the original dictionary page scan.
darakaram. "hole-maker", a staff View this entry on the original dictionary page scan.
dārakarmann. taking a wife, marrying
dārakriyāf. idem or 'n. taking a wife, marrying ' View this entry on the original dictionary page scan.
dāralakṣaṇan. sign of wifehood View this entry on the original dictionary page scan.
dārarakṣitakamfn. relating to the protection of women. View this entry on the original dictionary page scan.
darbhakam. Name of a prince View this entry on the original dictionary page scan.
darbhakuṇḍikāf. a jar with d- View this entry on the original dictionary page scan.
darbhakusumaName of an insect View this entry on the original dictionary page scan.
darbhataruṇakan. a young shoot of d- View this entry on the original dictionary page scan.
dārduraka mf(ikā-)n. belonging to a frog View this entry on the original dictionary page scan.
dardurakam. Name of a gamester View this entry on the original dictionary page scan.
daridrāyakamfn. poor View this entry on the original dictionary page scan.
darpakamfn. in fine compositi or 'at the end of a compound' making proud View this entry on the original dictionary page scan.
darpakam. pride, 511 View this entry on the original dictionary page scan.
darpakam. the god of love View this entry on the original dictionary page scan.
darpaṇakāram. the author of View this entry on the original dictionary page scan.
darpapattrakaName of a grass View this entry on the original dictionary page scan.
darśakamfn. seeing (with genitive case) View this entry on the original dictionary page scan.
darśakamfn. looking at (accusative) View this entry on the original dictionary page scan.
darśakamfn. in fine compositi or 'at the end of a compound' looking for, View this entry on the original dictionary page scan.
darśakamfn. "examining" See akṣa-- View this entry on the original dictionary page scan.
darśakamfn. showing, pointing out (with genitive case ; in fine compositi or 'at the end of a compound' ;with lohitasya-,making blood appear by striking any one) View this entry on the original dictionary page scan.
darśakam. a door-keeper View this entry on the original dictionary page scan.
darśakam. a skilful man View this entry on the original dictionary page scan.
darśakam. Name of a prince View this entry on the original dictionary page scan.
darśakam. plural Name of a people View this entry on the original dictionary page scan.
darśanakāṅkṣinmfn. longing for the sight of (compound), View this entry on the original dictionary page scan.
dāruhastakam. a wooden spoon or ladle View this entry on the original dictionary page scan.
dārukacchakamfn. relating to it View this entry on the original dictionary page scan.
dāruṇādhyāpakam. an indefatigable teacher View this entry on the original dictionary page scan.
dāruṇakan. Name of a disease of the roots of the hair View this entry on the original dictionary page scan.
dāruṇakarmann. violent treatment (of diseases) View this entry on the original dictionary page scan.
dāruphalakan. window-shutter View this entry on the original dictionary page scan.
dārvakamf(ikā-)n. relating to the dārva-s View this entry on the original dictionary page scan.
daryakam. Name of a man View this entry on the original dictionary page scan.
daśabalakāśyapam. Name of one of the first 5 pupils of śākya-muni- View this entry on the original dictionary page scan.
daśabandhaka in fine compositi or 'at the end of a compound' equals dha- View this entry on the original dictionary page scan.
daśadṛṣṭāntakathāf. Name of work View this entry on the original dictionary page scan.
dāśakam. fisherman (?), Name of a son of bhajamāna- View this entry on the original dictionary page scan.
dāsakam. Name of a man (see dāś-) gaRa aśvādi- View this entry on the original dictionary page scan.
daśakamfn. consisting of 10, having 10 parts View this entry on the original dictionary page scan.
daśakamfn. (with śata-) 10 per cent. View this entry on the original dictionary page scan.
daśakam. one in a decad of chs. (of the sāma-tantra-) View this entry on the original dictionary page scan.
daśakan. a decad View this entry on the original dictionary page scan.
daśakakṣya(d/asu-) mfn. having 10 girths View this entry on the original dictionary page scan.
daśakāmajavyasanan. the 10 vices arising from love of pleasure (See ) . View this entry on the original dictionary page scan.
daśakamāsikamfn. hired for 10 months Va1rtt. 4 View this entry on the original dictionary page scan.
daśakandharam. equals -kaṇṭha- View this entry on the original dictionary page scan.
dāśakaṇṭhamf(ī-)n. belonging to daśakaṇṭha-, id est rāvaṇa- View this entry on the original dictionary page scan.
daśakaṇṭham. (paroxytone ),"ten-necked", rāvaṇa- View this entry on the original dictionary page scan.
daśakaṇṭhajitm. "enemy of rāvaṇa-", rāma- View this entry on the original dictionary page scan.
daśakaṇṭhanigraham. Name of View this entry on the original dictionary page scan.
daśakaṇṭhārim. equals ṭha-jit- View this entry on the original dictionary page scan.
daśakaṇṭhāyaNom., yate-, to act like rāvaṇa- View this entry on the original dictionary page scan.
daśakanyātīrthan. the tīrtha- of the 10 Virgins View this entry on the original dictionary page scan.
dāśakaputram. the son of a fisherman Scholiast or Commentator on ( dāmaka--). View this entry on the original dictionary page scan.
dāsakarmakaram. a servant doing his work View this entry on the original dictionary page scan.
daśakarmapaddhatif. Name of work on the 10 ceremonies prescribed to the 3 twice-born classes. View this entry on the original dictionary page scan.
dāsakāyanam. patronymic fr. dāsaka- View this entry on the original dictionary page scan.
dāsaketum. Name of a son of manu- dakṣasāvarṇa- View this entry on the original dictionary page scan.
daśakṣīramfn. mixed with 10 parts of milk View this entry on the original dictionary page scan.
daśakṣīran. a compound of 10 parts of milk with 1 part of milk with 1 part of some other substance, iv, 22, 14 View this entry on the original dictionary page scan.
daśakṣīran. (kṣīra daśa-guṇa-,16) . View this entry on the original dictionary page scan.
daśakṣitigarbham. Name of a Buddhist sūtra-. View this entry on the original dictionary page scan.
daśakumāracarita n. "adventures of the 10 princes", Name of work by daṇḍin-. View this entry on the original dictionary page scan.
daśakumāracaritran. "adventures of the 10 princes", Name of work by daṇḍin-. View this entry on the original dictionary page scan.
daśalakṣaṇan. 10 marks or attributes View this entry on the original dictionary page scan.
daśalakṣaṇamfn. relating to 10 objects View this entry on the original dictionary page scan.
daśālakṣaṇan. Name of a chapter of View this entry on the original dictionary page scan.
daśalakṣaṇakamfn. tenfold View this entry on the original dictionary page scan.
daśalakṣaṇīf. "10 chs.", Name of kaṇāda-'s sūtra-s View this entry on the original dictionary page scan.
dāsamitrāyaṇabhaktan. dāsamitrāyaṇa
dāsamitribhaktan. dāsamitri
daśamukhāntakam. equals śaripu- View this entry on the original dictionary page scan.
daśamūtrakan. the urine of 10 (elephant, buffalo, camel, cow, goat, sleep, horse, donkey, man, and woman) View this entry on the original dictionary page scan.
daśamūtrakan. see View this entry on the original dictionary page scan.
daśanakhamfn. having ten finger-nails, View this entry on the original dictionary page scan.
daśanāmakaSee -mānika-. View this entry on the original dictionary page scan.
daśapakṣa(d/aś-) mf(ā-)n. having 10 side posts View this entry on the original dictionary page scan.
dāśārhakam. dāśārha
daśārhakam. plural (gaRa yāvādi- ) the daśārha-s View this entry on the original dictionary page scan.
dāśārṇakamf(ikā-)n. Dasharnic View this entry on the original dictionary page scan.
daśarūpakan. idem or 'n. Name of work on rhetorical and dramatic composition (also called daśarūpāloka loka-m.and daśarūpāvaloka valoka-m.)' on and View this entry on the original dictionary page scan.
daśarūpakan. the 10 kinds of dramas View this entry on the original dictionary page scan.
dāśarūpyakamfn. relating to it Va1rtt. 26 View this entry on the original dictionary page scan.
daśaśatakaradhārinmfn. thousand-rayed (the moon) View this entry on the original dictionary page scan.
dāsasyakulan. low people, the mob View this entry on the original dictionary page scan.
daśāsyāntakam. idem or 'm. "conqueror of rāvaṇa-", rāma- ' View this entry on the original dictionary page scan.
daśavaktram. Name of a magical formula pronounced over weapons View this entry on the original dictionary page scan.
dāśerakam. fisherman View this entry on the original dictionary page scan.
dāśerakam. plural Name of a people (equals daś-) View this entry on the original dictionary page scan.
dāśerakaa camel, . View this entry on the original dictionary page scan.
dāserakam. = dāseya-1 View this entry on the original dictionary page scan.
dāserakam. a fisherman (see dāś-) View this entry on the original dictionary page scan.
dāserakam. a camel Name of a man plural in fine compositi or 'at the end of a compound' his descendants View this entry on the original dictionary page scan.
dāserakam. of a people (see dāś-) View this entry on the original dictionary page scan.
daśerakam. an ass (see dasra-) View this entry on the original dictionary page scan.
daśerakam. plural Name of a people (equals maru-; see dāś- sg. their country ) (śair-derived fr. 2. daśa-) ; vii, 397 View this entry on the original dictionary page scan.
daśerakam. see agniveśa-- View this entry on the original dictionary page scan.
daśerakagaḍerakam. plural the descendants of daśera- and gaḍeraka- gaRa tika-kitavādi- () View this entry on the original dictionary page scan.
dāserakīf. a female camel View this entry on the original dictionary page scan.
dāserakim. patronymic fr. dāseraka- , View this entry on the original dictionary page scan.
dāsīmāṇavakam. female slaves and boys gaRa gavāśvādi-. View this entry on the original dictionary page scan.
dātṛpratīcchakam. dual number giver and receiver, . View this entry on the original dictionary page scan.
dattairaṇḍapallakaName of a district in the Deccan. View this entry on the original dictionary page scan.
dattakamfn. (with putra-) equals ttrima-, View this entry on the original dictionary page scan.
dattakam. a form of names terminating in -datta- , View this entry on the original dictionary page scan.
dattakam. Name of an author View this entry on the original dictionary page scan.
dattakam. of māgha-'s father View this entry on the original dictionary page scan.
dattakacandrikāf. Name of work View this entry on the original dictionary page scan.
dattakamīmāṃsāf. another work. View this entry on the original dictionary page scan.
dattakarṇamfn. in fine compositi or 'at the end of a compound' giving ear to, listening to View this entry on the original dictionary page scan.
dattakṣaṇamfn. to whom occasion or a festival has been given View this entry on the original dictionary page scan.
dattānapakarmann. non-delivery of gifts View this entry on the original dictionary page scan.
dattānapakarmann. see View this entry on the original dictionary page scan.
dattārdhacandrakamfn. ardhacandraka
dātyūhakam. a little gallinule View this entry on the original dictionary page scan.
dauhitrakamf(ī-)n. relating to a daughter's son View this entry on the original dictionary page scan.
daurātmyakamfn. wicked, evil (deed) View this entry on the original dictionary page scan.
dautyakan. dautya
davadagdhakaName of a grass View this entry on the original dictionary page scan.
davarakam. a string View this entry on the original dictionary page scan.
dāyādhikārakramasaṃgraham. Name of work View this entry on the original dictionary page scan.
dāyakamf(ikā-)n. giving, granting, bestowing View this entry on the original dictionary page scan.
dāyakamf(ikā-)n. imparting, communicating, uttering, telling View this entry on the original dictionary page scan.
dāyakamf(ikā-)n. fulfilling, causing, effecting (generally in fine compositi or 'at the end of a compound'; see agni--, uttara--, jñāna-- viṣa--). View this entry on the original dictionary page scan.
dāyakam. heir, kinsman View this entry on the original dictionary page scan.
dāyakālam. time of dividing an inheritance View this entry on the original dictionary page scan.
dāyakramasaṃgraham. Name of work View this entry on the original dictionary page scan.
dayāśamakaram. Name of a man. View this entry on the original dictionary page scan.
dāyatattvakṛtm. Name of an author. View this entry on the original dictionary page scan.
dehacatuṣṭayavyavasthālakṣaṇan. Name of work View this entry on the original dictionary page scan.
dehadhārakam. "body Supporter", bone
dehakaram. "body-former", a father View this entry on the original dictionary page scan.
dehakartṛm. idem or 'm. "body-former", a father ' View this entry on the original dictionary page scan.
dehakartṛm. Name of the sun View this entry on the original dictionary page scan.
dehakośam. "body-covering", skin or wing (see -dhi-). View this entry on the original dictionary page scan.
dehakṛtm. a father View this entry on the original dictionary page scan.
dehakṛtm. Name of śiva- View this entry on the original dictionary page scan.
dehakṣayam. "body-decay", sickness, disease View this entry on the original dictionary page scan.
dehalakṣaṇan. "body-mark", mole View this entry on the original dictionary page scan.
deharakṣāf. "care of the body", chastity View this entry on the original dictionary page scan.
deśakamfn. (in fine compositi or 'at the end of a compound') showing, pointing out View this entry on the original dictionary page scan.
deśakam. shower, indicator (san-mārga-- ; dharma-- varia lectio d-) View this entry on the original dictionary page scan.
deśakam. ruler, instructor View this entry on the original dictionary page scan.
deśakālam. dual number place and time View this entry on the original dictionary page scan.
deśakālam. (sg.) place and time for (genitive case) View this entry on the original dictionary page scan.
deśakālajñamfn. knowing place and time () View this entry on the original dictionary page scan.
deśakālavibhāgam. apportioning of place and time View this entry on the original dictionary page scan.
deśakālavidmfn. knowing place and time () View this entry on the original dictionary page scan.
deśakālavirodhinmfn. neglecting place and time View this entry on the original dictionary page scan.
deśakālavyatītamfn. regardless of place and time View this entry on the original dictionary page scan.
deśakālavyavasthitamfn. regulated by place and time View this entry on the original dictionary page scan.
deśakaṇṭakam. "country's thorn", public calamity View this entry on the original dictionary page scan.
deśakapaṭun. a mushroom View this entry on the original dictionary page scan.
deśakārīf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
deśāntaramṛtakriyānirūpaṇan. Name of work View this entry on the original dictionary page scan.
deśarakṣinm. protector of a country, king View this entry on the original dictionary page scan.
deśāvakāśikan. (with jaina-s) a particular vow or observance View this entry on the original dictionary page scan.
deśāvakāśikavratan. idem or 'n. (with jaina-s) a particular vow or observance' View this entry on the original dictionary page scan.
deśīprakāśam. Name of a dictionary of provincialisms Scholiast or Commentator on View this entry on the original dictionary page scan.
deśīyarājaśekharakośam. Name of work View this entry on the original dictionary page scan.
devabhakta(v/a--) mfn. distributed by the gods View this entry on the original dictionary page scan.
devabhaktif. service of the gods View this entry on the original dictionary page scan.
devacakran. a divine wheel View this entry on the original dictionary page scan.
devacakran. (with śākta-s)"the holy circle" , Name of a mystical diagram View this entry on the original dictionary page scan.
devacikitsakam. divine physician View this entry on the original dictionary page scan.
devacikitsakam. dual number the two aśvin-s View this entry on the original dictionary page scan.
devadattakam. plural the party led by deva-datta- View this entry on the original dictionary page scan.
devahiṃsakam. enemy of the gods View this entry on the original dictionary page scan.
devajagdhakan. "god-eaten", a kind of fragrant grass (equals kattṛṇa-) View this entry on the original dictionary page scan.
devakamf(ikā-)n. who or what sports or plays View this entry on the original dictionary page scan.
devakamf(ikā-)n. divine, celestial idem or 'mf(ikā-)n. who or what sports or plays ' View this entry on the original dictionary page scan.
devakam. (div-) a god, deity (at the end of an adjective (cf. mfn.) compound) (see daivaka-) View this entry on the original dictionary page scan.
devakam. Name of a man (?) View this entry on the original dictionary page scan.
devakam. of a gandharva- (at once a prince, son of āhuka- and father of devakī- [below] )
devakam. of a son of yudhi-ṣṭhira- and yaudheyī- or pauravī- (see vikā-below) View this entry on the original dictionary page scan.
devakam. familiar N. for deva-dattaka- View this entry on the original dictionary page scan.
devakam. plural Name of the śūdra-s in krauñca-dvīpa- View this entry on the original dictionary page scan.
devakāf. fam. for deva-dattikā- Va1rtt. 4 View this entry on the original dictionary page scan.
devakabhojaputrīf. patron. of devakī- View this entry on the original dictionary page scan.
devakaḍam. (for kṛta-?) Name of a grāma- (see devī-kṛti-). View this entry on the original dictionary page scan.
devakalaśam. Name of a man View this entry on the original dictionary page scan.
devakalpamfn. god-like View this entry on the original dictionary page scan.
devakāma(v/a-k-) mfn. loving the gods, pious View this entry on the original dictionary page scan.
devakamalapuran. Name of a town View this entry on the original dictionary page scan.
devakāñcanam. "divine gold", the tree Bauhinea Purpurea View this entry on the original dictionary page scan.
devakāntam. "god-loved"(?), magnet (see candra--, sūrya--). View this entry on the original dictionary page scan.
devakanyāf. idem or 'f. a celestial maiden, a nymph ' View this entry on the original dictionary page scan.
devakanyakāf. a celestial maiden, a nymph View this entry on the original dictionary page scan.
devakardamam. "divine paste", a fragrant paste of sandal, agallochum, camphor, and safflower View this entry on the original dictionary page scan.
devakarmam. master of divine or sacred work View this entry on the original dictionary page scan.
devakarmakṛtmfn. performing it View this entry on the original dictionary page scan.
devakarmann. religious act or rite, worship of the gods View this entry on the original dictionary page scan.
devakāryan. equals -karman- View this entry on the original dictionary page scan.
devakāryan. any matter concerning the gods, divine command View this entry on the original dictionary page scan.
devakāṣṭhan. "divine wood", Pinus devadāru- or some other kind of pine View this entry on the original dictionary page scan.
devakātmajāf. idem or 'f. patron. of devakī- ' View this entry on the original dictionary page scan.
devakavacan. divine armour (see devī--). View this entry on the original dictionary page scan.
devakhātamfn. "dug by the gods", hollow by nature View this entry on the original dictionary page scan.
devakhātan. (m. Scholiast or Commentator) a natural pond or reservoir View this entry on the original dictionary page scan.
devakhātan. a cave or cavern ( devakhātaka -ka- n. idem or 'n. (m. Scholiast or Commentator) a natural pond or reservoir ' ) View this entry on the original dictionary page scan.
devakhātabilan. cavern, chasm View this entry on the original dictionary page scan.
devakhātakan. devakhāta
devakhātatīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
devakīf. See below. View this entry on the original dictionary page scan.
devakīf. Name of a daughter of devaka- (See above) who was wife of vasu-deva- and mother of kṛṣṇa- (identified with a-diti- ;with dākṣāyaṇī- ) View this entry on the original dictionary page scan.
devakilbiṣan. offence against the gods View this entry on the original dictionary page scan.
devakīmātṛm. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīnandana(or kin-) m. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīputram. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakirīf. (in music) Name of a rāgiṇī- regarded as wife of megha-rāga- (see -girī-, deśa-karī-, goṇḍa-kirī-, rāma-k-). View this entry on the original dictionary page scan.
devakīrtim. Name of an astronomer View this entry on the original dictionary page scan.
devakīsūnum. Name of kṛṣṇa- View this entry on the original dictionary page scan.
devakīyamfn. (gaRa gahādi-) divine, belonging or relating to a divinity View this entry on the original dictionary page scan.
devakośam. divine cask or receptacle View this entry on the original dictionary page scan.
devakf. (in music) Name of a rāga- (see -kirī-). View this entry on the original dictionary page scan.
devakṛta(v/a-k-) mfn. made or done by the gods View this entry on the original dictionary page scan.
devakṛtyan. equals -kārya- View this entry on the original dictionary page scan.
devakṣatran. (v/a-k-) domain of the gods (-kṣetra-?) View this entry on the original dictionary page scan.
devakṣatram. Name of a prince (son of deva-rāta-) View this entry on the original dictionary page scan.
devakṣemam. Name of the author of the vijñāna-kāya- View this entry on the original dictionary page scan.
devakṣetran. domain of the gods View this entry on the original dictionary page scan.
devakulan. "deity-house", a temple etc. View this entry on the original dictionary page scan.
devakulāvāsam. plural buildings belonging to a temple View this entry on the original dictionary page scan.
devakulikam. attendant on a temple View this entry on the original dictionary page scan.
devakulikāf. a small temple, chapel View this entry on the original dictionary page scan.
devakulyāf. "river of the gods", personified as a daughter of pūrṇiman- and grand-daughter of marīci- View this entry on the original dictionary page scan.
devakulyāf. Name of the wife of ud-gītha- View this entry on the original dictionary page scan.
devakuṇḍan. a natural spring View this entry on the original dictionary page scan.
devakurum. Name of a people and country (associated with the uttara-k-) View this entry on the original dictionary page scan.
devakurumbāf. Name of a plant (equals mahādroṇa-) View this entry on the original dictionary page scan.
devakusuman. "divine flower", cloves View this entry on the original dictionary page scan.
devakūṭan. "divine peak", Name of a mountain View this entry on the original dictionary page scan.
devakyamfn. idem or 'mfn. (gaRa gahādi-) divine, belonging or relating to a divinity ' View this entry on the original dictionary page scan.
devakyamfn. godlike, corresponding to the number of the gods (said of the metre anuṣṭubh-) (varia lectio tya-). View this entry on the original dictionary page scan.
devalakṣman. divine characteristic View this entry on the original dictionary page scan.
devalakṣman. the Brahmanical cord View this entry on the original dictionary page scan.
devālayalakṣaṇan. Name of work View this entry on the original dictionary page scan.
devamānakam. equals -mañjara- View this entry on the original dictionary page scan.
devanakṣatran. Name of the first 14 nakṣatra-s in the southern quarter (pp. to yama--) View this entry on the original dictionary page scan.
devanakṣatram. Name of a king (varia lectio for va-kṣatra-). View this entry on the original dictionary page scan.
devanāyakam. Name of a man View this entry on the original dictionary page scan.
devanāyakapañcāśatf. Name of work View this entry on the original dictionary page scan.
devanāyakastutif. Name of work View this entry on the original dictionary page scan.
devanindakamfn. idem or 'mfn. hating the gods, a god-hater ' View this entry on the original dictionary page scan.
devanindakamfn. atheist or atheism View this entry on the original dictionary page scan.
devāntakam. Name of a rakṣas-
devāntakam. of a daitya- View this entry on the original dictionary page scan.
devāntakavadham. "destruction of deva-datta-", Name of 71st chapter of View this entry on the original dictionary page scan.
devaprakāśinīf. Name of work View this entry on the original dictionary page scan.
devapūjakam. worshipper of the gods View this entry on the original dictionary page scan.
devapūrvakamind. beginning with the gods View this entry on the original dictionary page scan.
devarakṣitam. "god-protected", Name of a son of devaka-
devarakṣitam. of a prince of the kosala-s View this entry on the original dictionary page scan.
devarakṣitam. of a Brahman View this entry on the original dictionary page scan.
devarakṣitāf. of a daughter of devaka- and one of the wives of vasu-deva- View this entry on the original dictionary page scan.
devaraktadaṃśīf. (in music) Name of a rāgiṇī-. View this entry on the original dictionary page scan.
devārcakam. worshipper of the gods View this entry on the original dictionary page scan.
devārcanakramapaddhatif. Name of work View this entry on the original dictionary page scan.
devasakham. friend or companion of the gods View this entry on the original dictionary page scan.
devasakhim. "id.", Name of a mountain (Bombay edition) iv, 43, 17. View this entry on the original dictionary page scan.
devaśaktim. "having divine strength", Name of a king View this entry on the original dictionary page scan.
devasomakam. Name of a man View this entry on the original dictionary page scan.
devasūkakṣetran. Name of a region of the northern pañcāla-s
devāsuragaṇāṇādhyakṣam. Name of śiva- View this entry on the original dictionary page scan.
devasyatvakamfn. containing the words devasyatvā- (as an adhyāya- or anuvāka-) gaRa goṣad-ādi-. View this entry on the original dictionary page scan.
devatāḍakam. devatāḍa
devatālakam. Lipeocercis Serrata (see -tāḍ-). View this entry on the original dictionary page scan.
devatāmūrtiprakaraṇan. Name of work on sculpture. View this entry on the original dictionary page scan.
devatārcanakramam. Name of several works. View this entry on the original dictionary page scan.
devātmaśaktif. the power of the soul View this entry on the original dictionary page scan.
devavaktran. "the mouth of the gods", Name of agni- as the devouring flame View this entry on the original dictionary page scan.
devavardhakim. "divine architect", Name of viśva-karman- View this entry on the original dictionary page scan.
devendrakīrtidevam. Name of a man View this entry on the original dictionary page scan.
devīmāhātmyamantravibhāgakramam. Name of work View this entry on the original dictionary page scan.
devīṃdhiyakamfn. containing the words devīṃ dhiyā- (as an adhyāya- or anuvāka-) gaRa goṣad-ādi-. View this entry on the original dictionary page scan.
devīpūjāprakaraṇan. Name of work View this entry on the original dictionary page scan.
devīrāpaka() (gaRa goṣad-ādi-) mfn. containing the words devīr āpas- (see --dhiyaka-). View this entry on the original dictionary page scan.
devīrāpasaka(gaRa goṣad-ādi-) mfn. containing the words devīr āpas- (see --dhiyaka-). View this entry on the original dictionary page scan.
devīśatakan. Name of work View this entry on the original dictionary page scan.
devopāsakam. worshipper of the gods View this entry on the original dictionary page scan.
devyaparādhakṣamāpaṇastotran. Name of work View this entry on the original dictionary page scan.
devyāryāśatakan. Name of work View this entry on the original dictionary page scan.
devyaṣṭakan. Name of work View this entry on the original dictionary page scan.
dhairyakalitamfn. assuming firmness or composure, steady, calm View this entry on the original dictionary page scan.
dhak Nominal verb fr. dagh- or dah- (see dakṣiṇa-dagh-and uś/a-dah-). View this entry on the original dictionary page scan.
dhakan exclamation of wrath View this entry on the original dictionary page scan.
dhakāram. the letter or sound dh-. View this entry on the original dictionary page scan.
ḍhakāram. the letter ḍh-. View this entry on the original dictionary page scan.
dhakitind. equals dhik- View this entry on the original dictionary page scan.
dhakk cl.10 P. dhakkayati-, to destroy, annihilate View this entry on the original dictionary page scan.
ḍhakkam. a large sacred building View this entry on the original dictionary page scan.
ḍhakkam. Name of a locality (see ṭakka-) Introd. View this entry on the original dictionary page scan.
ḍhakf. a large drum (see gaja--, jaya--) View this entry on the original dictionary page scan.
ḍhakf. covering, disappearance View this entry on the original dictionary page scan.
ḍhakkadeśīyamfn. spoken in the district of ḍhakka- View this entry on the original dictionary page scan.
ḍhakkanan. shutting (of a door) View this entry on the original dictionary page scan.
ḍhakkanam. Name of a man (varia lectio kkama-). View this entry on the original dictionary page scan.
ḍhakkārīf. Name of the goddess tārā- or tāriṇī-, View this entry on the original dictionary page scan.
dhakṣatand dh/akṣu- mfn. ( dah-) equals d/akṣat- and kṣu- View this entry on the original dictionary page scan.
dhamakam. "a blower", blacksmith (as blowing the forge) View this entry on the original dictionary page scan.
dhāmakam. a sort of weight (equals māṣaka-) View this entry on the original dictionary page scan.
dhāmakeśinmfn. "ray-haired"(the sun) View this entry on the original dictionary page scan.
dhammillakamf(ā-)n. in fine compositi or 'at the end of a compound' a woman's braided and ornamented hair wound round the head (satr-. wrong reading dhamilla-) View this entry on the original dictionary page scan.
dhanabhakṣam. plural booty and enjoyments View this entry on the original dictionary page scan.
dhanādhyakṣam. "overseer of treasury", treasurer View this entry on the original dictionary page scan.
dhanādhyakṣam. Name of kubera- View this entry on the original dictionary page scan.
dhanahārakamfn. with money View this entry on the original dictionary page scan.
dhanakam. avarice, covetousness View this entry on the original dictionary page scan.
dhanakam. Name of a yādava- (son of dur-dama- or dur-mada-) View this entry on the original dictionary page scan.
dhanakam. of another man View this entry on the original dictionary page scan.
dhānakan. coriander View this entry on the original dictionary page scan.
dhānakāf. plural diminutive fr. next View this entry on the original dictionary page scan.
dhāṇakam. (1. dhā-? see ) a weight of gold, part of a dīnāra- (see 2. dhān-) View this entry on the original dictionary page scan.
dhānakam. a particular coin of a certain weight (= 4 kārṣāpaṇas-) View this entry on the original dictionary page scan.
dhanakāma(dh/ana-.) mfn. desirous of wealth, covetous View this entry on the original dictionary page scan.
dhanakāmyamfn. desirous of wealth, covetous View this entry on the original dictionary page scan.
dhanakelim. "sporting with wealth", Name of kubera- View this entry on the original dictionary page scan.
dhanakośam. treasure of wealth or money View this entry on the original dictionary page scan.
dhanakrītāf. a woman bought with money View this entry on the original dictionary page scan.
dhanakrītī f. a woman bought with money View this entry on the original dictionary page scan.
dhanakṣayam. loss of money or property View this entry on the original dictionary page scan.
dhanakṣayam. Name of a man View this entry on the original dictionary page scan.
dhanaṃjayakośam. Name of dictionary View this entry on the original dictionary page scan.
dhānāphalavratakathāf. Name of work View this entry on the original dictionary page scan.
dhanarakṣam. keeping money, not spending it View this entry on the original dictionary page scan.
dhanarakakam. Name of kubera- View this entry on the original dictionary page scan.
dhanasyakam. Asteracantha Longifolia View this entry on the original dictionary page scan.
dhaneyakan. coriander seed (equals dhanyāka-) View this entry on the original dictionary page scan.
dhāneyakan. coriander View this entry on the original dictionary page scan.
dhanīyaka n. coriander seed (equals dhanyāka-) View this entry on the original dictionary page scan.
dhanuketakīf. a kind of flower View this entry on the original dictionary page scan.
dhanurmakha varia lectio for -maha-. View this entry on the original dictionary page scan.
dhanurvakramfn. crooked like a bow View this entry on the original dictionary page scan.
dhanurvaktram. "bow-mouth", Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
dhanurvedaprakaraṇan. Name of work View this entry on the original dictionary page scan.
dhanvantaripañcakan. Name of work View this entry on the original dictionary page scan.
dhanvayāsakam. idem or 'm. idem or 'm. Alhagi Maurorum ' ' View this entry on the original dictionary page scan.
dhanvayavāsakam. Alhagi Maurorum View this entry on the original dictionary page scan.
dhānyābhrakan. a particular preparation of talc View this entry on the original dictionary page scan.
dhanyakam. Name of a man View this entry on the original dictionary page scan.
dhānyakamfn. (in fine compositi or 'at the end of a compound' for dhānya-), grain, corn View this entry on the original dictionary page scan.
dhānyakam. Name of a man View this entry on the original dictionary page scan.
dhānyakan. equals dhānyāka-, coriander (see dhanyāka-). View this entry on the original dictionary page scan.
dhānyakalkam. bran, chaff, straw View this entry on the original dictionary page scan.
dhānyakartanan. "corn-reaping", Name of chapter of View this entry on the original dictionary page scan.
dhānyakaṭakaName of a country View this entry on the original dictionary page scan.
dhānyakhalam. threshing-floor View this entry on the original dictionary page scan.
dhānyakośa m. store of grain View this entry on the original dictionary page scan.
dhānyakośam. ear of corn View this entry on the original dictionary page scan.
dhānyakoṣam. store of grain View this entry on the original dictionary page scan.
dhānyakoṣam. ear of corn View this entry on the original dictionary page scan.
dhānyakoṣṭakan. equals -kūṭa- View this entry on the original dictionary page scan.
dhānyakṣetran. a corn-field, rice-field View this entry on the original dictionary page scan.
dhānyakūṭam. or n. granary View this entry on the original dictionary page scan.
dhānyapañcakan. the 5 sorts of grain (śāli-dhānya-, vrīhi--, śūka--, śimbī--, kṣudra--) View this entry on the original dictionary page scan.
dhānyaśīrṣakan. the ear of corn View this entry on the original dictionary page scan.
dhanyāṣṭakan. equals nya-stotra- View this entry on the original dictionary page scan.
dhārakamfn. equals prec. (in fine compositi or 'at the end of a compound'; see kula--, deha--, nāma--etc.) View this entry on the original dictionary page scan.
dhārakamfn. keeping in the memory (with genitive case) View this entry on the original dictionary page scan.
dhārakam. a receptacle or vessel for anything View this entry on the original dictionary page scan.
dhārakam. a water-pot View this entry on the original dictionary page scan.
dhārakāf. the vulva of a female View this entry on the original dictionary page scan.
dhāraka in fine compositi or 'at the end of a compound' equals prec. or next View this entry on the original dictionary page scan.
dhāraka see tri--. View this entry on the original dictionary page scan.
dhāralopakam. or n. Name of a particular observance View this entry on the original dictionary page scan.
dhāraṇakamfn. holding, containing, consisting of (see a--, pañca--) View this entry on the original dictionary page scan.
dhāraṇakam. a debtor View this entry on the original dictionary page scan.
dhāraṇalakṣaṇan. Name of work View this entry on the original dictionary page scan.
dhāraṇātmakamf(ikā-)n. (t-) that whose nature consists in bearing itself View this entry on the original dictionary page scan.
dhāraṇātmakamf(ikā-)n. one who easily collects or composes himself View this entry on the original dictionary page scan.
dharaṇīkīlakam. a mountain View this entry on the original dictionary page scan.
dharbakam. Name of a son of ajātaśatru- View this entry on the original dictionary page scan.
dharmabhāṇakam. law-expounder, preacher View this entry on the original dictionary page scan.
dharmabhāṇakam. lecturer, public reader of the and other sacred works. View this entry on the original dictionary page scan.
dharmābhiṣekakriyāf. any ablution prescribed as a religious duty View this entry on the original dictionary page scan.
dharmacakran. the wheel or range of the law View this entry on the original dictionary page scan.
dharmacakran. a particular mythical weapon View this entry on the original dictionary page scan.
dharmacakram. "having or turning the wheel of the law", a buddha- View this entry on the original dictionary page scan.
dharmacakrabhṛtm. "holding the wheel of the law", a buddha- or jaina- View this entry on the original dictionary page scan.
dharmacakrapravartanan. setting in motion the wheel of the law, ibidem or 'in the same place or book or text' as the preceding ; View this entry on the original dictionary page scan.
dharmacakṣusn. the eye of the law View this entry on the original dictionary page scan.
dharmacakṣusmfn. having an eye for the law or for what is right View this entry on the original dictionary page scan.
dharmacintakamfn. meditating on the law, familiar with it View this entry on the original dictionary page scan.
dharmadakṣiṇāf. fee for instruction in the law View this entry on the original dictionary page scan.
dharmadeśakam. teacher of the law (varia lectio d-). View this entry on the original dictionary page scan.
dharmādeśakaSee ma-d-. View this entry on the original dictionary page scan.
dharmadhātuparirakṣiṇīf. Name of a kiṃ-narī- View this entry on the original dictionary page scan.
dharmādhikārakāraṇikam. a judge () View this entry on the original dictionary page scan.
dharmādhikārakāraṇinm. a judge () View this entry on the original dictionary page scan.
dharmādhyakṣam. "overseer of justice", minister of justice, judge, magistrate View this entry on the original dictionary page scan.
dharmaghaṭavratakathāf. Name of work View this entry on the original dictionary page scan.
dharmakamfn. in fine compositi or 'at the end of a compound' = dh/arma-1 View this entry on the original dictionary page scan.
dharmakam. Name of a man View this entry on the original dictionary page scan.
dharmakālam. (kāya-?) a jina- View this entry on the original dictionary page scan.
dharmakāmamfn. loving justice, observing right View this entry on the original dictionary page scan.
dharmakāmam. Name of a demon, on (son of pāpīyas-) View this entry on the original dictionary page scan.
dharmakāmārtham. plural virtue, pleasure, and wealth View this entry on the original dictionary page scan.
dharmakāmārthasaṃbaddhamfn. joined with or containing virtue, pleasure, and wealth View this entry on the original dictionary page scan.
dharmakāmārthasambandham. alliance for virtue, pleasure, and wealth id est matrimony View this entry on the original dictionary page scan.
dharmakañcukam. or n. armour or garb of virtue View this entry on the original dictionary page scan.
dharmakañcukapraveśinmfn. putting it on , View this entry on the original dictionary page scan.
dharmakāṇḍam. n. Name of work View this entry on the original dictionary page scan.
dharmakāṅkṣiṇīf. Name of a gandharvī- and a kiṃ-narī- View this entry on the original dictionary page scan.
dharmakāram. "law-doer", Name of a man View this entry on the original dictionary page scan.
dharmakāraṇan. cause of virtue View this entry on the original dictionary page scan.
dharmakarmann. work of duty, pious action View this entry on the original dictionary page scan.
dharmakaropādhyāyam. Name of an author View this entry on the original dictionary page scan.
dharmakāryan. any act of duty or religion, good work, virtuous conduct View this entry on the original dictionary page scan.
dharmakathāf. discourse upon law etc. View this entry on the original dictionary page scan.
dharmakathakam. propounder of the law (varia lectio thika-) View this entry on the original dictionary page scan.
dharmakāyam. "law-body", Name of one of the 3 bodies of a buddha- View this entry on the original dictionary page scan.
dharmakāyam. "having the law for body", a buddha- View this entry on the original dictionary page scan.
dharmakāyam. a jaina- saint View this entry on the original dictionary page scan.
dharmakāyam. Name of avalokiteśvara- View this entry on the original dictionary page scan.
dharmakāyam. of a god of the bodhi- tree View this entry on the original dictionary page scan.
dharmaketum. "having justice for a banner", Name of a son of su-ketu- and father of satya-ketu- View this entry on the original dictionary page scan.
dharmaketum. a buddha- View this entry on the original dictionary page scan.
dharmaketum. a jaina- saint View this entry on the original dictionary page scan.
dharmakhaṇḍam. Name of work View this entry on the original dictionary page scan.
dharmakīlam. royal edict or grant (also -ka-) View this entry on the original dictionary page scan.
dharmakīlam. husband View this entry on the original dictionary page scan.
dharmakīrtim. "glory of the law", Name of a philosopher and poet View this entry on the original dictionary page scan.
dharmakīrtim. of a grammarian View this entry on the original dictionary page scan.
dharmakīrtim. of a king View this entry on the original dictionary page scan.
dharmakīrtim. Name (also title or epithet) of a teacher, View this entry on the original dictionary page scan.
dharmakośa m. the treasury or collective body of laws and duties View this entry on the original dictionary page scan.
dharmakośam. Name of work View this entry on the original dictionary page scan.
dharmakoṣam. the treasury or collective body of laws and duties View this entry on the original dictionary page scan.
dharmakoṣam. Name of work View this entry on the original dictionary page scan.
dharmakośavyākhyāf. Name of a View this entry on the original dictionary page scan.
dharmakṛcchran. a difficult point of duty or right View this entry on the original dictionary page scan.
dharmakrityan. fulfilment of duty, virtue, any moral or religious observance View this entry on the original dictionary page scan.
dharmakriyāf. observance of duties, pious work, righteous conduct View this entry on the original dictionary page scan.
dharmakṛtmfn. (2.See under 3. dharma-) doing one's duty, virtuous View this entry on the original dictionary page scan.
dharmakṛtm. maintainer of order (indra-) View this entry on the original dictionary page scan.
dharmakṣetran. "law-field" equals kuru-kṣetra-, q.v
dharmakṣetram. a man of piety and virtue View this entry on the original dictionary page scan.
dharmakṣetram. Name of a man View this entry on the original dictionary page scan.
dharmakūpam. "holy well", Name of a tīrtha- View this entry on the original dictionary page scan.
dharmakūṭam. Name of Scholiast or Commentator on View this entry on the original dictionary page scan.
dharmalakṣaṇan. an essential mark of law or ethics (as place, time etc.) View this entry on the original dictionary page scan.
dharmapāṭhakam. a teacher of law, lawyer View this entry on the original dictionary page scan.
dharmaprakāśam. Name of work View this entry on the original dictionary page scan.
dharmapraśnavyakhyāf. Name of a Comm. on it. View this entry on the original dictionary page scan.
dharmapratirūpakam. counterfeit of virtue View this entry on the original dictionary page scan.
dharmapravaktrim. teacher of law View this entry on the original dictionary page scan.
dharmaputrakam. adopted son (see pārvatī-dharmaputraka-). View this entry on the original dictionary page scan.
dharmarakṣitāf. "law-protected", Name of a female View this entry on the original dictionary page scan.
dharmāraṇyakhaṇḍamn. Name of work View this entry on the original dictionary page scan.
dharmāraṇyakulācāranirṇayam. Name of work View this entry on the original dictionary page scan.
dharmārthakāmamokṣam. plural religious merit, wealth, pleasure and final emancipation (the 4 objects of existence) View this entry on the original dictionary page scan.
dharmaśāstrakārikāf. Name of work View this entry on the original dictionary page scan.
dharmasmārakam. law-teacher. View this entry on the original dictionary page scan.
dharmasūtrakāram. dharmasūtra
dharmatattvaprakāśam. Name of work View this entry on the original dictionary page scan.
dharmavāṇijaka() m. one who tries to make a profit out of his virtue like a merchant. View this entry on the original dictionary page scan.
dharmavāṇijyaka() m. one who tries to make a profit out of his virtue like a merchant. View this entry on the original dictionary page scan.
dharmitāvacchedakapratyāsattif. Name of work
dharmitāvacchedakapratyāsattinirūpaṇan. Name of work
dharmitāvacchedakarahasyan. Name of work
dharmitāvacchedakatāvādam. Name of work
dharmitāvacchedakatāvādārtham. Name of work
dharmitāvacchedakavādam. Name of work
dharmopadeśakam. teacher of the law, spiritual preceptor View this entry on the original dictionary page scan.
dharmopaghātakamfn. "law-killing", unlawful View this entry on the original dictionary page scan.
dharṣakamfn. attacking, assailing (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
dharṣakamfn. overbearing View this entry on the original dictionary page scan.
dharṣakamfn. violating, seducing View this entry on the original dictionary page scan.
dharṣakam. seducer, adulterer View this entry on the original dictionary page scan.
dharṣakam. dancer, actor, mime View this entry on the original dictionary page scan.
dharṣakāriṇīf. a violated virgin View this entry on the original dictionary page scan.
dhārṣṇaka(wrong reading for dhārṣṇava-) mfn. descended fr. dhṛṣṇu- (varia lectio ṭaka-; see above) . View this entry on the original dictionary page scan.
dhārṣṭakamf(ī-)n. ( [ varia lectio ṣṇaka-] ) proceeding or descended fr. dhṛṣṭa-. View this entry on the original dictionary page scan.
dhārtarājñakamfn. View this entry on the original dictionary page scan.
dhaṭakam. a kind of weight = 14 Vallasor 42 raktikā-s View this entry on the original dictionary page scan.
dhātakan. equals dhāṭī- View this entry on the original dictionary page scan.
dhātakim. Name of one of the 2 sons of vīti-hotra- praiyavrata- (king of a varṣa- of puṣkara-dvīpa-) View this entry on the original dictionary page scan.
dhātakīf. Grislea Tomentosa View this entry on the original dictionary page scan.
dhātakikīkhaṇḍa n. Name of a varṣa- of puṣkara-dvīpa- ruled by dhātaki- View this entry on the original dictionary page scan.
dhātakikitīrthan. Name of a tīrtha- View this entry on the original dictionary page scan.
dhātakiṣaṇḍan. Name of a varṣa- of puṣkara-dvīpa- ruled by dhātaki- View this entry on the original dictionary page scan.
dhāṭīpañcaka n. Name of work View this entry on the original dictionary page scan.
dhātrīmodakam. a kind of pastille (in med.) View this entry on the original dictionary page scan.
dhattūrakam. dhattūra
dhattūrakāf. dhattūra
dhātudrāvakan. "dissolving metals"borax View this entry on the original dictionary page scan.
dhātugarbhakumbham. a relic-urn View this entry on the original dictionary page scan.
dhātukṣayakāsam. a consumptive cough View this entry on the original dictionary page scan.
dhātulakṣaṇan. Name of work on some Vedic verbs. View this entry on the original dictionary page scan.
dhātuprakaraṇan. Name of work View this entry on the original dictionary page scan.
dhātuprakāśam. Name of work View this entry on the original dictionary page scan.
dhātuprasaktamfn. devoted to alchemy View this entry on the original dictionary page scan.
dhātupratyayapañcakan. Name of work View this entry on the original dictionary page scan.
dhāturājakan. "chief fluid of the body", semen View this entry on the original dictionary page scan.
dhaumakam. (fr. dhūma- ) Name of a district View this entry on the original dictionary page scan.
dhaumatāyanaka gaRa arīhaṇādi- (not in ) View this entry on the original dictionary page scan.
dhauritakaand dhaurya- n. a horse's trot (see dhorita-, taka-). View this entry on the original dictionary page scan.
dhaurtakan. (fr. dhūrta-) roguery, knavery, fraud, gaRa manojñādi-. View this entry on the original dictionary page scan.
dhautakamfn. made of bleached or purified silk View this entry on the original dictionary page scan.
dhautakaṭam. a bag of coarse cloth View this entry on the original dictionary page scan.
dhautakauśeyan. bleached or purified silk (= pattrorṇa-) View this entry on the original dictionary page scan.
dhautakhaṇḍīf. sugar-candy View this entry on the original dictionary page scan.
dhautakośaja n. bleached or purified silk (= pattrorṇa-) View this entry on the original dictionary page scan.
dhautakuṣṭhan. a kind of leprosy View this entry on the original dictionary page scan.
dhautamūlakam. Name of a prince of the cīna-s View this entry on the original dictionary page scan.
dhauvakim. metron. fr. dhuvakā- gaRa bāhv-ādi-. View this entry on the original dictionary page scan.
dhāvakamfn. running View this entry on the original dictionary page scan.
dhāvakam. purato dh- forerunner View this entry on the original dictionary page scan.
dhāvakamfn. idem or 'm. See danta--.' View this entry on the original dictionary page scan.
dhāvakam. a washerman View this entry on the original dictionary page scan.
dhavalapakṣam. "white-winged", a goose (-vihaṃgama- idem or 'm. Name of work ' ) View this entry on the original dictionary page scan.
dhavalapakṣam. the light half of the month View this entry on the original dictionary page scan.
dhavalāṣṭakan. Name of a poem. View this entry on the original dictionary page scan.
dhavāṇakam. ( dhū-) wind, View this entry on the original dictionary page scan.
dhenudakṣiṇamfn. (sacrifice) whereat a cow is given as a fee View this entry on the original dictionary page scan.
dhenumakṣikāf. horse-fly, gad-fly View this entry on the original dictionary page scan.
dhīsakha() () m. wise counsellor, minister. View this entry on the original dictionary page scan.
dhīśaktif. mental or intellectual faculty View this entry on the original dictionary page scan.
dhītokakam. Name of a poet View this entry on the original dictionary page scan.
dhoritakan. a horse's trot View this entry on the original dictionary page scan.
dhrauvakim. metron. fr. dhruvakā- gaRa bāhvādi-. View this entry on the original dictionary page scan.
dhṛṣṭakam. Name of a prince (Calcutta edition ṣṇuka-) View this entry on the original dictionary page scan.
dhṛṣṭakakathāf. Name of work View this entry on the original dictionary page scan.
dhṛṣṭaketum. Name of a king of cedi- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a king of videhā- or mithilā- (son of su-dhṛti-) View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of satya-dhṛti- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of the son of sukumāra- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of his father View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of dhṛṣṭa-dyumna- View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a king of the kaikaya-s View this entry on the original dictionary page scan.
dhṛṣṭaketum. of a son of manu- View this entry on the original dictionary page scan.
dhṛtadakṣa(t/a--) mfn. of collected mind, attentive or constant View this entry on the original dictionary page scan.
dhṛtakam. Name of a saint or patriarch View this entry on the original dictionary page scan.
dhṛtakam. varia lectio for vrika- View this entry on the original dictionary page scan.
dhṛtakanakamālamfn. wearing a golden collar or wreath View this entry on the original dictionary page scan.
dhṛtakārmukeṣumfn. armed with bow and arrows View this entry on the original dictionary page scan.
dhṛtaketum. Name of a son of the 9th manu- View this entry on the original dictionary page scan.
dhṛtakleśam. undergoing hardships View this entry on the original dictionary page scan.
dhruvacakra n. Name of work View this entry on the original dictionary page scan.
dhruvāḍakan. a kind of dance (ṭaka-?). View this entry on the original dictionary page scan.
dhruvāḍakaSee above. View this entry on the original dictionary page scan.
dhruvakam. the unchangeable longitude of fixed stars View this entry on the original dictionary page scan.
dhruvakam. post, pale, stake View this entry on the original dictionary page scan.
dhruvakam. (in music) equals dhruvā- f. View this entry on the original dictionary page scan.
dhruvakam. Name of an attendant of skanda- View this entry on the original dictionary page scan.
dhruvakāf. (in music) equals dhruvā- f. (see dhuvakā-) View this entry on the original dictionary page scan.
dhruvakam. Name of a woman gaRa bāhv-ādi-. View this entry on the original dictionary page scan.
dhruvakabhāgam. (astronomy) equals dhruvaka- View this entry on the original dictionary page scan.
dhruvaketum. a kind of meteor View this entry on the original dictionary page scan.
dhruvakilamfn. See gaRa prekṣādi- and picchādi-. View this entry on the original dictionary page scan.
dhruvakin mfn. See gaRa prekṣādi- and picchādi-. View this entry on the original dictionary page scan.
dhruvakṣema(v/a--) mfn. firmly fixed, immovable View this entry on the original dictionary page scan.
dhruvakṣetran. Name of a place View this entry on the original dictionary page scan.
dhruvakṣitmfn. resting firmly View this entry on the original dictionary page scan.
dhruvakṣitimfn. (v/a--) having a firm position or abode View this entry on the original dictionary page scan.
dhruvakṣitim. a particular personification View this entry on the original dictionary page scan.
dhruvalakṣaṇan. "the mark of recurring verses", Name of chapter of View this entry on the original dictionary page scan.
dhruvatārakan. () the polar star. View this entry on the original dictionary page scan.
dhūligucchakam. the red powder thrown about at the Holi festival View this entry on the original dictionary page scan.
dhūliprakṣepam. the throwing of handful of dust View this entry on the original dictionary page scan.
dhūmakamfn. in fine compositi or 'at the end of a compound' equals dhūma-, smoke View this entry on the original dictionary page scan.
dhūmakam. a kind of pot-herb View this entry on the original dictionary page scan.
dhūmakapuṣpāf. a species of nettle View this entry on the original dictionary page scan.
dhūmaketanam. "smoke-marked", fire View this entry on the original dictionary page scan.
dhūmaketanam. meteor, a comet View this entry on the original dictionary page scan.
dhūmaketanam. ketu- or the personified descending node View this entry on the original dictionary page scan.
dhūmaketumfn. (m/a--) having smoke as banner or sign (agni- ;the sun ) View this entry on the original dictionary page scan.
dhūmaketum. fire View this entry on the original dictionary page scan.
dhūmaketum. a comet or falling star etc. View this entry on the original dictionary page scan.
dhūmaketum. the personified descending node View this entry on the original dictionary page scan.
dhūmaketum. Name of the sun View this entry on the original dictionary page scan.
dhūmaketum. of a yakṣa- wrong reading for dhūmra-k-. View this entry on the original dictionary page scan.
dhūmarakta(m/a-) mfn. coloured with smoke View this entry on the original dictionary page scan.
dhūmrakam. "the grey animal", a camel View this entry on the original dictionary page scan.
dhūmrakarṇam. a donkey, View this entry on the original dictionary page scan.
dhūmrakeśam. "dark-haired", Name of a son of pṛthu- and arcis- View this entry on the original dictionary page scan.
dhūmrakeśam. of a son of kṛśāśva- and arcis- View this entry on the original dictionary page scan.
dhūmrakeśam. of a dānava- View this entry on the original dictionary page scan.
dhūmraketum. "grey-bannered", Name of a son of bharata- View this entry on the original dictionary page scan.
dhūmraketum. of a son of tṛṇabindu- View this entry on the original dictionary page scan.
dhūmrasaṃraktalocanamfn. having dark-red or greyish-red eyes View this entry on the original dictionary page scan.
dhūmravarṇakam. the Indian fox View this entry on the original dictionary page scan.
dhūnakam. idem or 'm. the resin of Shorea Robusta ' View this entry on the original dictionary page scan.
dhūnakam. any resin View this entry on the original dictionary page scan.
dhūpakam. equals dhūpa-, especially in fine compositi or 'at the end of a compound' (See kṛtrima--, sa--) View this entry on the original dictionary page scan.
dhūpakam. preparer of incense, perfumer (see pika-). View this entry on the original dictionary page scan.
dhūpakaṭacchukan. a small spoon with frankincense View this entry on the original dictionary page scan.
dhūpavṛkṣakam. Pinus Longifolia View this entry on the original dictionary page scan.
dhūrtakamfn. cunning, crafty View this entry on the original dictionary page scan.
dhūrtakamfn. a cheat, rogue View this entry on the original dictionary page scan.
dhūrtakam. a jackal View this entry on the original dictionary page scan.
dhūrtakam. Name of a nāga- View this entry on the original dictionary page scan.
dhūrtakitavam. a gamester, sharper View this entry on the original dictionary page scan.
dhūrtakṛtm. thorn-apple View this entry on the original dictionary page scan.
dhūrtakṛtm. knave, rogue, cheat View this entry on the original dictionary page scan.
dhūrtanartakan. Name of a drama. View this entry on the original dictionary page scan.
dhūsarakam. Name of a jackal View this entry on the original dictionary page scan.
dhūtakalmaṣamfn. "whose sins are shaken off", pure View this entry on the original dictionary page scan.
dhūtapāpakan. Name of tīrtha-s View this entry on the original dictionary page scan.
dhuvakam. one who gets rid of a fetus (= garbha-mocaka-) View this entry on the original dictionary page scan.
dhuvakāf. the introductory stanza of a song (forming afterwards the burthen of each verse) (see gaRa prekṣādi-). View this entry on the original dictionary page scan.
dhuvakaetc. See under 1. dhu-. View this entry on the original dictionary page scan.
dhuvakilamfn. See gaRa prekṣādi- and picchādi-. View this entry on the original dictionary page scan.
dhuvakin mfn. See gaRa prekṣādi- and picchādi-. View this entry on the original dictionary page scan.
dhvajāgrakeyūram. "the ring on the top of a standard", Name of a particular samādhi- View this entry on the original dictionary page scan.
dhvaṃsakamfn. destroying, removing (see dakṣādhvara--) View this entry on the original dictionary page scan.
dhvaṃsakam. a particular disease (caused by overdrinking) View this entry on the original dictionary page scan.
dhvaṃsakalākṛ gaRa ūry-ādi-. View this entry on the original dictionary page scan.
dhvaṃsakārinmfn. (in fine compositi or 'at the end of a compound') destroying View this entry on the original dictionary page scan.
dhvaṃsakārinmfn. violating View this entry on the original dictionary page scan.
dhvanibodhaka m. a kind of grass (equals rohiṣa-) View this entry on the original dictionary page scan.
dhvāṅkṣanakf. Capparis Sepiaria View this entry on the original dictionary page scan.
dhvanyātmakamfn. inarticulate (sound) View this entry on the original dictionary page scan.
dhvastakamalamfn. (a pond) which has lost its lotus-flowers View this entry on the original dictionary page scan.
dhyāmakan. a participle kind of grass View this entry on the original dictionary page scan.
dhyānacakṣusn. the eye of meditation View this entry on the original dictionary page scan.
dhyānalakṣaṇan. "mark of meditation", Name of chapter of View this entry on the original dictionary page scan.
dhyānaśatakan. Name of work View this entry on the original dictionary page scan.
didhakmfn. Nominal verb dhak- ( dah- Desiderative), wishing to burn View this entry on the original dictionary page scan.
didhakṣāf. desire to burn View this entry on the original dictionary page scan.
didhakṣumfn. desirous of burning View this entry on the original dictionary page scan.
dīdhitiprakāśam. Name of Comm. View this entry on the original dictionary page scan.
dīdhitipratyakṣaṭikāf. Name of Comm. View this entry on the original dictionary page scan.
ḍiḍimāṇakam. Name of a bird of the pratuda- class View this entry on the original dictionary page scan.
ḍiḍimāṇakam. (ḍiṇḍimāṇava- ) View this entry on the original dictionary page scan.
digvakrasaṃsthamfn. standing apart from the right direction View this entry on the original dictionary page scan.
digvijayakramam. going forth to conquer the world, invasion View this entry on the original dictionary page scan.
dikcakran. the circuit of the quarter of the compass, the horizon View this entry on the original dictionary page scan.
dikcakran. the compass, the whole world View this entry on the original dictionary page scan.
dikcakravālan. the whole range of sight, the scenery all around View this entry on the original dictionary page scan.
dīkṣakam. a priest, spiritual guide View this entry on the original dictionary page scan.
dīkṣakam. Name of a king View this entry on the original dictionary page scan.
dīkṣāprakaraṇan. Name of work View this entry on the original dictionary page scan.
dīkṣitabālakṛṣṇam. View this entry on the original dictionary page scan.
diksraktimfn. having the angles or corners towards the quarters of the compass Scholiast or Commentator on View this entry on the original dictionary page scan.
dikśūlalakṣaṇan. Name of chapter of the View this entry on the original dictionary page scan.
ḍimbhacakran. Name of a mystical diagram. View this entry on the original dictionary page scan.
ḍimbhakam. a new-born child, young animal (in Prakrit varia lectio) View this entry on the original dictionary page scan.
ḍimbhakam. Name of a general of jarā-saṃdha- View this entry on the original dictionary page scan.
dīnadakṣa(n/a--) mfn. of weak understanding View this entry on the original dictionary page scan.
ḍīnaḍīnakan. flying reiteratedly
dīnakamfn. very miserable or dejected View this entry on the original dictionary page scan.
dīnakamind. very miserably View this entry on the original dictionary page scan.
dinakaramf(ī-)n. making day or light View this entry on the original dictionary page scan.
dinakaram. the sun etc. View this entry on the original dictionary page scan.
dinakaram. Name of an āditya- View this entry on the original dictionary page scan.
dinakaram. of the author of the work candrārkī- View this entry on the original dictionary page scan.
dinakaram. of a Scholiast or Commentator on (miśra-d-) View this entry on the original dictionary page scan.
dinakaram. of other men View this entry on the original dictionary page scan.
dinakarabhaṭṭam. Name of an author View this entry on the original dictionary page scan.
dinakarabhaṭṭīyan. his work View this entry on the original dictionary page scan.
dinakaradevam. Name of a poet View this entry on the original dictionary page scan.
dinakaratanayam. "son of the sun", the planet Saturn View this entry on the original dictionary page scan.
dinakaraṭippanīf. Name of a commentator or commentary View this entry on the original dictionary page scan.
dinakarātmajam. "daughter of the sun" patronymic of the yamunā- View this entry on the original dictionary page scan.
dinakarīf. (scilicet ṭīkā-) Name of commentator or commentary on the and siddhānta-muktāvalī- View this entry on the original dictionary page scan.
dinakarīyan. Name of work View this entry on the original dictionary page scan.
dinakaroddyotam. Name of work View this entry on the original dictionary page scan.
dinakartavyan. "day-duty", ceremonies to be performed daily View this entry on the original dictionary page scan.
dinakartṛm. "day-maker", the sun View this entry on the original dictionary page scan.
dinakāryan. equals -kartavya- View this entry on the original dictionary page scan.
dinakesara(also written śara-) m. "day-hair", darkness View this entry on the original dictionary page scan.
dinakeśava m. "day-hair", darkness View this entry on the original dictionary page scan.
dinakṛtm. equals -kartṛ- etc. View this entry on the original dictionary page scan.
dinakṛtsutam. equals -karatanaya- View this entry on the original dictionary page scan.
dinakṛtyan. equals -kartavya- (printed diva-k-) View this entry on the original dictionary page scan.
dinakṣayam. "day-decline", evening View this entry on the original dictionary page scan.
dinakṣayam. equals tithi-- View this entry on the original dictionary page scan.
dinakṣayam. Name of a chapter of View this entry on the original dictionary page scan.
dinanaktamind. by day and night View this entry on the original dictionary page scan.
dinānśakam. "day-portion", day-time View this entry on the original dictionary page scan.
dināntakam. "day-destroyer", darkness View this entry on the original dictionary page scan.
dīnārakam. View this entry on the original dictionary page scan.
dīnasādhakam. "causing woe", Name of śiva- View this entry on the original dictionary page scan.
ḍiṇḍiramodakan. garlic View this entry on the original dictionary page scan.
dīpakamfn. kindling, inflaming, illuminating View this entry on the original dictionary page scan.
dīpakamfn. exciting, stimulating (digestion) View this entry on the original dictionary page scan.
dīpakamfn. skilful in managing a lamp (gaRa ākarṣādi-) View this entry on the original dictionary page scan.
dīpakam. a light, lamp View this entry on the original dictionary page scan.
dīpakam. the shining body, View this entry on the original dictionary page scan.
dīpakam. Name of two plants having digestive properties, Ptychotis Ajowan or Celosia cristata View this entry on the original dictionary page scan.
dīpakam. a bird of prey View this entry on the original dictionary page scan.
dīpakam. (in music) Name of a rāga- View this entry on the original dictionary page scan.
dīpakam. a kind of measure View this entry on the original dictionary page scan.
dīpakam. Name of kāma- (the inflamer) View this entry on the original dictionary page scan.
dīpakam. of a son of garuḍa- () etc. View this entry on the original dictionary page scan.
dīpakam. or n. saffron View this entry on the original dictionary page scan.
dīpakan. a particular class of rhetoric figures (throwing light upon an idea) View this entry on the original dictionary page scan.
dīpakan. Name of a metre View this entry on the original dictionary page scan.
dīpakalikāf. Name of a commentator or commentary on View this entry on the original dictionary page scan.
dīpakamālāf. Name of a metre. View this entry on the original dictionary page scan.
dīpakarpūrajam. a kind of camphor View this entry on the original dictionary page scan.
dīpakavyākaraṇan. Name of work View this entry on the original dictionary page scan.
dīpakhorif. the wick of a lamp-black View this entry on the original dictionary page scan.
dīpakiṭṭan. lamp-black, soot View this entry on the original dictionary page scan.
dīpakūpīf. View this entry on the original dictionary page scan.
dīpālikakalpam. Name of work View this entry on the original dictionary page scan.
dīpaprakāśam. Name of work View this entry on the original dictionary page scan.
dīpikāprakāśam. View this entry on the original dictionary page scan.
dīpikāprakāśikāf. View this entry on the original dictionary page scan.
dīptakam. or n. a kind of disease of the nose View this entry on the original dictionary page scan.
dīptakan. gold View this entry on the original dictionary page scan.
dīptaketum. "bright-bannered", Name of a king View this entry on the original dictionary page scan.
dīptaketum. of a son of manu- dakṣa-sāvarṇi-
dīptakiraṇamfn. "hot-rayed", he sun View this entry on the original dictionary page scan.
dīptakīrtimfn. "bright-famed" View this entry on the original dictionary page scan.
dīptakīrtimfn. Name of skanda- View this entry on the original dictionary page scan.
dīptaśaktim. "having a glittering spear", Name of skanda- View this entry on the original dictionary page scan.
dīpyakam. a species of plant View this entry on the original dictionary page scan.
dīpyakam. Celosia Cristata View this entry on the original dictionary page scan.
dīpyakamn. Ptychotis Ajowan View this entry on the original dictionary page scan.
dīpyakan. Apium Involucratum View this entry on the original dictionary page scan.
dīpyakan. a figure of rhetoric View this entry on the original dictionary page scan.
dīrghadaṇḍakam. Ricinus Communis View this entry on the original dictionary page scan.
dīrghajīrakam. cumin View this entry on the original dictionary page scan.
dīrghakālam. a long time View this entry on the original dictionary page scan.
dīrghakālajīvinmfn. long-lived View this entry on the original dictionary page scan.
dīrghakaṃdharāf. equals -kaṇṭhaka- View this entry on the original dictionary page scan.
dīrghakaṇāf. white cumin View this entry on the original dictionary page scan.
dīrghakāṇḍam. "having long joints", the root of Scirpus Kysoor View this entry on the original dictionary page scan.
dīrghakāṇḍāf. a sort of creeper View this entry on the original dictionary page scan.
dīrghakandakan. "having long bulbs", a kind of radish (equals mūlaka-) View this entry on the original dictionary page scan.
dīrghakandikāf. Curculigo Orchioides (equals muṣalī-) View this entry on the original dictionary page scan.
dīrghakaṇṭam. "long-thorned", Name of a plant (equals varvūra-) View this entry on the original dictionary page scan.
dīrghakaṇṭakam. "long-thorned", Name of a plant (equals varvūra-) View this entry on the original dictionary page scan.
dīrghakaṇṭham. "long-necked", Name of a dānava- (varia lectio -bāhu-). View this entry on the original dictionary page scan.
dīrghakaṇṭhakam. Ardea Nivea View this entry on the original dictionary page scan.
dīrghakarṇam. "long-ear", Name of a cat View this entry on the original dictionary page scan.
dīrghakarṣaṇan. a sort of svara- View this entry on the original dictionary page scan.
dīrghakāṣṭhan. a long piece of timber, spar, beam View this entry on the original dictionary page scan.
dīrghakāyamfn. "long-bodied", tall View this entry on the original dictionary page scan.
dīrghakeśamf(ī-)n. "long-haired" View this entry on the original dictionary page scan.
dīrghakeśam. a bear View this entry on the original dictionary page scan.
dīrghakeśam. plural Name of a people. View this entry on the original dictionary page scan.
dīrghakīla m. "long-stemmed", Alangium Hexapetalum (equals aṅkoṭa-) = View this entry on the original dictionary page scan.
dīrghakīlakam. "long-stemmed", Alangium Hexapetalum (equals aṅkoṭa-) = View this entry on the original dictionary page scan.
dīrghakośāf. a kind of muscle shell, a cockle View this entry on the original dictionary page scan.
dīrghakośīf. a kind of muscle shell, a cockle View this entry on the original dictionary page scan.
dīrghakośikā f. a kind of muscle shell, a cockle View this entry on the original dictionary page scan.
dīrghakūrakan. "long rice", a kind of rice (equals rājānna-)
dīrghakūrcamfn. "long-bearded" View this entry on the original dictionary page scan.
dīrghamūlakan. a kind of radish View this entry on the original dictionary page scan.
dīrghanakhamf(ī-)n. having long nails View this entry on the original dictionary page scan.
dīrghanakham. Name of a man View this entry on the original dictionary page scan.
dīrghanakf. Diospyros Embryopteris View this entry on the original dictionary page scan.
dīrghapakṣam. "long-winged", the fork-tailed shrike View this entry on the original dictionary page scan.
dīrghapattrakam. a kind of sugar-cane View this entry on the original dictionary page scan.
dīrghapattrakam. a kind of garlic (equals rakta-lasuna-) View this entry on the original dictionary page scan.
dīrghapattrakam. Ricinus Communis View this entry on the original dictionary page scan.
dīrghapattrakam. Barringtonia Acutangula View this entry on the original dictionary page scan.
dīrghapattrakam. a kind of reed View this entry on the original dictionary page scan.
dīrghapattrakam. Capparis Aphylla View this entry on the original dictionary page scan.
dīrghapattrakam. equals jalaja-madhūka-
dīrghaphalakam. Agati Grandiflora View this entry on the original dictionary page scan.
dīrgharohiṣakam.</